Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0K004108.840ON62662633250.0
NCAS0C004108.840ON62561722790.0
YMR278W (PGM3)8.840ON62261920310.0
KNAG0J002708.840ON62562020260.0
Suva_13.4668.840ON62261920250.0
Kpol_1068.88.840ON63262220190.0
TDEL0B005708.840ON63061920100.0
Smik_13.4918.840ON62261520050.0
Skud_13.4508.840ON62261420010.0
TPHA0I002508.840ON62962019920.0
ZYRO0G14190g8.840ON61062019840.0
CAGL0M02981g8.840ON61761819840.0
SAKL0D01474g8.840ON62462319540.0
TBLA0B032508.840ON64363719540.0
KAFR0B039208.840ON62462519410.0
Kwal_27.102588.840ON62062518360.0
KLLA0D01573g8.840ON60762518330.0
KLTH0C03872g8.840ON62163018260.0
ABL126W8.840ON62462717350.0
Ecym_46118.840ON63062716830.0
KNAG0E023902.445ON5692581000.002
TPHA0G029002.445ON569294980.003
TBLA0G009806.11ON55835970.005
Suva_13.2822.445ON569256940.010
CAGL0B03597g6.11ON54036940.010
Kwal_26.76282.445ON570418940.010
Smik_13.2912.445ON569295930.012
TPHA0M002106.11ON54593930.014
NDAI0H023502.445ON569252930.014
YMR105C (PGM2)2.445ON569252910.020
NDAI0K028906.11ON56131910.021
TDEL0A022102.445ON572291910.021
NCAS0F014702.445ON569254910.024
NCAS0F002006.11ON54928900.026
KAFR0L003406.11ON54028900.027
Kpol_1032.26.11ON53976900.031
TDEL0G046006.11ON52828890.033
KNAG0E009406.11ON538117890.037
Smik_5.296.11ON55573880.052
KLTH0D04796g2.445ON570376870.060
CAGL0K03421g2.445ON568252870.069
ZYRO0F00506g6.11ON55024870.069
Smik_2.3338.551ON218128850.070
Suva_5.106.11ON55350870.073
YEL058W (PCM1)6.11ON55762860.083
Kpol_1033.542.445ON570302860.088
Skud_5.316.11ON55728850.10
ACR015W6.11ON55240850.12
KAFR0D030102.445ON569251840.14
YBR193C (MED8)8.551ON223128820.15
Skud_13.2632.445ON569299840.16
ABL029W2.445ON568298810.32
SAKL0E03630g2.445ON571303810.34
KLLA0D00858g6.11ON54119810.34
SAKL0E00902g6.11ON54419810.34
Kwal_56.223556.11ON54125810.37
KLTH0C11506g6.11ON54420800.41
TPHA0G024702.445ON569297800.49
Skud_2.3198.551ON220128770.55
NCAS0A043502.445ON569252790.57
KNAG0A062802.445ON570301790.63
Suva_4.4478.551ON227130760.85
Suva_11.982.445ON570298780.86
TDEL0E00210singletonON570251780.90
Skud_11.1022.445ON570298761.2
TBLA0B090102.445ON569294751.7
ZYRO0G02508g2.445ON569607751.7
Ecym_30146.11ON55137751.8
KAFR0K010907.130ON21553722.5
YKL127W (PGM1)2.445ON570297732.8
KAFR0A042008.740ON26055722.9
TBLA0I013802.445ON571249732.9
Skud_2.2918.518ON58050733.2
CAGL0K07480g2.445ON567293707.8
Kpol_1002.416.233ON1168173707.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0K00410
         (626 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...  1285   0.0  
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...   882   0.0  
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...   786   0.0  
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...   785   0.0  
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...   784   0.0  
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...   782   0.0  
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...   778   0.0  
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...   776   0.0  
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...   775   0.0  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...   771   0.0  
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...   768   0.0  
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...   768   0.0  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...   757   0.0  
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...   757   0.0  
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...   752   0.0  
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...   711   0.0  
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...   710   0.0  
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...   707   0.0  
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...   672   0.0  
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...   652   0.0  
KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.4...    43   0.002
TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON}               42   0.003
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...    42   0.005
Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {...    41   0.010
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...    41   0.010
Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C...    41   0.010
Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {...    40   0.012
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...    40   0.014
NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {O...    40   0.014
YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON} ...    40   0.020
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....    40   0.021
TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.4...    40   0.021
NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {O...    40   0.024
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...    39   0.026
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...    39   0.027
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...    39   0.031
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...    39   0.033
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...    39   0.037
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)    39   0.052
KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly...    38   0.060
CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa] ...    38   0.069
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...    38   0.069
Smik_2.333 Chr2 complement(595382..596038) [657 bp, 218 aa] {ON}...    37   0.070
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)    38   0.073
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...    38   0.083
Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON} (1362...    38   0.088
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)    37   0.10 
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...    37   0.12 
KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.4...    37   0.14 
YBR193C Chr2 complement(609082..609753) [672 bp, 223 aa] {ON}  M...    36   0.15 
Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {...    37   0.16 
ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic ho...    36   0.32 
SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {...    36   0.34 
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...    36   0.34 
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...    36   0.34 
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...    36   0.37 
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...    35   0.41 
TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.4...    35   0.49 
Skud_2.319 Chr2 complement(576416..577078) [663 bp, 220 aa] {ON}...    34   0.55 
NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.4...    35   0.57 
KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON}               35   0.63 
Suva_4.447 Chr4 complement(779289..779972) [684 bp, 227 aa] {ON}...    34   0.85 
Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C...    35   0.86 
TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445...    35   0.90 
Skud_11.102 Chr11 (190406..192118) [1713 bp, 570 aa] {ON} YKL127...    34   1.2  
TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa] ...    33   1.7  
ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly...    33   1.7  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...    33   1.8  
KAFR0K01090 Chr11 complement(226784..227431) [648 bp, 215 aa] {O...    32   2.5  
YKL127W Chr11 (203541..205253) [1713 bp, 570 aa] {ON}  PGM1Phosp...    33   2.8  
KAFR0A04200 Chr1 complement(842429..843211) [783 bp, 260 aa] {ON...    32   2.9  
TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {O...    33   2.9  
Skud_2.291 Chr2 (533122..534864) [1743 bp, 580 aa] {ON} YBR163W ...    33   3.2  
CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa] ...    32   7.8  
Kpol_1002.41 s1002 (121367..124873) [3507 bp, 1168 aa] {ON} (121...    32   7.9  

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 1285 bits (3325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/626 (98%), Positives = 616/626 (98%)

Query: 1   MSSIPSIICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGT 60
           MSSIPSIICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGT
Sbjct: 1   MSSIPSIICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGT 60

Query: 61  AGLRSRMEAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASV 120
           AGLRSRMEAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASV
Sbjct: 61  AGLRSRMEAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASV 120

Query: 121 FLRVGFKVYYLNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQI 180
           FLRVGFKVYYLNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQI
Sbjct: 121 FLRVGFKVYYLNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQI 180

Query: 181 IPPHDKNIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSS 240
           IPPHDKNIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSS
Sbjct: 181 IPPHDKNIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSS 240

Query: 241 SISRPNNNGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVS 300
           SISRPNNNGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVS
Sbjct: 241 SISRPNNNGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVS 300

Query: 301 FPNPEEKGALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFA 360
           FPNPEEKGALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFA
Sbjct: 301 FPNPEEKGALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFA 360

Query: 361 SFELEKYMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDL 420
           SFELEKYMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDL
Sbjct: 361 SFELEKYMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDL 420

Query: 421 QGQGYYVPFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEXXXXX 480
           QGQGYYVPFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILE     
Sbjct: 421 QGQGYYVPFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEKGFKK 480

Query: 481 XXXXXEYNGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSN 540
                EYNGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSN
Sbjct: 481 FGFFKEYNGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSN 540

Query: 541 TIDNLPNLPVDPHSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAI 600
           TIDNLPNLPVDPHSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAI
Sbjct: 541 TIDNLPNLPVDPHSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAI 600

Query: 601 DLAYEMWNVLKKEWIRPDVTGLTTTF 626
           DLAYEMWNVLKKEWIRPDVTGLTTTF
Sbjct: 601 DLAYEMWNVLKKEWIRPDVTGLTTTF 626

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  882 bits (2279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/617 (66%), Positives = 493/617 (79%), Gaps = 2/617 (0%)

Query: 11  DCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRMEAG 70
           +CP NLRE I+LWLR D+ EETR EV+QLC++ NW ELH+RFD+RIVFGTAGLRSRMEAG
Sbjct: 10  NCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRMEAG 69

Query: 71  FSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFKVYY 130
           FSRMN L+ILQ++QGLA YIK QFP NLTAVVGHDHRFHSK+FA++TAS+FLR GFKV+Y
Sbjct: 70  FSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKVFY 129

Query: 131 LNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKNIAA 190
           L P+D FVHTPLVPFSV +L AS+GVMITASHNPKMDNGYKVYY N CQIIPPHDKNIA 
Sbjct: 130 LTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIAE 189

Query: 191 TIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNNNGK 250
            I +NLEPWS+ W+WD+TF+K L+  KLV++++ MT KYL  MK +L+ SS      + K
Sbjct: 190 MIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSS-HLSLKDVK 248

Query: 251 KPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGAL 310
            P+FVYTPMHGVG  IF K+S  +L+  EN+DY VV EQ  PDP+FPTVSFPNPEEKGAL
Sbjct: 249 TPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEEKGAL 308

Query: 311 SLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKYMSQ 370
           SLA KLA+EN +SLVIANDPDADRFS A  N+KTG+W+QL+GNEIGFL   +E + Y  Q
Sbjct: 309 SLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQLYEQQ 368

Query: 371 DIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYYVPFG 430
           D+ +R+THPLAMINSTVSSQMIK+MA +  FHYEDTLTGFKWIGN+A+DL+ +GYYVPFG
Sbjct: 369 DVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYYVPFG 428

Query: 431 FEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEXXXXXXXXXXEYNGY 490
           FEEAIGYMFP M  DKDG+SAA VFL AY +W+N     PFDI+E          EYNGY
Sbjct: 429 FEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKEYNGY 488

Query: 491 YIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPNLPV 550
           YI  D   TK +FDF+R++Y ++   YP  IG E  + VFRDLT GYQSNT DN+PNLPV
Sbjct: 489 YILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIPNLPV 548

Query: 551 DPHSEMITIEAVPKQDIG-KSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEMWNV 609
           DP S+MIT+EA P +    +  VR TMRGSGTEPKLK+YIEA + +E+ A +LA   W++
Sbjct: 549 DPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLARSTWDI 608

Query: 610 LKKEWIRPDVTGLTTTF 626
           LK+EW RP+VTGLTT+F
Sbjct: 609 LKREWFRPEVTGLTTSF 625

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/619 (60%), Positives = 463/619 (74%), Gaps = 1/619 (0%)

Query: 8   ICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRM 67
           I +  P++L++ I LW +QD+  +T  EV  LCK S+W ELHKRFDSRI FGTAGLRS+M
Sbjct: 5   ILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQM 64

Query: 68  EAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFK 127
           +AGFSRMN LV++QASQGLA Y++ QFP NL AVVGHDHRFHSK+FA  TA+ FL  GFK
Sbjct: 65  QAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFK 124

Query: 128 VYYLNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKN 187
           V+YLNP+  FVHTPLVPF+V+ L AS+GVMITASHNPKMDNGYKVYYSNGCQIIPPHD  
Sbjct: 125 VHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHA 184

Query: 188 IAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNN 247
           I+ +ID NLEPW++ W++D    K LK+ KL+Y REEM   YL+ +   LV  +  +   
Sbjct: 185 ISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPLKLEV 244

Query: 248 NGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEK 307
             K PWFVYTPMHGVG++IF+ I K  L   E  DY  V EQ  PDP+FPTV FPNPEEK
Sbjct: 245 KAK-PWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEK 303

Query: 308 GALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKY 367
           GAL +   LAE+++I L++ANDPDADRFSVA K+ ++G+W+QL+GNEIGFLFA +E +KY
Sbjct: 304 GALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEYQKY 363

Query: 368 MSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYYV 427
            S D E++  HPLAM+NSTVSSQMIKKMA++E FHYEDTLTGFKWIGNRA+ L+ +GYYV
Sbjct: 364 KSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKGYYV 423

Query: 428 PFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEXXXXXXXXXXEY 487
           PFGFEEAIGYMFP M  DKDG+SA++VFL AY  W  +    P ++LE          EY
Sbjct: 424 PFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVFKEY 483

Query: 488 NGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPN 547
           NGYY+  +P  TK IFD++R  Y   G  YP +IG+E ++  +RDLTTGYQS+TI++ P 
Sbjct: 484 NGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPT 543

Query: 548 LPVDPHSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEMW 607
           LPVDP S+MIT+ A P        +RFT+RGSGTEPKLK+YIEA A+ E+ A  LA   W
Sbjct: 544 LPVDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAKLTW 603

Query: 608 NVLKKEWIRPDVTGLTTTF 626
           NVL++EW RPD   + T F
Sbjct: 604 NVLRREWFRPDEMNIVTKF 622

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/620 (59%), Positives = 466/620 (75%), Gaps = 3/620 (0%)

Query: 8   ICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRM 67
           I  + P  L+  I  WLR DK EETR EV+ LC+  +W EL+ RF  RI+FGTAGLRSRM
Sbjct: 8   ILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRM 67

Query: 68  EAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFK 127
           EAG +R+N LVILQA+QGLA+YI +QFP N  AVVGHDHRFHSK+FA +TA+VFLR GFK
Sbjct: 68  EAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFK 127

Query: 128 VYYLNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKN 187
           V YLNP D+ VHTPLVPF+V+HLNAS+GVMITASHNPKMDNGYKVY++NGCQIIPPHD N
Sbjct: 128 VLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLN 187

Query: 188 IAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNN 247
           IA +ID+NLEPW   W+W +  +   KE ++VYV+++MT  Y +  +  L+        N
Sbjct: 188 IARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGR-KVLRN 246

Query: 248 NGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEK 307
            G  PWFVYTPMHGVG  IF++IS+++L  +EN DY  V EQ +PDP+FPTVSFPNPEEK
Sbjct: 247 PGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEEK 306

Query: 308 GALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKY 367
           GAL  A +LA +N I+LVIANDPDADRFS+A  + KT  W+QL+GNEIGFLFA  + E Y
Sbjct: 307 GALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMY 366

Query: 368 MSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYYV 427
            + D  +++ HPL ++NSTVSSQMIKKMA+VE FHYEDTLTGFKWIGNRA DL+ +G++ 
Sbjct: 367 KAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFA 426

Query: 428 PFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEXXXXXXXXXXEY 487
           PFG+EEAIGYMF  M  DKDG+SA+++FLL+Y +W+ +   +P DILE          EY
Sbjct: 427 PFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEY 486

Query: 488 NGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPN 547
           NGYYI D+PK  K+ FD++R      G  YP+ IG EF++  FRDLT G+QS+T D++P 
Sbjct: 487 NGYYIVDNPKIMKETFDYIRNDR-KPGTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIPT 545

Query: 548 LPVDPHSEMITIEAVPKQD-IGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEM 606
           LPVDP+S+MIT+ A P  D + +  VRFT+RGSGTEPKLK+YIEA + +E  A  LA +M
Sbjct: 546 LPVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQM 605

Query: 607 WNVLKKEWIRPDVTGLTTTF 626
           W+ L++ W RP  TGL T F
Sbjct: 606 WDTLQEVWFRPQTTGLVTDF 625

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/619 (60%), Positives = 463/619 (74%), Gaps = 1/619 (0%)

Query: 8   ICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRM 67
           + +  P++L+  I LW  QD+  ET  EV  LCK+S+W ELHKRFD+RI FGTAGLRS M
Sbjct: 5   LLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSEM 64

Query: 68  EAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFK 127
           +AGFSRMN LVI+QA+QGLA YIK QFP NL  VVGHDHRFHSK+FA  TA+ FL  GFK
Sbjct: 65  QAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGFK 124

Query: 128 VYYLNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKN 187
           V+YLNP+  FVHTPLVPF+V+ L AS+GVMITASHNPKMDNGYKVYYSNGCQIIPPHD  
Sbjct: 125 VHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHA 184

Query: 188 IAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNN 247
           I+ +ID NLEPW++ W +     K LK+ KL+Y REEM N Y + +   LV ++  +   
Sbjct: 185 ISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLKLEI 244

Query: 248 NGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEK 307
             K PWFVYTPMHGVG+NIF+ I K  +   E  DY  V EQ  PDP+FPTV FPNPEEK
Sbjct: 245 KAK-PWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEEK 303

Query: 308 GALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKY 367
           GAL +  +LAEE++I+L++ANDPDADRFS+A K+ ++ +W+QL+GNEIGFLFA FE ++Y
Sbjct: 304 GALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEFQRY 363

Query: 368 MSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYYV 427
            ++D E++R+HPLAM++STVSSQMIKKMA+VE F YEDTLTGFKWIGNRA+ L+ +GYYV
Sbjct: 364 KNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEGYYV 423

Query: 428 PFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEXXXXXXXXXXEY 487
           PFGFEEAIGYMFP M  DKDG+SAAVV L AY  W  +    P DILE          EY
Sbjct: 424 PFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVFKEY 483

Query: 488 NGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPN 547
           NGYY+   P  T +IF+++R  Y  +G PYP +IG+E ++  +RDLTTGYQS+T D+ P 
Sbjct: 484 NGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKPV 543

Query: 548 LPVDPHSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEMW 607
           LPVDP S+MIT+   P    G   +RFT+RGSGTEPKLK+YIEA ADNEK A  LA   W
Sbjct: 544 LPVDPTSQMITLSGKPSDGNGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAKLTW 603

Query: 608 NVLKKEWIRPDVTGLTTTF 626
           +VL++ W RP++  +TT F
Sbjct: 604 DVLRRGWFRPEIMNITTDF 622

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/622 (60%), Positives = 462/622 (74%), Gaps = 3/622 (0%)

Query: 8   ICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRM 67
           + +  P +LR+ +  WL QDK  ET NEVI+LCK ++  ELHKRFD+RI+FGTAGLRS+M
Sbjct: 11  VLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKM 70

Query: 68  EAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFK 127
           EAGFSRMN LV+LQA+QGLA YIK QFP+NL AV+GHDHR+HSK+FA I  SVFL  GF 
Sbjct: 71  EAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFT 130

Query: 128 VYYLNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKN 187
           VY LNP  +FVHTPLVPF+V+ + AS+GVMITASHNPKMDNGYKVYYSNGCQIIPP D +
Sbjct: 131 VYNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPVDAS 190

Query: 188 IAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNN 247
           IA  IDENLEPWS+ W+     E  L  KKL+Y+R EM   Y   + + ++     R  +
Sbjct: 191 IAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIREFD 250

Query: 248 NGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEK 307
             +KPWFVYTPMHGVGY IFT +    ++ +EN DY  VKEQ+ PDPAFPT+SFPNPEEK
Sbjct: 251 EHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEEK 310

Query: 308 GALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKY 367
           GAL +A  LA+EN+ISLVIANDPDADRFS A  N  +G+WQQL+GNEIGFLF  +   KY
Sbjct: 311 GALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNKY 370

Query: 368 MSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYYV 427
            + D E+++ HPLAM+NSTVSS+M+K MA  E+F + DTLTGFKWIGN+A+DL+ +GY+V
Sbjct: 371 TNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGYHV 430

Query: 428 PFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEXXXXXXXXXXEY 487
            FG+EEAIGYMFP M  DKDG++A+VVFL AY  W N       DILE          EY
Sbjct: 431 VFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAFKEY 490

Query: 488 NGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPN 547
           NGYY+  +P+ T  IF ++R +Y  +GN YPK IG   ++  FRDLTTG+QS+T+DN+P+
Sbjct: 491 NGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIPS 550

Query: 548 LPVDPHSEMITIEAVPKQD---IGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAY 604
           LPVDP S+MITI A    D      S VRFTMRGSGTEPKLKLYIE  + +   A  +A 
Sbjct: 551 LPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASKIAK 610

Query: 605 EMWNVLKKEWIRPDVTGLTTTF 626
             W+VLKKEWIRP+VTG+TT++
Sbjct: 611 LTWDVLKKEWIRPEVTGVTTSY 632

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/619 (59%), Positives = 452/619 (73%), Gaps = 1/619 (0%)

Query: 8   ICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRM 67
           + +  P +L + +  WL QD  ++TR E++ LCK  +W+ELHKR D+RI+FGTAGLRSRM
Sbjct: 13  VINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSRM 72

Query: 68  EAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFK 127
           EAGFSRMN LV+LQA+QGLA++IK QFP  LTAVVGHDHRF+S++FA+ T + FL+ GFK
Sbjct: 73  EAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGFK 132

Query: 128 VYYLNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKN 187
           V +LN  D FVHTP+VPF+VN + AS+GVMITASHNPKMDNGYKVYYSNGCQIIPPHD  
Sbjct: 133 VIFLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDSE 192

Query: 188 IAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNN 247
           IA +I+ENL  W   W WD   ++ L  K LVY  EEM  +Y + M   LV  +      
Sbjct: 193 IAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISAEK 252

Query: 248 NGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEK 307
            GK PWFVYTP+HGVGY+IF +I++  ++     DY  VKEQ  PDP+FPTV FPNPEEK
Sbjct: 253 EGK-PWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEEK 311

Query: 308 GALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKY 367
           GAL +A  +A++N ISLV+ANDPDADRFS A K+ KTG W+QL+GNEIG LFA +E +KY
Sbjct: 312 GALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFYEFQKY 371

Query: 368 MSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYYV 427
             ++ E++  HPLAM+NSTVSSQ+I KMA++E FHY DTLTGFKWIGNR LDL+   YYV
Sbjct: 372 QKKNEEYKEKHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYV 431

Query: 428 PFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEXXXXXXXXXXEY 487
           PFGFEEAIGYMFP M  DKDG+SAA VFL  Y  WL         +LE          EY
Sbjct: 432 PFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKEY 491

Query: 488 NGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPN 547
           NGYY  +DPK  K++FDF+R  Y  + +PYP  IG+E K+  FRDLT GYQS+T++  P+
Sbjct: 492 NGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRPD 551

Query: 548 LPVDPHSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEMW 607
           LPVDP+S+MIT             VRFT+RGSGTEPKLK+YIEA + +E+ A +LA   W
Sbjct: 552 LPVDPNSQMITAWTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERASELAQLTW 611

Query: 608 NVLKKEWIRPDVTGLTTTF 626
            VLK+EW RPDVTGLTTTF
Sbjct: 612 RVLKREWFRPDVTGLTTTF 630

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/615 (60%), Positives = 454/615 (73%), Gaps = 1/615 (0%)

Query: 12  CPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRMEAGF 71
            P+NL+E I LW  QD+  ET  EV  LCK S+W ELH+RFDSRI FGTAGLRS+M+AGF
Sbjct: 9   VPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQAGF 68

Query: 72  SRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFKVYYL 131
           +RMN LVI+QASQGLA Y K QFP NL AVVGHDHRFHSK+FA  TA+ FL  GFKV+YL
Sbjct: 69  NRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKVHYL 128

Query: 132 NPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKNIAAT 191
           NP+  FVHTPLVPF+V+ L AS+GVM+TASHNPKMDNGYKVYYSNGCQIIPPHD  I+ +
Sbjct: 129 NPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDHAISDS 188

Query: 192 IDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNNNGKK 251
           ID NLEPW++ WN+D    K LK+ KL+Y REE+   YL  +   LV +   +     K 
Sbjct: 189 IDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLKFEVKAK- 247

Query: 252 PWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALS 311
           PWFVYTPMHGVG++IF+ I K  +   E  DY  V EQ  PDP+FPTV+FPNPEEKGAL 
Sbjct: 248 PWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEKGALD 307

Query: 312 LATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKYMSQD 371
           L   LAE + I+L+IANDPDADRFSVA K+ ++G+W+QL+GNEIGFLFA FE +K+ S +
Sbjct: 308 LGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKFKSME 367

Query: 372 IEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYYVPFGF 431
            +++  HPLAM++STVSSQMIKKMA+VE FHYE+TLTGFKWIGNRA+ L+ +GYYVPFGF
Sbjct: 368 KQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYVPFGF 427

Query: 432 EEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEXXXXXXXXXXEYNGYY 491
           EEAIGYMFP M  DKDG+SA++VFL AY  W  +    P  ILE          EYNGYY
Sbjct: 428 EEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFKEYNGYY 487

Query: 492 IYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPNLPVD 551
           I   P  T +IFD++R  Y   G  YP +IGKE ++  +RDLT GYQS+T ++ P LP+D
Sbjct: 488 IVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPTLPID 547

Query: 552 PHSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEMWNVLK 611
           P S+MIT+ A P        +RFT+RGSGTEPK+K+YIEA AD E+ A  LA   WNVLK
Sbjct: 548 PSSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAKLTWNVLK 607

Query: 612 KEWIRPDVTGLTTTF 626
           +EW RP+   + T F
Sbjct: 608 REWFRPEKMDIVTHF 622

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/614 (62%), Positives = 467/614 (76%), Gaps = 1/614 (0%)

Query: 13  PANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRMEAGFS 72
           P++L+  I LW  QD+  ET  EV  LCK S+W ELHKRFD+RI FGTAGLRS+M+AGFS
Sbjct: 10  PSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQMQAGFS 69

Query: 73  RMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFKVYYLN 132
           RMN LVI+QASQGLA YI+ QFP NL AVVGHDHRFHSK+FA  TA+ FL  GFKV+YLN
Sbjct: 70  RMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHYLN 129

Query: 133 PEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKNIAATI 192
           P   FVHTPLVPF+V+ LNAS+GVMITASHNPKMDNGYKVYYSNGCQIIPPHD+ I+  I
Sbjct: 130 PGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQAISNAI 189

Query: 193 DENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNNNGKKP 252
           D NLEPW++ WN+D    KNLK+ KL+Y REEM   YL+ + D LV ++  +     K P
Sbjct: 190 DMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLKLEVRSK-P 248

Query: 253 WFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSL 312
           WFVYTPMHGVG++IF+ I K  +   E  DY  V EQ  PDP+FPTV FPNPEEKGAL++
Sbjct: 249 WFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNI 308

Query: 313 ATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKYMSQDI 372
             +LAE+++ISL+IANDPDADRFSVA K+ ++G WQQL+GNEIGFLFA FE EK+ S D 
Sbjct: 309 GMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGFLFAFFEFEKFKSMDE 368

Query: 373 EWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYYVPFGFE 432
           ++++THPLAM++STVSSQMIK+MA+VE FHYEDTLTGFKWIGNRA+ L+ +GYYVPFGFE
Sbjct: 369 QFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGYYVPFGFE 428

Query: 433 EAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEXXXXXXXXXXEYNGYYI 492
           EAIGYMFP M  DKDG+SA+VVFL AY  W   +   P ++LE          EYNGYYI
Sbjct: 429 EAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFKEYNGYYI 488

Query: 493 YDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPNLPVDP 552
             +P  TK+IF ++R  Y     PYP  IG+E ++  +RDLTTGYQS+T+D+ P LPVDP
Sbjct: 489 VPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKPTLPVDP 548

Query: 553 HSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEMWNVLKK 612
            S+MIT+ A P    G   +RFT+RGSGTEPKLK+YIE  A+ E+ A  LA   W+VL++
Sbjct: 549 TSQMITVFARPNDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAKLTWDVLRR 608

Query: 613 EWIRPDVTGLTTTF 626
           EW RP+ T +TT F
Sbjct: 609 EWFRPEKTNITTNF 622

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/620 (60%), Positives = 460/620 (74%), Gaps = 2/620 (0%)

Query: 8   ICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRM 67
           +    P +L+E I +W R D  +ET +EV +LC + +  ELHKRFD RIVFGTAGLRSRM
Sbjct: 11  LLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRSRM 70

Query: 68  EAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFK 127
           EAGF+RMN L +LQ++QGLA YIK+QFP+NLTAVVGHDHR+HSK+FA ITA+VFL  GFK
Sbjct: 71  EAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAGFK 130

Query: 128 VYYLNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKN 187
           VYYLNP D FVHTP+VPF +N  +ASIGVMITASHNP+MDNGYKVYY+NGCQIIPPHDKN
Sbjct: 131 VYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPHDKN 190

Query: 188 IAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNN 247
           IA  I++NLEP S +WN ++   K ++  KL+Y +E++  +Y+  +   ++  +IS    
Sbjct: 191 IAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISLGTT 250

Query: 248 -NGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEE 306
             GKKPWFVYTPMHGVGY IF +IS   L+  E++DY  VKEQ+ PDP+FPTVSFPNPEE
Sbjct: 251 IKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPNPEE 310

Query: 307 KGALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEK 366
           KGAL L  K A+++NI LV+ANDPDADRFSVA +N  T ++QQL+GNEIGFLFA F  E+
Sbjct: 311 KGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFLWEQ 370

Query: 367 YMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYY 426
           Y     +++   PLAMINSTVSSQMIKKMA+VE F+YEDTLTGFKWIGN+A +L+ +GYY
Sbjct: 371 YSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELEKEGYY 430

Query: 427 VPFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEXXXXXXXXXXE 486
           VPFGFEEAIGYMFP M  DKDG++A VVFL AY  W  N+    FDI+E          E
Sbjct: 431 VPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKYGVFKE 490

Query: 487 YNGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLP 546
           YNGYYI +D   TK IFD +R +       Y  +IG EFK+  FRDLT GYQS+TI N+P
Sbjct: 491 YNGYYIVNDLSLTKIIFDNIR-ENKNDKEKYVSHIGTEFKVITFRDLTLGYQSDTIGNVP 549

Query: 547 NLPVDPHSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEM 606
            LPVDP S+MIT+  +P        VRFT+RGSGTEPKLK+YIEA A  E  A  LA   
Sbjct: 550 TLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEANRLAKLT 609

Query: 607 WNVLKKEWIRPDVTGLTTTF 626
           W+VLK+EW   + TGLTT F
Sbjct: 610 WDVLKREWFSSEKTGLTTNF 629

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/620 (59%), Positives = 461/620 (74%), Gaps = 11/620 (1%)

Query: 8   ICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRM 67
           +  + P NL++ I LWL QD+ E+T  E+ +LC   NW ELH+R +SR+ FGTAGLR+RM
Sbjct: 1   MSSNIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARM 60

Query: 68  EAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFK 127
           EAGFSRMN LV++QA+QGLA+YIK QFP +L AVVGHDHRF+S  FA  TA+V L+ GF+
Sbjct: 61  EAGFSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFE 120

Query: 128 VYYLNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKN 187
           V+YLN  DS+VHTP+VPF+V+ + AS+GVMITASHNPK+DNGYKVYY+NGCQIIPPHD  
Sbjct: 121 VHYLNQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSA 180

Query: 188 IAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNN 247
           IA +I+ NLEP +  W+WD T ++   E KL+Y R++M  +Y+  +KD  V+   S P  
Sbjct: 181 IARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDSLPKG 240

Query: 248 NGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEK 307
              KPWFVYTPMHGVGY +F +I+  IL  E N D+ VV EQ+ PDP FPTV FPNPEEK
Sbjct: 241 ---KPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEK 297

Query: 308 GALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKY 367
           GAL LA KLAE + I LVIA+DPDADRFSVA K      WQQLSGN+IGFLFA +EL+KY
Sbjct: 298 GALDLAIKLAENHGIKLVIASDPDADRFSVAFKGPHG--WQQLSGNDIGFLFAYYELQKY 355

Query: 368 MSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYYV 427
              D E++++HPLAM+NSTVSSQMI  MA +E FH+EDTLTGFKWIGNRAL+L+ +GYYV
Sbjct: 356 RGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYV 415

Query: 428 PFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEXXXXXXXXXXEY 487
           PFGFEEAIGYMFP    DKDG+SAAVVFL AY  W++  G  P DIL+          EY
Sbjct: 416 PFGFEEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQ-GKSPLDILDEASAKYGVFREY 474

Query: 488 NGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPN 547
           NGYY+ D+P  T + F ++R  Y   G  YP+ IG + +++ FRDLTTGYQS+T +N+PN
Sbjct: 475 NGYYLVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPN 533

Query: 548 LPVDPHSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEMW 607
           L VDP S+MITI A PK       VRFT+RGSGTEPKLK+YIEA A ++  A +LA + W
Sbjct: 534 LHVDPSSQMITIVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTW 593

Query: 608 NVLKKEWI-RPDVTGLTTTF 626
           ++L++EW  RP   GLTT F
Sbjct: 594 DILREEWFNRP---GLTTKF 610

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/618 (59%), Positives = 457/618 (73%), Gaps = 7/618 (1%)

Query: 11  DCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRMEAG 70
           D P  LR  I+ WL+ DK EETRNEVI+LC D NW ELHKRFDSRIVFGTAGLR+RMEAG
Sbjct: 5   DIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAG 64

Query: 71  FSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFKVYY 130
            +R+N LVILQASQGLA YIK +FP NLTAVVGHDHR+HS++FA +TA+ F+R GFKVYY
Sbjct: 65  TNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYY 124

Query: 131 LNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKNIAA 190
           LNP D FVHTP+VP+SV+HLNAS+GVMITASHNPKMDNGYKVYY+NGCQIIPPHD  IA 
Sbjct: 125 LNPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAE 184

Query: 191 TIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNNNGK 250
           TI+ NLEPWS+DWN+         + K+ YVR+ M   YL ++ + L+    + P+   +
Sbjct: 185 TINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFAAPD---E 241

Query: 251 KPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGAL 310
           KPWFVYTPMHGVG+ IF+ I    L+ ++N+DY  V EQ  PDP+F TVSFPNPEEKGAL
Sbjct: 242 KPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGAL 301

Query: 311 SLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKYMSQ 370
           +LA  LAE N I LV+ANDP+ADRFSVA +++   +W+QL+GNEIG LFA +E + Y   
Sbjct: 302 NLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKA 361

Query: 371 DIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYYVPFG 430
             +  +  PLAM+NSTVS+Q+IK+MA+ E F Y+DTLTGFKWIGN A  L+ +GY+VPFG
Sbjct: 362 ADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPFG 421

Query: 431 FEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEXXXXXXXXXXEYNGY 490
           +EEAIGYMFP M  DKDGVSAA+VFL AY+ WL +  S P DI+           EYNGY
Sbjct: 422 YEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQS-SSNPIDIIHECYDKYGVSAEYNGY 480

Query: 491 YIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPNLPV 550
           YI  DP  T ++F+ +R  Y + G  +P++IG+ F++  FRDLT G+ S T D  P LPV
Sbjct: 481 YIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPV 540

Query: 551 DPHSEMITIEAVPK--QDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEMWN 608
           D +S+MITI AVP    + G+S VRFT+RGSGTEPKLK+YIE ++  E  A  LA  +W 
Sbjct: 541 DKNSQMITITAVPSGASNTGES-VRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWE 599

Query: 609 VLKKEWIRPDVTGLTTTF 626
            LK EW +P   GL+T F
Sbjct: 600 TLKHEWFKPSSNGLSTDF 617

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/623 (59%), Positives = 453/623 (72%), Gaps = 14/623 (2%)

Query: 12  CPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRMEAGF 71
            P +L+E+++LWL  DK  ETR+E++ L +  +W ELH R D RI FGTAGLRSRMEAGF
Sbjct: 8   VPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAGF 67

Query: 72  SRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFKVYYL 131
           SRMN L +LQASQGLA YIK+QFP NL+ +VGHDHR+HS +FA +T + FL++GFKVYYL
Sbjct: 68  SRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYYL 127

Query: 132 N-----PEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDK 186
           N       ++FVHTP+VPF++N LNAS G+MITASHNPKMDNGYKVYYSNGCQIIPPHD+
Sbjct: 128 NLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187

Query: 187 NIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPN 246
            I+ TID+NL PW+  W+ D   +  ++   L  V+E++T+KY++ + D LV      P 
Sbjct: 188 LISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRV----PM 243

Query: 247 NNGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEE 306
            +  KPWFVYTPMHGVG+ IF +I+   L  +E   Y  V EQ  PDPAFPTVSFPNPEE
Sbjct: 244 LDCDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEE 303

Query: 307 KGALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEK 366
           KGAL L+  LAEE +I LVIANDPDADRFSVA KN    +W QL+GNEIGFLFA ++ + 
Sbjct: 304 KGALDLSIALAEEQDIRLVIANDPDADRFSVAVKN--GDRWSQLTGNEIGFLFAYYQWQD 361

Query: 367 YMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYY 426
           Y      +++ HPLAMINSTVSSQMIK +A+ E FHYEDTLTGFKW+GNRA +L+ QGYY
Sbjct: 362 YQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYY 421

Query: 427 VPFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEXXXXXXXXXXE 486
           VPF +EEAIGYMFP +  DKDG+SAAVVFL  Y  WL+ D   P  +L+          E
Sbjct: 422 VPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKE 481

Query: 487 YNGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLP 546
           YNGYYI      TK++FD++R  Y  SG+ YP  IG EF +  FRDLTTGYQS+TIDN+P
Sbjct: 482 YNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVP 541

Query: 547 NLPVDPHSEMITIEAVP---KQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLA 603
           NLPVD  S+MIT    P   K+     +VRFT+RGSGTEPKLK+YIEA + +EK A  LA
Sbjct: 542 NLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLA 601

Query: 604 YEMWNVLKKEWIRPDVTGLTTTF 626
            E W VL++EW RP+ TGL T F
Sbjct: 602 RETWQVLRREWFRPERTGLETKF 624

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/637 (59%), Positives = 462/637 (72%), Gaps = 21/637 (3%)

Query: 8   ICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRM 67
           +  D P +L++ + LWL QDK + TR E+I LCK +N  ELH+RFDSRI FGTAGLRS M
Sbjct: 10  LIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTM 69

Query: 68  EAGFSRMNPLVILQASQGLAKYIKAQFPTN---LTAVVGHDHRFHSKQFAMITASVFLRV 124
           EAGFSRMN L +LQASQGLA Y+K         L AV+GHDHR+HSK+FA I A+VFL  
Sbjct: 70  EAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIA 129

Query: 125 GFKVYYLN------PEDS-FVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNG 177
           GFKVYYLN      P D+ FVHTP+VPF+V +L AS+GVM+TASHNPKMDNGYKVYYSNG
Sbjct: 130 GFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYYSNG 189

Query: 178 CQIIPPHDKNIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDIL 237
           CQIIPPHD  I+  ID NLEPW + WN+         +  L+Y R+ M N Y+  +++ L
Sbjct: 190 CQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKL 249

Query: 238 VSSSI---SRPNNNGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDP 294
            S  I   S+  +   KPWFVYTPMHGVGY IFTKIS  ILH +E  D+ VV+EQ +PDP
Sbjct: 250 TSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDP 309

Query: 295 AFPTVSFPNPEEKGALSLATKLAEENNISLVIANDPDADRFSVASKNEKT-GQWQQLSGN 353
            FPTVSFPNPEEKGA+ +  KLAE+N ISLVIANDPDADRFS+A K++ + G W Q +GN
Sbjct: 310 GFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGN 369

Query: 354 EIGFLFASFELEKYMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWI 413
           EIG+LFA FE +KY    I  +  H L M+NSTVSSQMIKKMA++E F+YE+TLTGFKWI
Sbjct: 370 EIGYLFAYFEFQKY---KISKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWI 426

Query: 414 GNRALDLQGQGYYVPFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDI 473
           GNRA+DL  +G  VPFG+EEAIGYMFPTM  DKDG++A V+F+ A+ YW   D   P++I
Sbjct: 427 GNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEI 486

Query: 474 LEXXXXXXXXXXEYNGYYIYDDPKTTKQIFDFVRYQYD---TSGN-PYPKNIGKEFKIEV 529
           ++          EYNGYY Y D   TK+IFD+VRY YD   + GN  YP +IG+EFKI  
Sbjct: 487 IQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEFKIIK 546

Query: 530 FRDLTTGYQSNTIDNLPNLPVDPHSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYI 589
           +RDLTTGYQS+T DN P LPVDP S+MIT+E +P  +     +R T+RGSGTEPKLK+YI
Sbjct: 547 YRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGTEPKLKVYI 606

Query: 590 EAVADNEKCAIDLAYEMWNVLKKEWIRPDVTGLTTTF 626
           EA + +   A  LA + WNVLK+EW+RP+ TG+TT F
Sbjct: 607 EACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/625 (57%), Positives = 458/625 (73%), Gaps = 5/625 (0%)

Query: 2   SSIPSIICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTA 61
           S+I S+I +  P  L+ + D WLR D+ EETR+E++ +    +W EL  R + RI FGTA
Sbjct: 5   SNILSLIDEYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTA 64

Query: 62  GLRSRMEAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVF 121
           GLR RMEAGF+RMN LVILQ SQGLA+YI  +FP NL+ VVGHDHR+HSK+FA IT + F
Sbjct: 65  GLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATF 124

Query: 122 LRVGFKVYYLNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQII 181
           L  GFKV+YLN E+ FVHTPLVP+SV+ L ++ GVMITASHNPK DNGYKVYYSNGCQII
Sbjct: 125 LNAGFKVFYLNTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQII 184

Query: 182 PPHDKNIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSS 241
           PPHDKNIA TI++NL PWS DWNW   F    +   L +   +M   Y+Q +   + ++ 
Sbjct: 185 PPHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNG 244

Query: 242 ISRPNNNGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSF 301
              P     KPWFVYTPMHGVG+ IF +I+K +L   EN+DYF V EQ+ PDP+FPTVSF
Sbjct: 245 --SPMLKTGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSF 302

Query: 302 PNPEEKGALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFAS 361
           PNPEEKGAL +A +LAE   ++L+IANDPDADRFS A K++++ +W+QLSGNEIG LFA 
Sbjct: 303 PNPEEKGALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAI 362

Query: 362 FELEKYMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQ 421
           F+L+++  +    +   PLAM+NSTVSSQM+KKMAQVE FHYE+TLTGFKWIGNRAL L+
Sbjct: 363 FKLQEHKEKAASRK---PLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLE 419

Query: 422 GQGYYVPFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEXXXXXX 481
            QGY V FG+EEAIGYMFP M  DKDG+ A+VVFL  YS WL  +G  P D+L+      
Sbjct: 420 QQGYDVCFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKY 479

Query: 482 XXXXEYNGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNT 541
               EYNGYY  ++P   + +F ++R +Y     PYP+ +G+EF +  FRDLT GYQS+T
Sbjct: 480 GVFSEYNGYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDT 539

Query: 542 IDNLPNLPVDPHSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAID 601
           ID  P LPVD  S+MIT    P++ +G  ++RFT+RGSGTEPKLK+YIE+ A N++ A +
Sbjct: 540 IDFKPTLPVDASSQMITATLKPERTVGHEEIRFTIRGSGTEPKLKVYIESHAANKEAAAN 599

Query: 602 LAYEMWNVLKKEWIRPDVTGLTTTF 626
           LA+  WNVL++EW RP++TGL T+F
Sbjct: 600 LAHLTWNVLRREWFRPEITGLKTSF 624

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/625 (56%), Positives = 434/625 (69%), Gaps = 20/625 (3%)

Query: 11  DCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRMEAG 70
           + PA+L+ +++ W   DK EETRNE++QL  + NW ELHKR D RI FGTAGLRS+MEAG
Sbjct: 7   EIPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAG 66

Query: 71  FSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFKVYY 130
           FSRMN L +LQASQGLAKYI  +FP N T  VGHDHRF+S+ FA +T+  FL++ FKVY 
Sbjct: 67  FSRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYS 126

Query: 131 LN-----PEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 185
           L       +D+FVHTP+VPF+++ L AS GVMITASHNPKMDNGYKVYYSNGCQIIPPHD
Sbjct: 127 LGFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 186

Query: 186 KNIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRP 245
           + IA +I +NL PW   W+  +   +  ++   V +++ M + Y++ + D LVSS I   
Sbjct: 187 RLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSDI--- 243

Query: 246 NNNGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPE 305
             +  KPWFVYTP+HGVG+ IF +I+  +L   E  DY+ V E   PDPAFPTVSFPNPE
Sbjct: 244 -GDRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPE 302

Query: 306 EKGALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELE 365
           E GAL LA  LA++N IS V+ NDPDADRFS A K++  G+W+QL+GNEIGFLFA F  E
Sbjct: 303 EAGALDLAIALADKNGISFVLGNDPDADRFSAAVKHQ--GKWRQLTGNEIGFLFAQFVWE 360

Query: 366 KYMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGY 425
           KY  +  E++  +PLA+INSTVSSQMIKK+A VE FHYEDTLTGFKW+GNRA  L+  GY
Sbjct: 361 KYQKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGY 420

Query: 426 YVPFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEXXXXXXXXXX 485
           YVPF +EEAIG+MF  +V DKDGVSAAVVFL     W     S P D+L+          
Sbjct: 421 YVPFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQALS-PIDVLQSAFGKYGVFK 479

Query: 486 EYNGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNL 545
           EYNGYY   D   T +IF  +R  YD+    YPK+IG +F +  F DLT G+QS+T DN 
Sbjct: 480 EYNGYYTVPDLSLTDRIFSDIRSSYDS----YPKHIGNQFDVVSFTDLTKGFQSDTADNT 535

Query: 546 PNLPVDPHSEMITIEAVPKQDIGKSK----VRFTMRGSGTEPKLKLYIEAVADNEKCAID 601
           P LPVDP S+MI    VP    G       VRFT RGSGTEPKLK+YIEA +  E  A D
Sbjct: 536 PRLPVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASD 595

Query: 602 LAYEMWNVLKKEWIRPDVTGLTTTF 626
           LA   WNVL+ EW +P  TGL+T F
Sbjct: 596 LARTTWNVLRDEWFKPKETGLSTKF 620

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/625 (56%), Positives = 446/625 (71%), Gaps = 30/625 (4%)

Query: 8   ICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRM 67
           + +  P++L+  +  WL+ DK EETRNE++QLC   +  ELHKR D+ I FGTAGLR RM
Sbjct: 6   VIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRM 65

Query: 68  EAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFK 127
           EAGF+RMN L + QASQGLAKYIK QFP NLT VVGHDHR +S+ F  +T   FL++GFK
Sbjct: 66  EAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFK 125

Query: 128 VYYLNPED--SFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 185
           V++LN E+  S VHTPLVPF+VN   AS+G+MITASHNPKMDNGYKVYY+NGCQIIPPHD
Sbjct: 126 VFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHD 185

Query: 186 KNIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRP 245
           K IA +I  NLEP+SS            +   ++  +E+MT KY+ A+   L+  ++++ 
Sbjct: 186 KLIAESIIHNLEPFSSP-----------QTGTIIDCKEKMTKKYIDAIGSTLIDGAVNKK 234

Query: 246 NNNGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPE 305
            N   +PWFVYTPMHGVG+ IF  ISK +L  EE  DY VV+EQ YPD  FPTVSFPNPE
Sbjct: 235 TN---EPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPE 291

Query: 306 EKGALSLATKLAEENN-ISLVIANDPDADRFSVASKN---EKTGQWQQLSGNEIGFLFAS 361
           EKGAL LA +   +N+ + L+IANDPDADRFSVA ++     T  W+QL+GNEIGFLFA 
Sbjct: 292 EKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAY 351

Query: 362 FELEKYMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQ 421
           +E E+Y    I+     PLAM+NSTVSSQMIK+MA++E FHYEDTLTGFKW+GNRAL+L+
Sbjct: 352 YEWERYKHSPID----EPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELE 407

Query: 422 GQGYYVPFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEXXXXXX 481
            +GYY PF +EEAIGYMF ++V DKDG+SAA+VFL AYS W    G    DIL       
Sbjct: 408 QEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKW-RASGQTVLDILATASLKY 466

Query: 482 XXXXEYNGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNT 541
               E+NGYYI  D   TKQ+FD +R    +  +PYPK +G  F+I  FRDLT GYQS+T
Sbjct: 467 GHFKEFNGYYIVPDLAITKQVFDAIR----SIESPYPKKLGSSFEIIKFRDLTNGYQSDT 522

Query: 542 IDNLPNLPVDPHSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAID 601
            D++P L  DP S+MIT E +  +    S+VRFT+RGSGTEPKLK+YIEA  + E  +I 
Sbjct: 523 PDHIPELASDPSSQMITCEMLLVEQ-PTSRVRFTIRGSGTEPKLKVYIEARTNTEPNSIA 581

Query: 602 LAYEMWNVLKKEWIRPDVTGLTTTF 626
           LA   W+VL++EW +P++TGL T F
Sbjct: 582 LAKFTWDVLRQEWFKPELTGLLTPF 606

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/630 (54%), Positives = 448/630 (71%), Gaps = 20/630 (3%)

Query: 6   SIICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRS 65
           S+   + P +L+  ++ WL+ DK E+TR+++I+L +D +W EL  R + RI FGTAGLRS
Sbjct: 3   SLTNAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRS 62

Query: 66  RMEAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVG 125
           RMEAGF+RMN L +LQASQGLAKYI + FP NL+ VVGHDHRF+SK FA +T   FL++G
Sbjct: 63  RMEAGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLG 122

Query: 126 FKVYYLN-----PEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQI 180
           FKVY L       +D  VHTP+VPF ++HL AS G+MITASHNPKMDNGYKVYYSNGCQI
Sbjct: 123 FKVYDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQI 182

Query: 181 IPPHDKNIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSS 240
           IPPHD+ I+ +I  NLEPW   W+  +   + ++ + L+  ++ + ++Y+  ++  LV +
Sbjct: 183 IPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVIT 242

Query: 241 SISRPNNNGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVS 300
           ++    N+ K PWFVYTP+HGVG+ IF KI  +     +  DY  V+EQ YPDP FPTVS
Sbjct: 243 NV----NHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVS 298

Query: 301 FPNPEEKGALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFA 360
           FPNPEEKGAL  A +LAE+++I+ V+ NDPDADRFSVA+K+   GQW+QL+GNEIGFLFA
Sbjct: 299 FPNPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKH--NGQWRQLTGNEIGFLFA 356

Query: 361 SFELEKYMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDL 420
            ++ E Y  +  +++ T+PLAMINSTVSSQMIKKMA+VE FHYEDTLTGFKW+GNRA +L
Sbjct: 357 QYKWETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRAREL 416

Query: 421 QGQGYYVPFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEXXXXX 480
           +  GY+VPF +EEAIGYMF  +V DKDG+SAAVVFL     W       PFD+L+     
Sbjct: 417 ENAGYFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSW-KAQALTPFDVLQRAYQK 475

Query: 481 XXXXXEYNGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSN 540
                EYNGYYI  D   T ++F  +R  +       P +IG+EF++E + DLTTGYQSN
Sbjct: 476 YGVFKEYNGYYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQSN 531

Query: 541 TIDNLPNLPVDPHSEMITIEAVPKQDIGKS----KVRFTMRGSGTEPKLKLYIEAVADNE 596
           T D+ P LPVDP S+MIT    P    G+      VRFT RGSGTEPKLK+YIEAV+ +E
Sbjct: 532 TPDSEPRLPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVSSSE 591

Query: 597 KCAIDLAYEMWNVLKKEWIRPDVTGLTTTF 626
           + A  LA + W+VL++EW +P+ TGL T F
Sbjct: 592 ELASALAKKAWDVLRREWFKPEQTGLATNF 621

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/627 (53%), Positives = 435/627 (69%), Gaps = 18/627 (2%)

Query: 10  DDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRMEA 69
           D  P++L++++  WL  DK  ET++E+ +L  +  W EL KR   RI FGTAGLR+RMEA
Sbjct: 6   DAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEA 65

Query: 70  GFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFKVY 129
           GFSRMN L ++QASQGLA+YIK+QFP +L  V+GHDHRFHS++FA  T + FL++ + +Y
Sbjct: 66  GFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIY 125

Query: 130 YLN------PEDSFVHTPLVPFSVNHLNA---SIGVMITASHNPKMDNGYKVYYSNGCQI 180
           YLN       ED FVHTP+VPF++N++     S GVMITASHNPKMDNGYKVYY+NGCQI
Sbjct: 126 YLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQI 185

Query: 181 IPPHDKNIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSS 240
           IPPHD+ I   ID NLEPW+  W+  +  E+ +K  KL  VR+EM  KY  +++ +LV  
Sbjct: 186 IPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQ 245

Query: 241 SISRPNNNGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVS 300
           S  +       PWFVYTPMHGVGY  F +   ++L  EE+ DY VV EQ YPDP FPTVS
Sbjct: 246 SNLKFAGG---PWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVS 302

Query: 301 FPNPEEKGALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFA 360
           FPNPEE+GAL +A K+A+ N I++V+ANDPDADRFSVA K    G+W QL+GN+IG LFA
Sbjct: 303 FPNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVKYH--GEWNQLTGNQIGILFA 360

Query: 361 SFELEKYMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDL 420
             E++ Y  +    R+   LAM+ S VSSQ+++KMA+ E F   +TLTGFKW+GNRA +L
Sbjct: 361 QAEMQSYFKEPKLDRKQ--LAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRAREL 418

Query: 421 QGQGYYVPFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEXXXXX 480
           + +GYYVPF +EEAIGYMF  +V DKDG++AA VFL     W     S   ++L+     
Sbjct: 419 ELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSSQ-EVLQECYEK 477

Query: 481 XXXXXEYNGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSN 540
                +YNGYYI   P  TK++FD+ R +Y  +G PYP +IG EF++E  RDLT GYQS+
Sbjct: 478 YGYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSD 537

Query: 541 TIDNLPNLPVDPHSEMITIEAVP-KQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCA 599
           T  N+P+LPVD +S+MIT    P K +     VRFT RGSGTEPKLK+YIE+ A N + A
Sbjct: 538 TATNIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQRA 597

Query: 600 IDLAYEMWNVLKKEWIRPDVTGLTTTF 626
             L++  W+VLK+EW RP  TGL T F
Sbjct: 598 SHLSHLAWDVLKREWFRPTETGLQTNF 624

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/627 (53%), Positives = 423/627 (67%), Gaps = 23/627 (3%)

Query: 13  PANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRMEAGFS 72
           P +LR+ ID W + DK  +T  E+  L    NW EL  R   RI FGTAGLR+RMEAGF+
Sbjct: 14  PDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEAGFA 73

Query: 73  RMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFKVYYLN 132
           RMN L ++QASQGLA YIK+QFP NL  VVGHDHR++SK FA +  + FL++GF+VYYLN
Sbjct: 74  RMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVYYLN 133

Query: 133 --PE----DSFVHTPLVPFSVNHL--NASIGVMITASHNPKMDNGYKVYYSNGCQIIPPH 184
             P     +S+VHTP+VPF+V+++   AS G+MITASHNPKMDNGYKVYYSNGCQI PPH
Sbjct: 134 YVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQITPPH 193

Query: 185 DKNIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSS-SIS 243
           DK IA+ ID NL PW   W+     E      +L  V++E+   Y+Q ++  LV++ S++
Sbjct: 194 DKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTNSLA 253

Query: 244 RPNNNGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPN 303
               N    WFVYTPMHGVGY IF  I  N LH +E+  Y VV  Q +PDP F TVSFPN
Sbjct: 254 DCGKN----WFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPN 309

Query: 304 PEEKGALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFE 363
           PEE+GAL+LA +LA  +   LV+ANDPDADRFS A K+    +W+QL+GN++G+LFA  +
Sbjct: 310 PEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKD--GNKWKQLTGNQLGYLFAVGQ 367

Query: 364 LEKYMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQ 423
           LEK+ +Q+       PLAM+ STVSSQMI KMA VE F + +TLTGFKW+ NRA+DL+  
Sbjct: 368 LEKFSNQN---ENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLEND 424

Query: 424 GYYVPFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEXXXXXXXX 483
           G+YVPF +EEAIGYMF ++  DKDGVSAA  FL   + W   +G  P D+L         
Sbjct: 425 GFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARW-KKEGKTPLDVLNAGYEKYGN 483

Query: 484 XXEYNGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTID 543
             EYNGYY   D      +F ++R   + +  PYP  IG EF +  FRDLT GYQS+T +
Sbjct: 484 FVEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGN 543

Query: 544 NLPNLPVDPHSEMITIEAVP--KQDIGKSK--VRFTMRGSGTEPKLKLYIEAVADNEKCA 599
           ++PNLPV P S MIT    P  K+    S   VRFT+RGSGTEPKLK+YIE+ A +++ A
Sbjct: 544 HIPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYA 603

Query: 600 IDLAYEMWNVLKKEWIRPDVTGLTTTF 626
             LA   W+VLK+EW RP+VTGL T F
Sbjct: 604 TKLAKLTWDVLKREWFRPEVTGLQTKF 630

>KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 113/258 (43%), Gaps = 40/258 (15%)

Query: 99  TAVVGHDHRFHSKQFAMITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVNHL------NA 152
           T VVG D R+++       A++    G +   +  ++  + TP    + +H+        
Sbjct: 56  TLVVGGDGRYYNDVILHKIAAIGAANGVRKLVIG-QNGLLSTP----AASHIMRTYKEKC 110

Query: 153 SIGVMITASHN---PKMDNGYKVYYSNGCQIIPPHDKNI---AATIDE-NLEPWSSDWNW 205
           + G+++TASHN   PK D G K   SNG     P    I   +  +D   + P   +   
Sbjct: 111 TGGIILTASHNPGGPKNDMGIKYNLSNGGPAPEPVTNKIWEVSKQLDHYKIIPDLPELAL 170

Query: 206 DSTFEKNLKEKKLVYVREEMTNKYLQAMKDI----LVSSSISRPNNNGKKPW-FVYTPMH 260
           D T  +N++   L+    + T  Y++ +K+I    L+ S I +     +K W  ++  M+
Sbjct: 171 D-TLAENVQYGPLLVDVVDTTRDYVEFLKEIFDFPLIKSFIHK--QRSQKHWKLLFDGMN 227

Query: 261 GV----GYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKL 316
           GV    G  IF  + +  L  EE      V +  +P P F  +  P+P    A SL  ++
Sbjct: 228 GVTGPYGKAIF--VDEFELPAEE------VLQNWHPQPDFGGIH-PDPNLTYARSLVDRV 278

Query: 317 AEENNISLVIANDPDADR 334
             E NI    A+D D DR
Sbjct: 279 DRE-NIEFGAASDGDGDR 295

>TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 122/294 (41%), Gaps = 35/294 (11%)

Query: 59  GTAGLRSRMEAGFSRMNPLVILQASQGLAKYIKAQFPT---NLTAVVGHDHRFHSKQFAM 115
           GT+GLR + +   +  N       ++   + I    P    N T VVG D RF++     
Sbjct: 19  GTSGLRKKSKVFMNEPN------YTENFIQAILDAIPEGSENSTLVVGGDGRFYNDVILQ 72

Query: 116 ITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVN--HLNASIGVMITASHN---PKMDNGY 170
           + A +    G +   +  +   + TP     +   H   + G+++TASHN   P+ D G 
Sbjct: 73  LIAEIGAANGVRKLIIG-QAGILSTPAASHIIRTYHEEVTGGIILTASHNPGGPENDIGI 131

Query: 171 KVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWD----STFEKNLKEKKLVYVREEMT 226
           K   +NG    P    N      +NL  + +  ++     +T  +N+K   L+    + T
Sbjct: 132 KYNLANGGP-APESVTNAIWEASKNLTTYKTMKDFPKIDINTISENVKYGPLLIDIIDST 190

Query: 227 NKYLQAMKDI----LVSSSI--SRPNNNGKKPWFVYTPMHGVGYNIFTKISKNILHYEEN 280
             Y++ +K+I    L+   I   R  NN K    ++  ++GV         K I   E  
Sbjct: 191 EDYVKFLKEIFDFPLIKKFIETQRKTNNWK---LLFDSLNGVT----GPYGKAIFVDEFG 243

Query: 281 MDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNISLVIANDPDADR 334
           +    V +  +P P F  +  P+P    A +L  ++ +E  I    A+D D DR
Sbjct: 244 LPADEVLQNWHPQPDFGGLH-PDPNLTYARTLVDRVDKE-KIEFGAASDGDGDR 295

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 25/35 (71%)

Query: 146 SVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQI 180
           S++H   ++GVM+TASHNP +DNG K+   NG  +
Sbjct: 54  SLSHDGKAVGVMVTASHNPPVDNGVKIVEPNGSML 88

>Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 108/256 (42%), Gaps = 36/256 (14%)

Query: 99  TAVVGHDHRFHSKQFAMITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVNHL------NA 152
           T VVG D R+++       A++    G K   +  +   + TP    + +H+        
Sbjct: 56  TLVVGGDGRYYNDVILHKIAAISAANGVKKLVIG-QHGLLSTP----AASHIMRTYEDKC 110

Query: 153 SIGVMITASHN---PKMDNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWD--- 206
           + G+++TASHN   P+ D G K   SNG    P    N    I + L  +    ++    
Sbjct: 111 TGGIILTASHNPGGPENDMGIKYNLSNGGP-APESVTNAIWEISKKLTSYKIVKDFPELD 169

Query: 207 -STFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISR--PNNNGKKPW-FVYTPMHGV 262
             T  K+ K   L+    ++T  Y++ M++I   + I +   N    K W  ++  M+GV
Sbjct: 170 LQTIGKDRKYGPLLIDIIDVTKAYVELMEEIFDFNLIKKFIDNQRSTKNWKLLFDSMNGV 229

Query: 263 ----GYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAE 318
               G  IF  + K  L  EE      V +  +P P F  +  P+P    A SL  ++  
Sbjct: 230 TGPYGKAIF--VDKFGLPAEE------VLQNWHPSPDFGGMH-PDPNLTYASSLVKRVDR 280

Query: 319 ENNISLVIANDPDADR 334
           E  I    A+D D DR
Sbjct: 281 E-QIEFGAASDGDGDR 295

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%)

Query: 146 SVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQII 181
           S++   A +GVMITASHNP  DNG K+  S+G  ++
Sbjct: 46  SISCQCAPVGVMITASHNPPRDNGVKIVESDGSMLL 81

>Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C
           (PGM2) - Phosphoglucomutase [contig 55] FULL
          Length = 570

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 97/418 (23%), Positives = 168/418 (40%), Gaps = 55/418 (13%)

Query: 59  GTAGLRSRMEAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITA 118
           GT+GLR + +    +  P       Q + + I  +   N T VVG D R+++ +   I  
Sbjct: 19  GTSGLRKKTKV--FKDEPHYTENFIQAILEAI-PEGSENATLVVGGDGRYYNNEVMQIIG 75

Query: 119 SVFLRVGFKVYYLNPEDSFVHTPLVPFSVNHL--NASIGVMITASHN---PKMDNGYKVY 173
           ++    G +   L  ++  + TP     +       + G+++TASHN   P+ D G K  
Sbjct: 76  AIAAANGVRKMILG-QNGILSTPAASHIIRSYPEKCTGGIILTASHNPGGPENDFGIKYN 134

Query: 174 YSNGCQIIPPHDKNIAATIDENLEPWSSDWNWD----STFEKNLKEKKLVYVREEMTNKY 229
            SNG    P    N      + L  +    N+     S   K+ K   L+    + T  Y
Sbjct: 135 LSNGGP-APESVTNAIFEKSKQLTHYKIVKNFPKIDFSKIGKDQKYGPLLVDVVDSTADY 193

Query: 230 LQAMKDILVSSSISR--PNNNGKKPW-FVYTPMHGV----GYNIFTKISKNILHYEENMD 282
           +  MK+I     I +   N    K +  ++  ++GV    G  IF K  +  L  EE + 
Sbjct: 194 VALMKEIFDFDLIKKFIDNQRSTKGFKILFDSLNGVTGPYGEAIFVK--ELGLPAEEVLQ 251

Query: 283 YFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNISLVIANDPDADRFSVASKNE 342
            +V      P P F  +  P+P    A +L  ++ +E  I+   A+D D DR  +     
Sbjct: 252 NYV------PKPDFGGLH-PDPNLTYAHTLVERVDKE-QIAFGAASDGDGDRNMIYG--- 300

Query: 343 KTGQWQQLSGNEIGFLFASFELEKYMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFH 402
             G      G+ +        + +Y S+   +++     +  S  +S  I ++A+ +   
Sbjct: 301 -CGPAFVSPGDSVAI------IAEYASEIPYFKKQGIYGLARSFPTSAAIDRVAKEQGLA 353

Query: 403 YEDTLTGFKW----IGNRALDLQGQGYYVPFGFEEAIGYMFPTMVTDKDGVSAAVVFL 456
             +  TG+K+       + L + G         EE+ G      V +KDGV A V +L
Sbjct: 354 CYEVPTGWKFFCALFDAKKLSICG---------EESFG-TGSNHVREKDGVWAIVAWL 401

>Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 119/295 (40%), Gaps = 37/295 (12%)

Query: 59  GTAGLRSRMEAGFSRMNPLVILQASQGLAKYIKAQFP---TNLTAVVGHDHRFHSKQFAM 115
           GT+GLR + +    + N       ++   + I    P      T VVG D R+++     
Sbjct: 19  GTSGLRKKTKVFKDQPN------YTENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 116 ITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVNHL------NASIGVMITASHN---PKM 166
             A++    G K   +  +   + TP    + +H+        + G+++TASHN   P+ 
Sbjct: 73  KIAAIGAANGVKKLVIG-QHGLLSTP----AASHIMRTYEEKCTGGIILTASHNPGGPEN 127

Query: 167 DNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWD----STFEKNLKEKKLVYVR 222
           D G K   SNG    P    N+   I + L  +    ++     +T  KN K   L+   
Sbjct: 128 DMGIKYNLSNGGP-APESVTNVIWDISKKLTSYKIIKDFPELDLATIGKNKKYGPLLVDI 186

Query: 223 EEMTNKYLQAMKDILVSSSISR--PNNNGKKPW-FVYTPMHGVGYNIFTKISKNILHYEE 279
            ++T  Y+  +K+I     I +   N    K W  ++  M+GV         K I   E 
Sbjct: 187 IDITKDYVDFLKEIFDFKLIKKFIDNQRSTKNWKLLFDSMNGV----TGPYGKAIFVDEF 242

Query: 280 NMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNISLVIANDPDADR 334
            +    V +  +P P F  +  P+P    A +L  ++  E  I    A+D D DR
Sbjct: 243 GLPADEVLQNWHPSPDFGGMH-PDPNLTYASTLVKRVDRE-KIEFGAASDGDGDR 295

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 49/93 (52%), Gaps = 14/93 (15%)

Query: 153 SIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWDSTFEKN 212
           ++GVMITASHN   DNG K+   +G            + +D++ EP++++    ++F  +
Sbjct: 57  AVGVMITASHNQPCDNGVKIVEPDG------------SMLDQSWEPFATELANKASFCHS 104

Query: 213 LKEKKLVYVREEMTN-KYLQAMKDILVSSSISR 244
            +E KL Y++E+    K    +  +LV    SR
Sbjct: 105 TQEFKL-YLQEKFAQYKVDSGITPVLVVGRDSR 136

>NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 104/252 (41%), Gaps = 28/252 (11%)

Query: 99  TAVVGHDHRFHSKQFAMITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVNHL------NA 152
           T VVG D R+++       A++    G K   +  +   + TP    + +H+        
Sbjct: 56  TLVVGGDGRYYNDVILHKIAAIGAANGVKKLVVG-QHGLLSTP----AASHIMRTYEEKT 110

Query: 153 SIGVMITASHNP---KMDNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWD--- 206
           + G+++TASHNP   + D G K   SNG     P    I   I + +  +    ++    
Sbjct: 111 TGGIILTASHNPGGLENDMGIKYNLSNGGPAPEPVTNKI-WEISKKMTHYKIIKDFPELE 169

Query: 207 -STFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISR--PNNNGKKPW-FVYTPMHGV 262
             T  KN K   L+    ++T  Y+  +K+I     I +   N   KK W  ++  M+GV
Sbjct: 170 LETLGKNKKYGPLLVDVIDITKAYVDFLKEIFDFELIKKFIHNQREKKHWKLLFDGMNGV 229

Query: 263 GYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNI 322
                    K I   E  +    V +Q +P P F  V  P+P    A +L  ++  E  I
Sbjct: 230 ----TGPYGKAIFVDEFGLPADEVLQQWHPQPDFGGVH-PDPNLTYAKALVDRVNRE-KI 283

Query: 323 SLVIANDPDADR 334
               A+D D DR
Sbjct: 284 EFGAASDGDGDR 295

>YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON}
           PGM2Phosphoglucomutase, catalyzes the conversion from
           glucose-1-phosphate to glucose-6-phosphate, which is a
           key step in hexose metabolism; functions as the acceptor
           for a Glc-phosphotransferase
          Length = 569

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 102/252 (40%), Gaps = 28/252 (11%)

Query: 99  TAVVGHDHRFHSKQFAMITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVNHL------NA 152
           T VVG D R+++       A++    G K   +  +   + TP    + +H+        
Sbjct: 56  TLVVGGDGRYYNDVILHKIAAIGAANGIKKLVIG-QHGLLSTP----AASHIMRTYEEKC 110

Query: 153 SIGVMITASHN---PKMDNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWD--- 206
           + G+++TASHN   P+ D G K   SNG    P    N    I + L  +    ++    
Sbjct: 111 TGGIILTASHNPGGPENDMGIKYNLSNGGP-APESVTNAIWEISKKLTSYKIIKDFPELD 169

Query: 207 -STFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISR--PNNNGKKPW-FVYTPMHGV 262
             T  KN K   L+    ++T  Y+  +K+I     I +   N    K W  ++  M+GV
Sbjct: 170 LGTIGKNKKYGPLLVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGV 229

Query: 263 GYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNI 322
                    K I   E  +    V +  +P P F  +  P+P    A SL  ++  E  I
Sbjct: 230 ----TGPYGKAIFVDEFGLPADEVLQNWHPSPDFGGMH-PDPNLTYASSLVKRVDRE-KI 283

Query: 323 SLVIANDPDADR 334
               A+D D DR
Sbjct: 284 EFGAASDGDGDR 295

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 23/31 (74%)

Query: 151 NASIGVMITASHNPKMDNGYKVYYSNGCQII 181
           +++IGVM+TASHNP  DNG K+   NG  ++
Sbjct: 65  HSAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95

>TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.445
           YKL127W
          Length = 572

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 115/291 (39%), Gaps = 26/291 (8%)

Query: 59  GTAGLRSRMEAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITA 118
           GT+GLR + +    +  P       Q +   I  +   + T VVG D R+++ +   I A
Sbjct: 19  GTSGLRKKTKVFMEK--PHYTENFIQSILDAI-PEGSKDATLVVGGDGRYYNDKILQIIA 75

Query: 119 SVFLRVGFKVYYLNPEDSFVHTPLVPFSV------NHLNASIGVMITASHNPKM---DNG 169
           S+    G     +  +   + TP     +      +    + G+++TASHNP     D G
Sbjct: 76  SISAANGVGKLVIG-QHGLLSTPAASHIIRTYQDKSGKKVTGGIILTASHNPGGPDNDIG 134

Query: 170 YKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVR---EEMT 226
            K   SNG    P    N    I + L  +    N          EKKL  +     ++T
Sbjct: 135 IKYNLSNGGP-APESVTNAIWEISKKLTSYKIIKNLPQLDLSTKGEKKLGNLEIDVVDVT 193

Query: 227 NKYLQAMKDILVSSSISR--PNNNGKKPW-FVYTPMHGVGYNIFTKISKNILHYEENMDY 283
             Y++ +K+I     I +        K W  ++  ++GV       I  + L   EN   
Sbjct: 194 QAYVEFLKEIFDFDLIKKFVDTQRSTKHWKLLFDGLNGVTGPYGKAIFVDELGLPENE-- 251

Query: 284 FVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNISLVIANDPDADR 334
             V +  +P P F  +  P+P    A +L  ++ +E  I    A+D D DR
Sbjct: 252 --VLQNCHPKPDFGGI-HPDPNLTYARTLVERVDKE-KIEFGAASDGDGDR 298

>NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 65/254 (25%), Positives = 104/254 (40%), Gaps = 32/254 (12%)

Query: 99  TAVVGHDHRFHSKQFAMITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVNHL------NA 152
           T VVG D R+++       A++    G K   +  +   + TP    + +H+        
Sbjct: 56  TLVVGGDGRYYNDVILHKIAAIGAANGVKKLVIG-QRGLLSTP----AASHIMRTYEEKT 110

Query: 153 SIGVMITASHNP---KMDNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWD--- 206
             G+++TASHNP   K D G K   SNG     P    I   I + +  +    ++    
Sbjct: 111 QGGIILTASHNPGGIKNDMGIKFNLSNGGPAPEPVTNKI-WEISKKMTSFKIIKDFPELE 169

Query: 207 -STFEKNLKEKKLVYVREEMTNKYLQAMKDI----LVSSSISRPNNNGKKPW-FVYTPMH 260
             T  KN K   L+    + T  Y++ +K I    L+   + +  +   K W  ++  M+
Sbjct: 170 LETLGKNKKYGPLLVDVIDTTKAYVEFVKQIFDFDLIKKFVHKQRDT--KHWKLLFDGMN 227

Query: 261 GVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEEN 320
           GV         K I   E  +    V +Q +P P F  V  P+P    A +L  ++  E 
Sbjct: 228 GV----TGPYGKAIFVDELGLPADEVLQQWHPSPDFGGVH-PDPNLTYAKALVDRVDRE- 281

Query: 321 NISLVIANDPDADR 334
           NI    A+D D DR
Sbjct: 282 NIEFGAASDGDGDR 295

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 154 IGVMITASHNPKMDNGYKVYYSNGCQII 181
           +GVM+TASHNP +DNG KV    G  +I
Sbjct: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLI 87

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 154 IGVMITASHNPKMDNGYKVYYSNGCQII 181
           IGVMITASHNP  DNG K+   +G  +I
Sbjct: 59  IGVMITASHNPPQDNGVKIVEPSGAMLI 86

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 42/76 (55%), Gaps = 20/76 (26%)

Query: 153 SIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDW---NWDSTF 209
           ++GVMITASHNP  DNG K+   NG            A +D++ EP +++      +STF
Sbjct: 53  AVGVMITASHNPPEDNGVKIVEPNG------------AMLDQSWEPMATELANIAANSTF 100

Query: 210 EKNLKEKKLVYVREEM 225
           + +LK     YV E++
Sbjct: 101 D-DLK----AYVEEKV 111

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 154 IGVMITASHNPKMDNGYKVYYSNGCQII 181
           +GVMITASHNP  DNG KV   +G  +I
Sbjct: 57  VGVMITASHNPSGDNGVKVVEPDGSMLI 84

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 52/117 (44%), Gaps = 14/117 (11%)

Query: 151 NASIGVMITASHNPKMDNGYKVYYSNGCQI------IPPHDKNIAA--TIDENLEPWSSD 202
            A +GVM+TASHNP  DNG KV    G  +      +     N+AA  T D+  E W+S 
Sbjct: 55  GAQVGVMVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWTS- 113

Query: 203 WNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSS-SISRPNNNGKKPWFVYTP 258
                  E N      + V  +      + +K+++ ++ ++S  +    KPW    P
Sbjct: 114 ----LVEEGNYTGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHP 166

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 17/73 (23%)

Query: 154 IGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWDSTFEKNL 213
           +GVMITASHNP  DNG K        I+ P    + AT     EP++      ++F  N 
Sbjct: 60  VGVMITASHNPYQDNGVK--------IVEPDGSMLLAT----WEPYAMQLANTASFASNF 107

Query: 214 KEKKLVYVREEMT 226
           +E      R E+T
Sbjct: 108 EE-----FRAELT 115

>KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 570

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 83/376 (22%), Positives = 154/376 (40%), Gaps = 52/376 (13%)

Query: 101 VVGHDHRFHSKQFAMITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVNHL--NASIGVMI 158
           VVG D R+++ +       +    G K   +  ++  + TP     +      ++ G+++
Sbjct: 58  VVGGDGRYYNNEVLQKIGEIGAANGVKKLIVG-QNGLLSTPAASHIIRSYPEKSTGGIIL 116

Query: 159 TASHN---PKMDNGYKVYYSNGCQIIPPHDKNIAATIDE---NLEPWSSDWNWD----ST 208
           TASHN   P+ D G K   SNG     P  +++  +I E    L  + +  N+     S 
Sbjct: 117 TASHNPGGPENDFGIKYNLSNGG----PAPESVTNSIFEKSKQLASYKTVKNFPKINLSK 172

Query: 209 FEKNLKEKKLVYVREEMTNKYLQAMKDI----LVSSSISRPNNNGKKPWFVYTPMHGVGY 264
             KN +   L+    ++T +Y++ MK+I    L+   I    +  K    ++  ++G   
Sbjct: 173 IGKNQEYGSLLVDVIDVTAEYVKLMKEIFDFDLIKKFIDHQRST-KGFKILFDALNG--- 228

Query: 265 NIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNISL 324
            I     K I   E  +    V +   P P F  +  P+P    A +L  ++ +E  I+ 
Sbjct: 229 -ITGPYGKAIFADELGLPAEEVLQNYEPKPDFGGLH-PDPNLTYAHTLVERVDKE-QIAF 285

Query: 325 VIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKYMSQDIEWRRTHPLAMIN 384
             A+D D DR  +       G      G+ +        + +Y S+   +++     +  
Sbjct: 286 GAASDGDGDRNMIYG----CGPAFVSPGDSVAI------IAEYASEIPYFKKQGIYGLAR 335

Query: 385 STVSSQMIKKMAQVESFHYEDTLTGFKW----IGNRALDLQGQGYYVPFGFEEAIGYMFP 440
           S  +S  I ++A+ +  +  +  TG+K+       + L + G         EE+ G    
Sbjct: 336 SFPTSAAIDRVAKAQGLNCYEVPTGWKFFCALFDAKKLSICG---------EESFG-TGS 385

Query: 441 TMVTDKDGVSAAVVFL 456
             V +KDGV A V +L
Sbjct: 386 NHVREKDGVWAIVAWL 401

>CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c Phosphoglucomutase 2
          Length = 568

 Score = 38.1 bits (87), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 108/252 (42%), Gaps = 32/252 (12%)

Query: 101 VVGHDHRFHSKQFAMITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVNHL------NASI 154
           VVG D R+++       A++    G K   +  ++  + TP    + +H+        + 
Sbjct: 57  VVGGDGRYYNDVILQKIAAIGAANGVKKLVIG-QNGLLSTP----AASHIMRTYKEKCTG 111

Query: 155 GVMITASHN---PKMDNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWD----S 207
           G+++TASHN   P+ D G K   SNG     P    I   I + L  +    ++     +
Sbjct: 112 GIILTASHNPGGPENDMGIKYNLSNGGPAPEPVTNKIWE-ISKKLTHYKIVKDFPELDLT 170

Query: 208 TFEKNLKEKKLVYVREEMTNKYLQAMKDI----LVSSSISRPNNNGKKPW-FVYTPMHGV 262
              +N K   L+    + T+ Y+Q +K+I    L+   I++     +K W  +   M+GV
Sbjct: 171 KLVENKKYGPLLVDVIDTTDAYIQLLKEIFDFELIHKFIAKQRK--EKGWKLLVDSMNGV 228

Query: 263 GYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNI 322
                   +K I   E  +D   V +  +P P F  +  P+P    A +L  ++ +E  I
Sbjct: 229 ----TGPYAKAIFVDEFGLDSKEVLQNWHPQPDFGGLH-PDPNLTYAHTLVERVNKE-KI 282

Query: 323 SLVIANDPDADR 334
               A+D D DR
Sbjct: 283 EFGAASDGDGDR 294

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score = 38.1 bits (87), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 19/24 (79%)

Query: 154 IGVMITASHNPKMDNGYKVYYSNG 177
           IGVM+TASHNP +DNG KV   +G
Sbjct: 59  IGVMVTASHNPPVDNGVKVVEPDG 82

>Smik_2.333 Chr2 complement(595382..596038) [657 bp, 218 aa] {ON}
           YBR193C (REAL)
          Length = 218

 Score = 37.4 bits (85), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 51/128 (39%), Gaps = 31/128 (24%)

Query: 253 WFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSL 312
           W+       V  +    ++  + H++E +D  VV    YP P FPT S          SL
Sbjct: 62  WYTLQSQLNVTLSQLVSVTSTLQHFQETLDSTVV----YPLPKFPTTSHE--------SL 109

Query: 313 ATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKYMSQDI 372
            T L  + NI       P+ D + +    E +G    L  NE        E+EK + QD 
Sbjct: 110 VTTLLRKKNI-------PEVDEW-MKYVRETSGITPSLLKNE--------EIEKLLQQDK 153

Query: 373 E---WRRT 377
           E   W RT
Sbjct: 154 EITNWART 161

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 38.1 bits (87), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 9/50 (18%)

Query: 154 IGVMITASHNPKMDNGYKVYYSNGCQIIP---------PHDKNIAATIDE 194
           +GVMITASHNP  DNG K+   +G  ++           +  + AAT DE
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDE 109

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 37.7 bits (86), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 12/62 (19%)

Query: 154 IGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWDSTFEKNL 213
           +GVMITASHNP  DNG K        I+ P    + AT     EP++      ++F  N 
Sbjct: 60  VGVMITASHNPYQDNGVK--------IVEPDGSMLLAT----WEPYAMQLANAASFATNF 107

Query: 214 KE 215
           +E
Sbjct: 108 EE 109

>Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON}
           (136243..137955) [1713 nt, 571 aa]
          Length = 570

 Score = 37.7 bits (86), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 76/302 (25%), Positives = 129/302 (42%), Gaps = 50/302 (16%)

Query: 59  GTAGLRSRMEAGFSRMNPLVILQASQGLAKYIKAQFPT---NLTAVVGHDHRFHSKQFAM 115
           GT+GLR + +   S  N       ++   + I    P    N T VVG D RF++     
Sbjct: 19  GTSGLRKKTKIFMSEKN------YTENFIQSILNSIPNGVKNSTIVVGGDGRFYNDIILD 72

Query: 116 ITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVNHLNASI---GVMITASHN---PKMDNG 169
               +    G +   +  ++  + TP   + + +   S    G+++TASHN   P+ D G
Sbjct: 73  KIMQISAANGVRKLVIG-QNGILSTPAASYIIRNYKESCNGGGIILTASHNPGGPENDIG 131

Query: 170 YKVYYSNGCQIIPPHDKNIAATI---DENLEPWSSDWN---WDST-FEKNLKEKKLVYVR 222
            K   SNG     P  ++I   I    ++L  +    N    D+T   +N+K   L+   
Sbjct: 132 IKYNLSNGG----PAPESITDEIWEASKHLTHYKIIENLPQLDTTKVSENVKYGPLLVDI 187

Query: 223 EEMTNKYLQAMKDI----LVSSSI--SRPNNNGKKPWFVYTPMHGV----GYNIFTKISK 272
            + T  Y++ MK+I    L+ + I   R  NN K    ++  ++GV    G  IF  + +
Sbjct: 188 IDSTKSYVELMKEIFDFPLIRNFIHTQREKNNWK---LLFDSLNGVTGPYGKTIF--VDE 242

Query: 273 NILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNISLVIANDPDA 332
             L  +E +      +  +P P F  +  P+P    A +L  ++  E  I+   A+D D 
Sbjct: 243 LGLLADETL------QNWHPLPDFGGLH-PDPNLTYAHTLVERVDRE-MINFGAASDGDG 294

Query: 333 DR 334
           DR
Sbjct: 295 DR 296

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 154 IGVMITASHNPKMDNGYKVYYSNGCQII 181
           +GVMITASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 8/40 (20%)

Query: 151 NASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKNIAA 190
            A +GVM+TASHNP  DNG K        ++ PH + +AA
Sbjct: 55  GAYVGVMLTASHNPPEDNGVK--------LVDPHGEMLAA 86

>KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 104/251 (41%), Gaps = 26/251 (10%)

Query: 99  TAVVGHDHRFHSKQFAMITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVN--HLNASIGV 156
           T VVG D R+++       A +    G K   +  ++  + TP     +   H   + G+
Sbjct: 56  TLVVGGDGRYYNDVILEKIAKIGAANGVKKLVVG-QNGLLSTPAASHIIRSYHEKVTGGI 114

Query: 157 MITASHN---PKMDNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSS-----DWNW--D 206
           ++TASHN   PK D G K   +NG     P  +++   I EN +  +S     D      
Sbjct: 115 ILTASHNPGGPKNDMGIKYNLANGG----PAPESVTDKIWENSKKLTSYKIIKDLPTLDT 170

Query: 207 STFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISR--PNNNGKKPW-FVYTPMHGVG 263
           S   +N K   ++    ++T  Y++ +K+I     I +        K W  ++  ++G+ 
Sbjct: 171 SKIGENQKYGPILIDVIDVTKAYVEFLKEIFDFELIKKFIHTQRKTKNWKLLFDGLNGIT 230

Query: 264 YNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNIS 323
                 I  +     EN     V +  +P P F  +  P+P    A SL  ++ +E  I 
Sbjct: 231 GPYGKAIFVDEFELPENE----VLQNYHPQPDFGGLH-PDPNLTYARSLVDRVDKE-KIE 284

Query: 324 LVIANDPDADR 334
              A+D D DR
Sbjct: 285 FGAASDGDGDR 295

>YBR193C Chr2 complement(609082..609753) [672 bp, 223 aa] {ON}
           MED8Subunit of the RNA polymerase II mediator complex;
           associates with core polymerase subunits to form the RNA
           polymerase II holoenzyme; essential for transcriptional
           regulation
          Length = 223

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 51/128 (39%), Gaps = 31/128 (24%)

Query: 253 WFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSL 312
           W+       V  +    ++  + H++E +D  VV    YP P FPT S          SL
Sbjct: 62  WYTLQSQLNVTLSQLVSVTSTLQHFQETLDSTVV----YPLPKFPTTSHE--------SL 109

Query: 313 ATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKYMSQDI 372
            T L  + NI       P+ D + +    E +G    L  +E        E+EK + QD 
Sbjct: 110 VTTLLRKKNI-------PEVDEW-MKYVRETSGVTTALLKDE--------EIEKLLQQDR 153

Query: 373 E---WRRT 377
           E   W RT
Sbjct: 154 EITNWART 161

>Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 120/299 (40%), Gaps = 45/299 (15%)

Query: 59  GTAGLRSRMEAGFSRMNPLVILQASQGLAKYIKAQFP---TNLTAVVGHDHRFHSKQFAM 115
           GT+GLR + +    + N       ++   + I    P      T VVG D R+++     
Sbjct: 19  GTSGLRKKTKVFKDQPN------YTENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILN 72

Query: 116 ITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVNHL------NASIGVMITASHN---PKM 166
             A++    G K   +  +   + TP    + +H+        + G+++TASHN   P+ 
Sbjct: 73  KIAAIGSANGIKKLVIG-QYGLLSTP----AASHIMRTYEEECTGGIILTASHNPGGPEN 127

Query: 167 DNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWD----STFEKNLKEKKLVYVR 222
           D G K   SNG    P    N    I + L  +    ++      T  KN K   L+   
Sbjct: 128 DMGIKYNLSNGGP-APESVTNAIWDISKKLTNYKIVKDFPELDLKTIGKNKKYGPLLIDV 186

Query: 223 EEMTNKYLQAMKDILVSSSISR--PNNNGKKPW-FVYTPMHGV----GYNIFTKISKNIL 275
            ++T  Y+  +K I     I +   N    K W  ++  M+GV    G  IF  + +  L
Sbjct: 187 IDITKAYVDFLKKIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIF--VDEFGL 244

Query: 276 HYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNISLVIANDPDADR 334
             EE      V +  +P P F  +  P+P    A SL  ++  E  I    A+D D DR
Sbjct: 245 PAEE------VLQNWHPSPDFGGMH-PDPNLTYASSLVKRVDRE-KIEFGAASDGDGDR 295

>ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL127W (PGM1) and
           YMR105C (PGM2)
          Length = 568

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 67/298 (22%), Positives = 119/298 (39%), Gaps = 44/298 (14%)

Query: 59  GTAGLRSRMEAGFSRMNPLVILQASQGLAKYIKA------QFPTNLTAVVGHDHRFHSKQ 112
           GT+GLR + +         V  Q       +I+A      +   N   V+G D R+++  
Sbjct: 19  GTSGLRKKTK---------VFEQTEHYTENFIQAIMESIPEGSENAVLVIGGDGRYYNDA 69

Query: 113 FAMITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVN--HLNASIGVMITASHNPKM-DNG 169
                A V    G +   +  ++  + TP     +   H   + G+++TASHNP   DN 
Sbjct: 70  VMQKIAEVGSANGVRKLIIG-QNGLLSTPAASHIIRTYHDKVTGGIILTASHNPGGPDND 128

Query: 170 YKVYY--SNGCQIIPPHDKNIAATIDENLEPWSSDWNWD----STFEKNLKEKKLVYVRE 223
           + + Y  +NG    P    N       NL  +               +N +   L+    
Sbjct: 129 FGIKYNLANGAP-APEKVTNSMFERSRNLTHYKITRGMPKLDLGKIGENQQYGNLLVDVI 187

Query: 224 EMTNKYLQAMKDILVSSSISRPNNNGKKPW---FVYTPMHGV----GYNIFTKISKNILH 276
           + T  Y++ MK+I     I +   + +K +    ++  ++G+    G  IF      +  
Sbjct: 188 DPTEAYVRLMKEIFDFPLIKKFLEHAQKEYGLKVLFDALNGITGPYGKAIFV---DELGL 244

Query: 277 YEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNISLVIANDPDADR 334
            E+++  FV      P P F  +  P+P    A +L +++  E NI+   A+D D DR
Sbjct: 245 SEDSLQNFV------PKPDFGGLH-PDPNLTYAHTLVSRVDRE-NIAFGAASDGDGDR 294

>SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate which is a key step in hexose
           metabolism functions as the acceptor for a
           Glc-phosphotransferase and to YKL127W uniprot|P33401
           Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 571

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 126/303 (41%), Gaps = 52/303 (17%)

Query: 59  GTAGLRSRMEAGFSRMNPLVILQASQGLAKYIKA------QFPTNLTAVVGHDHRFHSKQ 112
           GT+GLR + +         V ++       +I+A      +   + T VVG D RF++  
Sbjct: 19  GTSGLRKKTK---------VFMEEPNYTENFIQAVMDAIPEGSQDATLVVGGDGRFYNDV 69

Query: 113 FAMITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVN---HLNASIGVMITASHNP---KM 166
                A++    G     +  ++  + TP     +    H   + G+++TASHNP   K 
Sbjct: 70  VVQKIAAIGAANGVHKLVIG-QNGILSTPAASHIIRTYPHAKITGGIILTASHNPGGAKN 128

Query: 167 DNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWDSTFEKNLKEKK--------L 218
           D G K   SNG     P  +++   I E  +  +S +   + F +    KK        L
Sbjct: 129 DFGIKYNLSNGG----PAPESVTNKIFEKSKQLTS-YKIVANFPQLDLSKKGTDQRYGPL 183

Query: 219 VYVREEMTNKYLQAMKDILVSSSISRPNNNGKKPW---FVYTPMHGV----GYNIFTKIS 271
           +    + T  Y++ MK I     I +     K+      ++  ++GV    G  +F  + 
Sbjct: 184 LVDIIDSTEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALF--VD 241

Query: 272 KNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNISLVIANDPD 331
           +  L  EE++  +V      P P F  +  P+P    A +L  ++ +++ I+   A+D D
Sbjct: 242 ELGLSAEESLQNYV------PKPDFGGLH-PDPNLTYAHTLVERV-DKDKIAFGAASDGD 293

Query: 332 ADR 334
            DR
Sbjct: 294 GDR 296

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/19 (78%), Positives = 16/19 (84%)

Query: 154 IGVMITASHNPKMDNGYKV 172
           +GVMITASHNP  DNG KV
Sbjct: 54  VGVMITASHNPPEDNGVKV 72

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 16/19 (84%)

Query: 154 IGVMITASHNPKMDNGYKV 172
           +GVMITASHNP  DNG K+
Sbjct: 58  VGVMITASHNPPQDNGVKI 76

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%)

Query: 153 SIGVMITASHNPKMDNGYKVYYSNG 177
           ++GVMITASHNP  DNG K+    G
Sbjct: 57  TVGVMITASHNPPEDNGVKIVDPKG 81

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%)

Query: 153 SIGVMITASHNPKMDNGYKV 172
           ++GVMITASHNP  DNG K+
Sbjct: 57  TVGVMITASHNPPEDNGVKI 76

>TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 66/297 (22%), Positives = 118/297 (39%), Gaps = 41/297 (13%)

Query: 59  GTAGLRSRMEAGFSRMNPLVILQASQGLAKYIKAQFPT---NLTAVVGHDHRFHSKQFAM 115
           GT+GLR + +   +  N       ++   + I    P    + T VVG D RF++     
Sbjct: 19  GTSGLRKKTKIFMNEPN------YTENFIQAILDAIPEGSEDSTLVVGGDGRFYNDVILQ 72

Query: 116 ITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVN--HLNASIGVMITASHN---PKMDNGY 170
           + A +    G +   +  +   + TP     +   H   + G+++TASHN   P+ D G 
Sbjct: 73  LIAEIGAANGVRKLIIG-QAGILSTPATSHVIRTYHEEVTGGIILTASHNPGGPENDIGI 131

Query: 171 KVYYSNGCQIIPPHDKNIAATIDENLEPWSS----------DWNWDSTFEKNLKEKKLVY 220
           K   +NG     P  +++   I E  +  ++          D N   T  +N+K   L+ 
Sbjct: 132 KYNLANGA----PAPESVTNAIWEESKKLTTYKIIKNFPKIDIN---TISENVKYGPLLV 184

Query: 221 VREEMTNKYLQAMKDILVSSSISR--PNNNGKKPW-FVYTPMHGVGYNIFTKISKNILHY 277
              E T  +++ +K I     I +        K W  ++  ++GV         K +   
Sbjct: 185 DIIEPTEAHVELLKGIFDFPLIKKFIETQRKTKNWKLLFDSLNGVT----GPYGKAVFVD 240

Query: 278 EENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNISLVIANDPDADR 334
           E  +    V +  +P P F  +  P+P      +L  ++ +E  I    A+D D DR
Sbjct: 241 EFGLPADEVLQNWHPQPDFGGLH-PDPNLTYGRTLVDRVDKE-KIEFGAASDGDGDR 295

>Skud_2.319 Chr2 complement(576416..577078) [663 bp, 220 aa] {ON}
           YBR193C (REAL)
          Length = 220

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 51/128 (39%), Gaps = 31/128 (24%)

Query: 253 WFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSL 312
           W+       V  +    ++  + H++E +D  VV    YP P FPT S          SL
Sbjct: 62  WYTLQSQLNVTLSQLVSVTSTLQHFQETLDSTVV----YPLPKFPTTSHE--------SL 109

Query: 313 ATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKYMSQDI 372
            T L  + NI       P+ D + +    E +G    +S N    L    E+ K + QD 
Sbjct: 110 VTTLLRKKNI-------PEVDEW-MKYVREASG----ISTN----LLKDEEMAKLLQQDK 153

Query: 373 E---WRRT 377
           E   W RT
Sbjct: 154 EITNWART 161

>NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 103/252 (40%), Gaps = 24/252 (9%)

Query: 97  NLTAVVGHDHRFHSKQFAMITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVNHLNASI-- 154
           + T VVG D RF++       A++    G K   +  ++  + TP     +      +  
Sbjct: 54  DATLVVGGDGRFYNDVIMNKIAAISAANGVKKLIIG-QNGLLSTPAASHIIRSYEEKVTG 112

Query: 155 GVMITASHN---PKMDNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWD----S 207
           G+++TASHN   P+ D G K   +NG    P    N    + + L  +    N+     S
Sbjct: 113 GIILTASHNPGGPENDLGIKYNLANGGP-APESVTNAIWEVSKKLTHYKIIKNFPPLDLS 171

Query: 208 TFEKNLKEKKLVYVREEMTNKYLQAMKDI----LVSSSISRPNNNGKKPW-FVYTPMHGV 262
              K+ K   L+    ++T  Y+  +K+I    L+   I +      K W  ++  ++G 
Sbjct: 172 KMGKDQKYGPLLVDIIDVTKDYVDFLKEIFDFELIKKFIHKQRET--KNWKLLFDSLNG- 228

Query: 263 GYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNI 322
              I     K I   E ++    V +  +P P F  +  P+P    A +L  ++  E  I
Sbjct: 229 ---ITGPYGKAIFVDEFDLPANEVLQNWHPKPDFGGLH-PDPNLTYAKTLVERVDRE-KI 283

Query: 323 SLVIANDPDADR 334
               A+D D DR
Sbjct: 284 EFGAASDGDGDR 295

>KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 124/301 (41%), Gaps = 49/301 (16%)

Query: 59  GTAGLRSRMEAGFSRMNPLVILQASQGLAKYIKAQFPT------NLTAVVGHDHRFHSKQ 112
           GT+GLR +           V ++       +I+A          + T V+G D RF++  
Sbjct: 20  GTSGLRKKTA---------VFMKEPHYTENFIQAILEAIPEGCKDATLVIGGDGRFYNDV 70

Query: 113 FAMITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVNHLN--ASIGVMITASHN---PKMD 167
                A++    G +   +  ++  + TP   + +      A+ G+++TASHN   P+ D
Sbjct: 71  VINKIAAISAANGVRKLVIG-QNGLLSTPATSYIIRSYKDKATGGIILTASHNPGGPEND 129

Query: 168 NGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWD----STFEKNLKEKKLVYVRE 223
            G K   +NG    P    N    I + L  +    ++     S    + K   L+    
Sbjct: 130 MGIKYNLANGGP-APESVTNAMWEISKKLTSYKIIKDFPTLDLSKIGNDQKYGPLLVDII 188

Query: 224 EMTNKYLQAMKDI----LVSSSIS--RPNNNGKKPWFVYTPMHGV----GYNIFTKISKN 273
           + T +Y++ +K I    L+ + I+  R  NN K    ++  ++G+    G  IF  + + 
Sbjct: 189 DTTKEYVEFLKTIFDFPLIKAFITKQRETNNWK---LLFDSLNGITGPYGKAIF--VDEF 243

Query: 274 ILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNISLVIANDPDAD 333
            L  EE +      +  +P P F  +  P+P    A +L  ++  E  I    A+D D D
Sbjct: 244 GLPAEEAL------QNWHPQPDFGGLH-PDPNLTYAKTLVERVDRE-KIQFGAASDGDGD 295

Query: 334 R 334
           R
Sbjct: 296 R 296

>Suva_4.447 Chr4 complement(779289..779972) [684 bp, 227 aa] {ON}
           YBR193C (REAL)
          Length = 227

 Score = 33.9 bits (76), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 49/130 (37%), Gaps = 37/130 (28%)

Query: 253 WFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSL 312
           W+       V  +    ++  + H++E++D  VV    YP P FPT S          SL
Sbjct: 66  WYTLQSQLNVTLSQLVSVTSTLQHFQESLDSTVV----YPLPKFPTTSHE--------SL 113

Query: 313 ATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGF---LFASFELEKYMS 369
            T L  + NI       P+ D            +W + +    G    L    E++K + 
Sbjct: 114 ITTLLRKKNI-------PEVD------------EWMKYARETSGITTNLLKDEEIQKLLR 154

Query: 370 QDIE---WRR 376
           QD E   W R
Sbjct: 155 QDKEITNWAR 164

>Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C
           (REAL)
          Length = 570

 Score = 34.7 bits (78), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 121/298 (40%), Gaps = 42/298 (14%)

Query: 59  GTAGLRSRMEAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITA 118
           GT+GLR + +   +   P       Q + + I  + P+  T VVG D RF++       A
Sbjct: 19  GTSGLRKKTKVFMNE--PHYTENFIQAMMECI-PEGPSGATLVVGGDGRFYNDVIMNKIA 75

Query: 119 SVFLRVGFKVYYLNPEDSFVHTPLVPFSV----NHLNASIGVMITASHN---PKMDNGYK 171
           +V    G K   +  +   + TP     +    ++ N   G+++TASHN   P+ D G K
Sbjct: 76  AVGAANGIKKLVIG-QAGLLSTPAASHIIRTYEDNCNGG-GIILTASHNPGGPENDLGIK 133

Query: 172 VYYSNGCQIIPPHDKNIAATIDENLEPWSS----------DWNWDSTFEKNLKEKKLVYV 221
               NG     P  +++   I E  +  +           D N      KN K   L+  
Sbjct: 134 YNLPNGG----PAPESVTDAIWEASKKLTHYKIIKSFPELDLN---KIGKNQKYGPLLVD 186

Query: 222 REEMTNKYLQAMKDI----LVSSSISRPNNNGKKPW-FVYTPMHGVGYNIFTKISKNILH 276
             + T  Y++ +K+I    L+ S ++       K W  ++  ++G    I     K I  
Sbjct: 187 IIDPTKAYVKFLKEIFDFDLIKSFLTEQRK--AKGWKLLFDSLNG----ITGPYGKAIFV 240

Query: 277 YEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNISLVIANDPDADR 334
            E  +    V +  +P P F  +  P+P    A +L  ++  E  I+   A+D D DR
Sbjct: 241 DEFGLPAEEVLQNWHPLPDFGGLH-PDPNLTYARTLVDRVDRE-KIAFGAASDGDGDR 296

>TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445
           YKL127W
          Length = 570

 Score = 34.7 bits (78), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 99/251 (39%), Gaps = 27/251 (10%)

Query: 101 VVGHDHRFHSKQFAMITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVNHLN------ASI 154
           VVG D R+++ +   I A++    G +   +  +   + TP     +           + 
Sbjct: 56  VVGGDGRYYNDKILQIIAAISAANGVRKLVIG-QHGLLSTPAASHIIRSYQDKDGKKVTG 114

Query: 155 GVMITASHN---PKMDNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWS-----SDWNWD 206
           G+++TASHN   P+ D G K   SNG    P    N    I + L  +       + N  
Sbjct: 115 GIILTASHNPGGPENDIGIKYNLSNGGP-APESVTNAIWDISKKLTHYKIVKGFPEINLS 173

Query: 207 STFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISR--PNNNGKKPW-FVYTPMHGVG 263
              EK+     LV    + T +Y+  +K I     I +        K W  ++  ++GV 
Sbjct: 174 VKGEKSYGS--LVIDVVDTTQEYVDFLKGIFDFDLIKKFVDTQRSTKNWKLLFDGLNGVT 231

Query: 264 YNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNIS 323
                 I  + L   EN     V +  +P P F  +  P+P    A +L  ++ +E  I 
Sbjct: 232 GPYGRAIFVDELGLPENE----VLQNCHPKPDFGGI-HPDPNLTYARTLVDRVDKE-KIE 285

Query: 324 LVIANDPDADR 334
              A+D D DR
Sbjct: 286 FGAASDGDGDR 296

>Skud_11.102 Chr11 (190406..192118) [1713 bp, 570 aa] {ON} YKL127W
           (REAL)
          Length = 570

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 69/298 (23%), Positives = 115/298 (38%), Gaps = 42/298 (14%)

Query: 59  GTAGLRSRMEAGFSRMNPLVILQASQGLAKYIKAQF------PTNLTAVVGHDHRFHSKQ 112
           GT+GLR + +         V +        +I+A        P   T VVG D RF++  
Sbjct: 19  GTSGLRKKTK---------VFMNEPHYTENFIQAMMESIPNGPDGATLVVGGDGRFYNDV 69

Query: 113 FAMITASVFLRVGFKVYYLNPEDSFVHTPLVPFSV----NHLNASIGVMITASHN---PK 165
                A+V    G +   +  +   + TP     +    +  N   G+++TASHN   P+
Sbjct: 70  IMNKIAAVGAANGIRKLIIG-QGGLLSTPAASHIIRTYEDRCNGG-GIILTASHNPGGPE 127

Query: 166 MDNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWD----STFEKNLKEKKLVYV 221
            D G K    NG    P    N      + L  +    N+     +   KN     L+  
Sbjct: 128 NDLGIKYNLRNGGP-APESVTNAIWEASKKLTHYKIVTNFPELDMNKLGKNQNYGPLLVD 186

Query: 222 REEMTNKYLQAMKDI----LVSSSISRPNNNGKKPW-FVYTPMHGVGYNIFTKISKNILH 276
             +    Y+Q +K+I    L+ S ++       K W  ++  ++G    I     K I  
Sbjct: 187 IIDPARAYVQFLKEIFDFDLIKSFLTEQRRT--KGWKLLFDSLNG----ITGPYGKAIFV 240

Query: 277 YEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNISLVIANDPDADR 334
            E  +    V +  +P P F  +  P+P    A +L +++  E  I+   A+D D DR
Sbjct: 241 DEFGLPAEEVLQNWHPLPDFGGLH-PDPNLTYARTLVSRVDRE-KIAFGAASDGDGDR 296

>TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa]
           {ON} Anc_2.445 YKL127W
          Length = 569

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 69/294 (23%), Positives = 118/294 (40%), Gaps = 35/294 (11%)

Query: 59  GTAGLRSRMEAGFSRMNPLVILQASQGLAKYIKAQFP---TNLTAVVGHDHRFHSKQFAM 115
           GT+GLR + +      N       ++   + I    P    + T VVG D RF++     
Sbjct: 19  GTSGLRKKTKVFMDEPN------YTENFIQAIMDAIPEGSKDATLVVGGDGRFYNDVIMN 72

Query: 116 ITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVNHLNASI--GVMITASHNPKM---DNGY 170
             A++    G K   +  ++  + TP     +      +  G+++TASHNP     D G 
Sbjct: 73  KIAAIGAANGVKKLIIG-QNGILSTPAASHIIRTYKDKVTGGIILTASHNPGGPTNDLGI 131

Query: 171 KVYYSNGCQIIPPHDKNIAATIDENLEPWS-----SDW-NWD-STFEKNLKEKKLVYVRE 223
           K    NG     P  + +   I E  +  +     +D+   D +T  +N K   L+    
Sbjct: 132 KYNLGNGA----PAPEAVTDAIWEASKKLTDYKIVNDFPELDLATIVENKKYGNLLVDII 187

Query: 224 EMTNKYLQAMKDILVSSSISR--PNNNGKKPW-FVYTPMHGVGYNIFTKISKNILHYEEN 280
           + T  Y++ MK+I     I +   +    K W  ++  ++GV         K I   E  
Sbjct: 188 DSTEAYVKYMKEIFDFPLIKKFIVSQRETKNWKLLFDSLNGVT----GPYGKAIFADEFG 243

Query: 281 MDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNISLVIANDPDADR 334
           +    V +   P P F  +  P+P    A +L +++ +E  I    A+D D DR
Sbjct: 244 LPADEVLQNYVPKPDFGGLH-PDPNLTYAKTLVSRVDKE-KIEFGAASDGDGDR 295

>ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 569

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 126/607 (20%), Positives = 226/607 (37%), Gaps = 110/607 (18%)

Query: 59  GTAGLRSRMEAGFSRMNPLVILQASQGLAKYIKAQFPTNL---TAVVGHDHRFHSKQFAM 115
           GT+GLR R +      N       ++   + I    P  +     +VG D R+++     
Sbjct: 19  GTSGLRKRTKVFAEEPN------YTENFIQAILEAIPEGVKDSVLLVGGDGRYYNDVVLQ 72

Query: 116 ITASVFLRVGFKVYYLNPEDSFVHTPL---VPFSVNHLNASIGVMITASHNPKMDN---G 169
             A++    G K   +  ++  + TP    V  S +    + G+++TASHNP   N   G
Sbjct: 73  KIAAIGAANGVKRLVVG-QNGILSTPAASHVIRSYSKAKVTGGIILTASHNPGGPNNDFG 131

Query: 170 YKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWDSTFEKNLKEKK---LVYVREEMT 226
            K   +NG    P +  N      + L  +    ++       L EK+   L     + T
Sbjct: 132 IKYNLANGGP-APENVTNAMWEASKRLTSYKIVTDFPHVDLSALGEKQYGSLTVDVIDST 190

Query: 227 NKYLQAMKDI----LVSSSISRPNNNGKKPW-FVYTPMHGVGYNIFTKISKNILHYEENM 281
             Y+  +K I    L+ S ++       K W  ++  ++GV       I  + L   E+ 
Sbjct: 191 KAYVDFLKTIFDFPLIKSFVNHQRET--KNWKLLFDGLNGVTGPYGRAIFADELGLPEDE 248

Query: 282 DYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNISLVIANDPDADRFSVASKN 341
               V +  +P P F  +  P+P    A +L  ++  E NI+   A+D D DR  +    
Sbjct: 249 ----VLQNCHPKPDFGGLH-PDPNLTYARTLVDRVDRE-NIAFGAASDGDGDRNMIYG-- 300

Query: 342 EKTGQWQQLSGNEIGFLFASFELEKYMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESF 401
              G      G+ +        + +Y S+   ++R     +  S  +SQ I  +A+  + 
Sbjct: 301 --AGPAFVSPGDSVAI------IAEYASEIPYFQREGIYGLARSFPTSQAIDLVAKHHNL 352

Query: 402 HYEDTLTGFKW----IGNRALDLQGQGYYVPFGFEEAIGYMFPTMVTDKDGVSAAVVFLL 457
              +  TG+K+       + L + G         EE+ G      + +KDG+ A +    
Sbjct: 353 SCYEVPTGWKFFCALFDAKKLSICG---------EESFG-TGSNHIREKDGLWAIIA--- 399

Query: 458 AYSYWLNNDGSYPFDILEXXXXXXXXXXEYNGYYIYDDPKTTKQIFDFVRYQYDTSGNPY 517
               WLN    Y     E          E+   Y         + F F RY Y+      
Sbjct: 400 ----WLNILAIYHKRNPEKDVSIKTIQDEFWDKY--------GRTF-FTRYDYENVSGEA 446

Query: 518 PKNIGKEFKIEVFRDLTT--GYQSNTIDNLPNLPVDPHSEMITIEAVPKQDIGKS----- 570
              +     IE F++  +  G + +      N P+D   +++       +D+  S     
Sbjct: 447 ANRV-----IEFFQNFVSQPGVKGS------NFPLDESLKVVDAGDFEYKDLDGSVSSNQ 495

Query: 571 --------KVRFTMRGSGT---EPKLKLYIEAVADNEKCAIDLAYEMWNVLKKEWIRPDV 619
                    VR  +R SGT      ++LY+E  +D+           + +  +E++RP +
Sbjct: 496 GLFLKLSNGVRTVLRLSGTGSAGATIRLYVEQYSDDA--------SKYGLTAEEFLRPAI 547

Query: 620 TGLTTTF 626
             L + F
Sbjct: 548 QQLVSFF 554

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 137 FVHTPLVPFSVNHLNAS-IGVMITASHNPKMDNGYKV 172
           F    L      HL    +G MITASHNP  DNG K+
Sbjct: 40  FTTGVLACLRSMHLKGQYVGAMITASHNPPQDNGVKL 76

>KAFR0K01090 Chr11 complement(226784..227431) [648 bp, 215 aa] {ON}
           Anc_7.130 YIL007C
          Length = 215

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 29/53 (54%)

Query: 526 KIEVFRDLTTGYQSNTIDNLPNLPVDPHSEMITIEAVPKQDIGKSKVRFTMRG 578
           ++ + +D      +N+I+ L +  VD HS ++T E  P++DI   +VR   R 
Sbjct: 31  EVIILKDDIESELNNSINLLQSFNVDMHSSLVTPEGFPREDIDVLQVRMLRRN 83

>YKL127W Chr11 (203541..205253) [1713 bp, 570 aa] {ON}
           PGM1Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate, which is a key step in hexose
           metabolism
          Length = 570

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 115/297 (38%), Gaps = 40/297 (13%)

Query: 59  GTAGLRSRMEAGFSRMNPLVILQASQGLAKYIKAQFPT------NLTAVVGHDHRFHSKQ 112
           GT+GLR + +         V +        +I+A   +        T VVG D RF++  
Sbjct: 19  GTSGLRKKTK---------VFMDEPHYTENFIQATMQSIPNGSEGTTLVVGGDGRFYNDV 69

Query: 113 FAMITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVNHLNASI---GVMITASHN---PKM 166
                A+V    G +   +  +   + TP     +          G+++TASHN   P+ 
Sbjct: 70  IMNKIAAVGAANGVRKLVIG-QGGLLSTPAASHIIRTYEEKCTGGGIILTASHNPGGPEN 128

Query: 167 DNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWD----STFEKNLKEKKLVYVR 222
           D G K    NG    P    N      + L  +    N+     +   KN K   L+   
Sbjct: 129 DLGIKYNLPNGGP-APESVTNAIWEASKKLTHYKIIKNFPKLNLNKLGKNQKYGPLLVDI 187

Query: 223 EEMTNKYLQAMKDI----LVSSSISRPNNNGKKPW-FVYTPMHGVGYNIFTKISKNILHY 277
            +    Y+Q +K+I    L+ S +++   +  K W  ++  ++G    I     K I   
Sbjct: 188 IDPAKAYVQFLKEIFDFDLIKSFLAKQRKD--KGWKLLFDSLNG----ITGPYGKAIFVD 241

Query: 278 EENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNISLVIANDPDADR 334
           E  +    V +  +P P F  +  P+P    A +L  ++  E  I+   A+D D DR
Sbjct: 242 EFGLPAEEVLQNWHPLPDFGGLH-PDPNLTYARTLVDRVDRE-KIAFGAASDGDGDR 296

>KAFR0A04200 Chr1 complement(842429..843211) [783 bp, 260 aa] {ON}
           Anc_8.740 YOR280C
          Length = 260

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 169 GYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVRE 223
           GY+++Y  G ++IP +D  +    D  +  W    N DS  E  +K K + Y+RE
Sbjct: 32  GYELHYPCGTEVIPANDVGLEEDTDAEMFGWFVR-NKDSFTEFEIKPKTINYLRE 85

>TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {ON}
           Anc_2.445 YKL127W
          Length = 571

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 100/249 (40%), Gaps = 21/249 (8%)

Query: 99  TAVVGHDHRFHSKQFAMITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVNHL---NASIG 155
           T VVG D R+++       A++    G K   +  ++  + TP     +        + G
Sbjct: 57  TLVVGGDGRYYNDAILHNIAAIGAANGVKKLIVG-QNGLLSTPAASHIIRTYAPGEITGG 115

Query: 156 VMITASHN---PKMDNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWD----ST 208
           +++TASHN   PK D G K    NG     P  + I     + L+ +    ++      T
Sbjct: 116 IILTASHNPGGPKNDMGIKYNIQNGAPAPEPVTEAIWEA-SKKLQNYKIIKDFPELELKT 174

Query: 209 FEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNNNGKKP--W-FVYTPMHGVGYN 265
             KN +   L+    +    Y+Q +K+I     I +  +  +K   W  ++  M+GV   
Sbjct: 175 LGKNKQYGPLLVDVIDTCEAYVQFIKEIFDFPLIKKFVDTQRKTKNWKLLFDGMNGV--- 231

Query: 266 IFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNISLV 325
                 K I   E  +    V +  +P P F     P+P    A SL  ++ +E  I   
Sbjct: 232 -TGPYGKAIFVDELGLPADEVLKDWHPSPDFGG-HHPDPNLTYAKSLVDRVDKE-KIEFG 288

Query: 326 IANDPDADR 334
            A+D D DR
Sbjct: 289 AASDGDGDR 297

>Skud_2.291 Chr2 (533122..534864) [1743 bp, 580 aa] {ON} YBR163W
           (REAL)
          Length = 580

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query: 5   PSIICDDCPANLRE-NIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFD 53
           P+ I    P NL+   ID+ L+Q K E  R  V QLC   NW EL   +D
Sbjct: 101 PAFINYRLPRNLQNPYIDIQLKQLKKE--RMSVTQLCSTQNWCELRNFYD 148

>CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c PGM2 phosphoglucomutase
          Length = 567

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 66/293 (22%), Positives = 118/293 (40%), Gaps = 33/293 (11%)

Query: 59  GTAGLRSRMEAGFSRMNPLVILQASQGLAKYIKAQFP---TNLTAVVGHDHRFHSKQFAM 115
           GT+GLR + +      N       ++   + I    P    +   VVG D RF++     
Sbjct: 17  GTSGLRKKTKVFMEEPN------YTENFIQAIMDAIPEGAKDAVLVVGGDGRFYNDVIMQ 70

Query: 116 ITASVFLRVGFKVYYLNPEDSFVHTPLVPFSVNHL--NASIGVMITASHN---PKMDNGY 170
             A++    G +   +  ++  + TP     +       + G+++TASHN   P+ D G 
Sbjct: 71  KIAAIGAANGVRKLIIG-QNGLLSTPAASHVIRSYAEKCTGGIILTASHNPGGPENDLGI 129

Query: 171 KVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWDST-FEKNLKEKK---LVYVREEMT 226
           K   +NG    P    N    + + L  +    ++    F K  K+++   L+    + T
Sbjct: 130 KYNLANGGP-APEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGPLLVDIIDTT 188

Query: 227 NKYLQAMKDI----LVSSSISRPNNNGKKPW-FVYTPMHGVGYNIFTKISKNILHYEENM 281
             Y++ MK+I    L+   I +      K W  ++  ++G    I     K I   E ++
Sbjct: 189 EDYVKFMKEIFDFKLIKEFIHKQRE--AKNWKLLFDSLNG----ITGPYGKAIFVDEFDL 242

Query: 282 DYFVVKEQMYPDPAFPTVSFPNPEEKGALSLATKLAEENNISLVIANDPDADR 334
               V +  +P P F  +  P+P    A +L  ++  E  I    A+D D DR
Sbjct: 243 PADEVLQNWHPQPDFGGLH-PDPNLTYAHTLVERVDRE-KIEFGAASDGDGDR 293

>Kpol_1002.41 s1002 (121367..124873) [3507 bp, 1168 aa] {ON}
           (121367..124873) [3507 nt, 1169 aa]
          Length = 1168

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 67/173 (38%), Gaps = 25/173 (14%)

Query: 5   PSIICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLR 64
           P I+ D  P  L  N+++W               + +   W   ++ F  R+ F T    
Sbjct: 8   PIILPDPKPLPLDLNVNVW--------------HIDETGEWFLTYREFLERMDFYTRHYF 53

Query: 65  SRMEAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHS-KQFAMITASVFLR 123
           +    G S +     L + +   KY++ +FP  L   V     F+S K+   +  SV+ R
Sbjct: 54  TCEITGTSCLTFFQALDSEESQFKYVEERFPIKLREPVARFLHFNSVKRLDALVESVYAR 113

Query: 124 V------GFKVYYLNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGY 170
                  G  V+    +DS V++     +     +S+ +  T S    MDN Y
Sbjct: 114 FKNDFFPGEVVFLRKNKDSNVNSHQTTPAPEESISSVPITSTVS----MDNSY 162

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,295,491
Number of extensions: 3231842
Number of successful extensions: 8687
Number of sequences better than 10.0: 79
Number of HSP's gapped: 8872
Number of HSP's successfully gapped: 79
Length of query: 626
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 510
Effective length of database: 40,180,143
Effective search space: 20491872930
Effective search space used: 20491872930
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)