Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0K004008.843ON55355325510.0
NCAS0A02540singletonON53953218100.0
NCAS0C004008.843ON51748417690.0
KAFR0B03930singletonON55549016040.0
KAFR0B039408.843ON54754415570.0
KNAG0J002608.843ON55052915530.0
NDAI0E002808.843ON54953415280.0
Skud_13.4518.843ON53953415190.0
YMR279C8.843ON54052715180.0
Suva_13.4678.843ON54353815120.0
CAGL0M03003g8.843ON55851915070.0
Smik_13.4928.843ON54353715020.0
YML116W (ATR1)8.843ON54253114760.0
NCAS0B002908.843ON54251714640.0
Skud_13.258.843ON53753314540.0
KNAG0G034308.843ON54250514540.0
Smik_13.188.843ON54553714520.0
TDEL0B005508.843ON53749414450.0
TPHA0C047908.843ON55648414280.0
Suva_13.278.843ON55353414220.0
CAGL0B02343g8.843ON53748613910.0
Kpol_541.168.843ON52849213820.0
SAKL0D01386g8.843ON52151613640.0
TBLA0D032708.843ON55053413550.0
KLTH0C03806g8.843ON52551113161e-177
Kwal_27.102458.843ON51551213121e-176
KAFR0A028408.843ON52048513021e-175
TBLA0D03280singletonON58056212521e-166
TBLA0C01160singletonON60047610941e-142
Smik_15.560na 1ON5164578051e-100
Skud_15.545na 1ON5165248001e-99
YOR378Wna 1ON5154577992e-99
Suva_8.435na 1ON5154797973e-99
KLTH0C10560gna 1ON5154937773e-96
KLLA0B00352gna 1ON4984617538e-93
Kwal_23.6547na 1ON5115037303e-89
TDEL0G04950singletonON5125137069e-86
KNAG0D00130na 1ON5655364643e-50
KAFR0C04860na 1ON5344884029e-42
SAKL0C06116gsingletonON1851253734e-41
CAGL0L02519gna 1ON5295203525e-35
NCAS0A05720na 1ON5635313155e-30
NDAI0K02730singletonON6045273149e-30
SAKL0F00440gsingletonON5444741332e-07
Kwal_34.15746na 2ON5185281199e-06
KLLA0C18931gna 2ON5532451126e-05
Smik_6.24na 3ON5445311091e-04
NCAS0A078102.473ON5682421072e-04
Ecym_73992.473ON5632131054e-04
ABL040W2.473ON5672201020.001
TDEL0D06610singletonON49788930.012
YMR088C (VBA1)2.473ON56298930.012
NDAI0H022002.473ON571135930.012
Skud_13.2442.473ON56298920.015
Suva_13.2652.473ON56198900.026
SAKL0E02992g2.473ON570172900.028
Smik_13.2722.473ON56198890.035
Skud_6.16na 3ON549476890.036
CAGL0J01375g2.473ON564124880.038
KLLA0F13684g2.473ON571176880.040
Suva_10.11singletonON540501880.040
KLLA0E24113g8.570ON575242860.070
KLTH0H16214gsingletonON551103820.20
KLTH0D16962gsingletonON571126800.37
SAKL0A08228gsingletonON569148780.64
KLTH0C10142gsingletonON573228780.73
Kpol_467.242.473ON370122760.92
KLTH0G09350g2.241ON563173761.3
NCAS0C03460na 4ON630134761.3
ZYRO0G03234g2.473ON56281751.5
Smik_18.10singletonON53187751.6
Kwal_23.48142.241ON529235741.8
KNAG0E025602.473ON57881741.9
Klac_YGOB_Anc_2.2412.241ON602128732.6
SAKL0D04510gna 5ON531117723.1
KLTH0D05434g2.473ON57686723.4
YKR105C (VBA5)singletonON582144714.3
YPR198W (SGE1)singletonON543151705.5
Smik_12.114.6ON166135715.7
TDEL0G03260singletonON612134705.9
TPHA0G031502.473ON60043707.1
NDAI0B037702.242ON571282697.2
TDEL0A024902.473ON55481698.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0K00400
         (553 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               987   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   701   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      686   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   622   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   604   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   602   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      593   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   589   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   589   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   587   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   585   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   583   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   573   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      568   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   564   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   564   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   563   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   561   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   554   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   552   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   540   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   536   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   530   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   526   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   511   e-177
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   509   e-176
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   506   e-175
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   486   e-166
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   426   e-142
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   314   e-100
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   312   1e-99
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   312   2e-99
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   311   3e-99
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   303   3e-96
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   294   8e-93
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   285   3e-89
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   276   9e-86
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   183   3e-50
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     159   9e-42
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   148   4e-41
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   140   5e-35
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            125   5e-30
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   125   9e-30
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    56   2e-07
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    50   9e-06
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    48   6e-05
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    47   1e-04
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    46   2e-04
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    45   4e-04
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    44   0.001
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    40   0.012
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    40   0.012
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    40   0.012
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    40   0.015
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    39   0.026
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    39   0.028
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    39   0.035
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    39   0.036
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    39   0.038
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    39   0.040
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    39   0.040
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    38   0.070
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    36   0.20 
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    35   0.37 
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    35   0.64 
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    35   0.73 
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    34   0.92 
KLTH0G09350g Chr7 (778062..779753) [1692 bp, 563 aa] {ON} simila...    34   1.3  
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    34   1.3  
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    33   1.5  
Smik_18.10 Chr18 complement(16419..18014) [1596 bp, 531 aa] {ON}...    33   1.6  
Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W...    33   1.8  
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    33   1.9  
Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 b...    33   2.6  
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    32   3.1  
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    32   3.4  
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    32   4.3  
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    32   5.5  
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...    32   5.7  
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               32   5.9  
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    32   7.1  
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    31   7.2  
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    31   8.3  

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  987 bits (2551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/553 (88%), Positives = 492/553 (88%)

Query: 1   MPTHITEIKEPVSVNEANLLESQSTIDCTSSERKTAIKEQDDEIGXXXXXXXXXXLQENN 60
           MPTHITEIKEPVSVNEANLLESQSTIDCTSSERKTAIKEQDDEIG          LQENN
Sbjct: 1   MPTHITEIKEPVSVNEANLLESQSTIDCTSSERKTAIKEQDDEIGSDSTTTSSSSLQENN 60

Query: 61  SSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMAS 120
           SSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMAS
Sbjct: 61  SSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMAS 120

Query: 121 FPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGL 180
           FPLVSGSFILISGRLGDIYGLKR           WSLICGFTNYAHSDTFFIVARAFQGL
Sbjct: 121 FPLVSGSFILISGRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVARAFQGL 180

Query: 181 GISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWI 240
           GISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWI
Sbjct: 181 GISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWI 240

Query: 241 FXXXXXXXXXCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWE 300
           F         CLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWE
Sbjct: 241 FYAYAVAAAVCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWE 300

Query: 301 KAYXXXXXXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTF 360
           KAY                 YEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTF
Sbjct: 301 KAYIIVLLIVSVIFLIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTF 360

Query: 361 YYFAFQLNLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSI 420
           YYFAFQLNLREYSPVWSG              TTVALTIKKVGPAILLFFSAIGFTCGSI
Sbjct: 361 YYFAFQLNLREYSPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGFTCGSI 420

Query: 421 IMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYS 480
           IMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYS
Sbjct: 421 IMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYS 480

Query: 481 TSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNAKD 540
           TSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNAKD
Sbjct: 481 TSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNAKD 540

Query: 541 PKDLQRCGTGSNI 553
           PKDLQRCGTGSNI
Sbjct: 541 PKDLQRCGTGSNI 553

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/532 (63%), Positives = 404/532 (75%), Gaps = 7/532 (1%)

Query: 22  SQSTIDCTSSERKTAIKEQDDEIGXXXXXXXXXXLQENNSSWQNPDYFSSSFKEYIFVAT 81
           S ST+   + ++  +  E++              + +++S WQNP+YFSS +KEY F+ T
Sbjct: 15  SSSTVSFPNEDKNISHNEKE------VYSNSTDSVLDDDSPWQNPNYFSSKYKEYFFIFT 68

Query: 82  CMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGL 141
           CM+ANLLNQAGQ+QVLS MNVIS+SFHS +G QTWLMASFPLVSGSFILISGR+GDIYGL
Sbjct: 69  CMVANLLNQAGQTQVLSTMNVISESFHSDSGKQTWLMASFPLVSGSFILISGRIGDIYGL 128

Query: 142 KRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGT 201
           K+           WSL+CGF ++ H+DTFFIV RAFQGLGISFILPNVMGL+GNIYKVGT
Sbjct: 129 KKTMIGGYIFMIIWSLLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGT 188

Query: 202 LRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLVMGYYTVPD 261
           LRKN+VIS+IG+ APTG+C GALWGGLIVTEN KQWPWIF          L+M  Y+VP+
Sbjct: 189 LRKNIVISMIGLTAPTGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSVPN 248

Query: 262 NIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXXXXXXXXXXXXXXXY 321
            IPTNV+ F MDWIGS++GV+GLILFNFVWNQGP+ GW+KAY                 Y
Sbjct: 249 CIPTNVHNFAMDWIGSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFVVY 308

Query: 322 EIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGXXX 381
           E+KY   PLLP  VT+NG ILTIL++LFLGWG+FGIWTFYYFAFQLNLR+YSPVW G   
Sbjct: 309 ELKYPISPLLPVEVTKNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTY 368

Query: 382 XXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQII 441
                        VA TIKKVGPAILLFFSA+GFT GS+++SVTP+HQ YWR   GMQII
Sbjct: 369 FMFIIWGTIAALIVAFTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQII 428

Query: 442 LVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDD 501
           L FGMDL FPASSIILSD+LPMQYQGMA SLVNT++NY+TSLCLGMGTTVERQINKSG+D
Sbjct: 429 LCFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSGED 488

Query: 502 LLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNAKDPKDLQRCGTGSNI 553
           LLKGYR+ALY  VG+ GLG+CIAF+N+C+ +W KR  +   DL+   T  ++
Sbjct: 489 LLKGYRSALYLAVGLGGLGSCIAFINLCYTLWMKRRDR-LADLKSVSTDDSV 539

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/484 (67%), Positives = 380/484 (78%)

Query: 56  LQENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQT 115
           L EN++ WQN  YF S  KEY F+ TCM ANLLNQAGQ+QVLS MNVIS+SFHS  G QT
Sbjct: 21  LLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGTQT 80

Query: 116 WLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVAR 175
           WLMASFPLVSGSFILISGR+GDIYGLK+           W+L+CGF +Y HSDTFFIV R
Sbjct: 81  WLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIVCR 140

Query: 176 AFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPK 235
           AFQGLGISFILPN+MGLVGNIYKVGTLRKN+VISLIGI APTG+C GALWGGLI TE+ +
Sbjct: 141 AFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATESSR 200

Query: 236 QWPWIFXXXXXXXXXCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGP 295
           QWPWIF          L+M  Y+VP+N+PTNV+ F MDW+G+++GV+GLILFNFVWNQGP
Sbjct: 201 QWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGVVGLILFNFVWNQGP 260

Query: 296 IVGWEKAYXXXXXXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSF 355
           + GW K Y                 YE+K+   PLLP+ VT+NG ILTIL +LFLGWGSF
Sbjct: 261 VNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREVTKNGQILTILGILFLGWGSF 320

Query: 356 GIWTFYYFAFQLNLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGF 415
           GIWTFYY+AFQLNLR YSP+W+G                V  TI +VGPA+LLFFSA+GF
Sbjct: 321 GIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPAVLLFFSALGF 380

Query: 416 TCGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNT 475
           T GS+++SVTP+HQTYWR   GMQIIL FGMDL FPASSIILSD+LPMQYQGMA SLVNT
Sbjct: 381 TMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLVNT 440

Query: 476 IVNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSK 535
           I+NYSTSLCLGMGTTVERQINK+G++LL+GYR+ALY  VG+ GLGAC+AFLN+C+D+W K
Sbjct: 441 IINYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAVGLGGLGACVAFLNLCYDLWRK 500

Query: 536 RNAK 539
           R ++
Sbjct: 501 RKSR 504

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/490 (61%), Positives = 363/490 (74%), Gaps = 1/490 (0%)

Query: 23  QSTIDCTSSERKTAIKEQDDEIGXXXXXX-XXXXLQENNSSWQNPDYFSSSFKEYIFVAT 81
           ++TI+  + +  T++ E+   I              +NN+ WQNP YFSS +KEY+F+ T
Sbjct: 28  KATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILT 87

Query: 82  CMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGL 141
           CM++NLLNQAGQ+Q  S MNVI  +F++ +  +TWLMASFPLVSGSFIL+SGR+GDIYGL
Sbjct: 88  CMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGL 147

Query: 142 KRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGT 201
           KR           WSLICGF NY+ S TFFI+ RAFQGLGI+F+LPNVMGLVGNIYKVG+
Sbjct: 148 KRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGS 207

Query: 202 LRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLVMGYYTVPD 261
           LRKN+VIS IG+ APTG+ FGA W GLI T+  KQWPWIF          LV+  Y++PD
Sbjct: 208 LRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPD 267

Query: 262 NIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXXXXXXXXXXXXXXXY 321
            +P NV+GF+MDW GSV+GVIGLILFNFVWN+ PIVGWEKAY                 Y
Sbjct: 268 TVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYIIVLLIFSLLIIVVFFIY 327

Query: 322 EIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGXXX 381
           EIK+AK PLLP+AVT N +I+ IL+ +F+GWGSFGIWTFYY+AF LNLR Y+P+ +G   
Sbjct: 328 EIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASH 387

Query: 382 XXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQII 441
                       TVA TIK+VGP++LLF S + FT GSI++S+TPVHQTYW+ TFGMQII
Sbjct: 388 CMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQII 447

Query: 442 LVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDD 501
           L FGMDL FPASSIILSD LPM+YQGMA SLVNTIVNYSTSLCLGMGTT E Q+NK+G D
Sbjct: 448 LAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTD 507

Query: 502 LLKGYRAALY 511
           LLKGYRAALY
Sbjct: 508 LLKGYRAALY 517

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/544 (54%), Positives = 366/544 (67%), Gaps = 13/544 (2%)

Query: 7   EIKEPVSVNEANLLESQSTIDCTS-SERKTAIKEQDDEIGXXXXXXXXXXLQENNSSWQN 65
           E K P+   +   + +Q+++D  S S +K  I   DD++              NNS WQ+
Sbjct: 14  EEKNPIEDFQTTTVTAQTSLDVLSDSVKKDQISITDDDVSSI----------SNNSKWQD 63

Query: 66  PDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVS 125
           P YF SS++EY F+ TCM+ANLLNQAGQ+Q LS MNV++DS +S    +TWLMASF L S
Sbjct: 64  PTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLAS 123

Query: 126 GSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFI 185
           GSFIL+SGR+GDIYGLK            WS++CG + Y  + TFFI+ RAFQGLG++F+
Sbjct: 124 GSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFV 183

Query: 186 LPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXX 245
           LPNVMGLVGNIY VG++RKN+VIS IG MAP G  FG +WGGLIV  N  QWPWIF    
Sbjct: 184 LPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATA 243

Query: 246 XXXXXCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXX 305
                 L+MG Y++P+++PTN+    MDWIGS+LGVIGLIL NFVWNQ PI GW KAY  
Sbjct: 244 IAVFINLIMGIYSIPNHVPTNIYNLKMDWIGSLLGVIGLILMNFVWNQAPISGWSKAYII 303

Query: 306 XXXXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAF 365
                          YE+K A+ PLLP  VT+N HI+TI+  LFLGWG+FGIWTFYY+AF
Sbjct: 304 VILIVAVFFLVAFFIYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAF 363

Query: 366 QLNLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVT 425
            LNLR +SP+W+G               TVA TI KVGP++L   S+IGFTCG+II SVT
Sbjct: 364 NLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVT 423

Query: 426 PVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCL 485
              QTYWRN+ GMQIIL  GMDL FP SSIILSD LPMQYQGM+ SLVNTI NY+TSLCL
Sbjct: 424 SPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCL 483

Query: 486 GMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIW--SKRNAKDPKD 543
           GMGTT E Q N  G D+LKGYRAALY  +G+  LG   +F  +  D+W   ++  ++ K 
Sbjct: 484 GMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQNEKK 543

Query: 544 LQRC 547
             +C
Sbjct: 544 EDKC 547

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/529 (55%), Positives = 365/529 (68%), Gaps = 10/529 (1%)

Query: 6   TEIKEPVSVN-EANLLESQSTIDCTSSERKTAIKEQDDEIGXXXXXXXXXXLQENNSSWQ 64
           T  ++ +++N EA   ++  T      E+K    E + E              +N++ WQ
Sbjct: 13  TITRDHITINQEAEYTKNDQT---NVEEKKNCSTESEAE------WCSESEFTDNDTPWQ 63

Query: 65  NPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLV 124
           NP YF++ ++EY F++TCM+A LLNQAGQ+Q  + MN+++D+F+SS   QTWLMASFPLV
Sbjct: 64  NPTYFANRWQEYAFISTCMLAQLLNQAGQAQATAPMNILADAFNSSAKKQTWLMASFPLV 123

Query: 125 SGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISF 184
           SGSFIL+SGR+GDIYGLK+           WSLICGF NY H+D FFI+ RAFQGLGI+F
Sbjct: 124 SGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAF 183

Query: 185 ILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXX 244
           ILPNVMGL+GNIYK  TLRKN VIS +G+ AP G+  G +W GLI  ENPKQWPWIF   
Sbjct: 184 ILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAY 243

Query: 245 XXXXXXCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYX 304
                  +VM  Y++P  +PTN++GF MDW GS +GV+G+ILFNFVWNQGPI GW K Y 
Sbjct: 244 AIVVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYI 303

Query: 305 XXXXXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFA 364
                           YEIK+AK PLLP  V +N HI  IL  +F+GWGSFGIWTFYY+A
Sbjct: 304 IALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYA 363

Query: 365 FQLNLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSV 424
           FQLNLR YS VW+G                VALTIK+VGP++LL FS  GFT G I++SV
Sbjct: 364 FQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSV 423

Query: 425 TPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLC 484
           TPVHQ+YW+   GMQIIL FGMDL FPASSIILSD+LP QYQGMA SLVNT+VNYSTSLC
Sbjct: 424 TPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLC 483

Query: 485 LGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIW 533
           LG+G+T E Q+NK+G D LKGYRAALY G+G+   G  +AF  +   +W
Sbjct: 484 LGVGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFEVLW 532

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/534 (55%), Positives = 368/534 (68%), Gaps = 12/534 (2%)

Query: 15  NEANLLESQSTIDCTSS----ERKTAIKEQDDEIGXXXXXXXXXXLQENN-----SSWQN 65
           N  N+ E +     TSS    E  +  KE+++E+            QE+N     S WQN
Sbjct: 9   NSKNVEEEKEITQSTSSIIEEECSSITKEENNEVSEDELPSSE---QEDNTIGDHSKWQN 65

Query: 66  PDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVS 125
           PDYF + ++EY+F+ +CM++ LLNQA   Q LS MN+I+DSF S  G +TWL+ASFPLVS
Sbjct: 66  PDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVS 125

Query: 126 GSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFI 185
           GSFILISGR+GDIYGLK+           WSLI GFT+Y+H+D FFI++RAFQGLGI+FI
Sbjct: 126 GSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFI 185

Query: 186 LPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXX 245
           LPNVMG+VGNIYK  T RKN+VIS+IG  AP G+  G+L+ GLI TENPKQWPW F    
Sbjct: 186 LPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFA 245

Query: 246 XXXXXCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXX 305
                 L +  Y++P+NIPTN++GF MDWIGS++ VIGLIL NFVWNQGPIVGW+KAY  
Sbjct: 246 IASAINLAISIYSIPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYII 305

Query: 306 XXXXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAF 365
                          YEIKYAK P+LP  VT+N HI+ IL  LFLGWGSFGI++FYYF+F
Sbjct: 306 VLLIISIIALVLFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSF 365

Query: 366 QLNLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVT 425
            LNLR YS +W+G                V   IK++  +++LFFS I F  G I++SVT
Sbjct: 366 LLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVT 425

Query: 426 PVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCL 485
           PV QTY+R   G  IIL FGMD+ FPA++IILSD L MQYQGMA SL NT+VNYS SLCL
Sbjct: 426 PVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCL 485

Query: 486 GMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNAK 539
           GMGTTVERQINKSG ++LKGYRAA Y GVG+AGLG  I+ + +   +W+KR  +
Sbjct: 486 GMGTTVERQINKSGKEILKGYRAAEYLGVGLAGLGIVISGIYMAEVLWAKRKER 539

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/534 (54%), Positives = 370/534 (69%), Gaps = 8/534 (1%)

Query: 20  LESQSTIDCTSS--ERKTAIKEQD------DEIGXXXXXXXXXXLQENNSSWQNPDYFSS 71
            E + ++  TSS    K ++KE+D      DE               N+S WQ+P YFSS
Sbjct: 5   FERKMSVQGTSSPVNDKISMKEEDKVIVSTDEEVTTVASSSKSNQISNDSPWQDPTYFSS 64

Query: 72  SFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILI 131
             KE +F+ TCM+A LLNQAGQ+  L  MNV+S SF S +  Q WLMASFPL +GSFILI
Sbjct: 65  FGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILI 124

Query: 132 SGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMG 191
           SGRLGDIYGLK+           WS+I G + Y+++D+FFI  RAFQG+GI+FILPN+MG
Sbjct: 125 SGRLGDIYGLKKMLMIGYVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFILPNIMG 184

Query: 192 LVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXC 251
           LVG++YKVG+LRKN+VIS+IG   PTG+ FG ++GGLIVTE+P QWPW+F          
Sbjct: 185 LVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFIS 244

Query: 252 LVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXXXXXX 311
           ++M +Y++P+N+PTNV+G +MDW GSVL VIGLILFNFVWN+ PI GW+KAY        
Sbjct: 245 MLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIVLLVVS 304

Query: 312 XXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLRE 371
                    YEIKYA+VPLLP AVT+N H++ IL  +F+GWGSFGIWTFYY +FQLNLR 
Sbjct: 305 VFFLVAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRH 364

Query: 372 YSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTY 431
           YSPVW+G                VA +IK++GPA+LL F+ + F  GSI+ SV PV Q+Y
Sbjct: 365 YSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSY 424

Query: 432 WRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTV 491
           W+  F MQ +L FGMDL FPASSIILSD LPMQYQGMA SLVNT++NYS SLCLGMG TV
Sbjct: 425 WKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATV 484

Query: 492 ERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNAKDPKDLQ 545
           E QINKSG ++L+GYRAA+Y G+G+A LG  I+   +   +W++R     K L+
Sbjct: 485 EHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRKSLE 538

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/527 (55%), Positives = 368/527 (69%), Gaps = 4/527 (0%)

Query: 22  SQSTID---CTSSERKTAIKEQDDEIGXXXXXXXXXXLQENNSSWQNPDYFSSSFKEYIF 78
           + S ID      ++ K  +  +D+E+           +  N+S WQ+P YFSS  KE +F
Sbjct: 14  TDSEIDEKITVKAKDKVVVSTEDEEVTTIVSSTKSTQV-TNDSPWQDPTYFSSFGKELMF 72

Query: 79  VATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDI 138
           +ATCM+A LLNQAGQ+  L  MNV+S SF+S    Q WLMASFPL +GSFILISGRLGDI
Sbjct: 73  IATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDI 132

Query: 139 YGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYK 198
           YGLK+           WS+I G + Y++SD FFI +RAFQG+GI+FILPN+MGLVG++YK
Sbjct: 133 YGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYK 192

Query: 199 VGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLVMGYYT 258
           VG+ RKN+VIS IG  APTG  FG L+GGLIVTE+P QWPW+F          L+M +Y+
Sbjct: 193 VGSFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGIATFLSLLMAWYS 252

Query: 259 VPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXXXXXXXXXXXXX 318
           +P+N+PTN++G +MDW GS L +IGLILFNFVWNQ PIVGW+K Y               
Sbjct: 253 IPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIVLLIISVIFLVAF 312

Query: 319 XXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSG 378
             YE KYA+VPLLP+A+T+N H++ IL  +FLGWGSFGIWTFYY +FQLNLR YSPVW+G
Sbjct: 313 FVYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTG 372

Query: 379 XXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGM 438
                           VA +IK++GPA+LL FS + F  GSI+ SV PV Q+YW+  F M
Sbjct: 373 GTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVEQSYWKLNFAM 432

Query: 439 QIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKS 498
           Q IL FGMDL FPASSIILSD LPMQYQGMA SLVNT++NYS SLCLGMG TVE QINKS
Sbjct: 433 QAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGGTVEHQINKS 492

Query: 499 GDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNAKDPKDLQ 545
           G+DLLKGYRAA+Y GVG+A LG  I+   +  ++W++    + + L+
Sbjct: 493 GNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDRSLE 539

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/538 (55%), Positives = 370/538 (68%), Gaps = 8/538 (1%)

Query: 8   IKEPVSVNEANLLESQSTIDCTS--SERKTAIKEQDDEIGXXXXXXXXXXLQENNSSWQN 65
           I+E V+V      +    ID  S  +E K  +  +D+++           +  N+S WQ+
Sbjct: 5   IEEKVNVQS----KDSPVIDKISMKAEDKVVVSSEDEDVTTVASSNKSTQV-SNDSPWQD 59

Query: 66  PDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVS 125
           P YFSS  +E +F+ TCM+A LLNQAGQ+  L+ MNV+S SF+S +  Q WLMASFPLV+
Sbjct: 60  PTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVA 119

Query: 126 GSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFI 185
           GSFILISGRLGDIYGLK+           WSLICG + Y+++D FFI  RAFQGLGI+FI
Sbjct: 120 GSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFI 179

Query: 186 LPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXX 245
           LPNVMGLVG++YKVG+ RKN+VIS IG  AP G  FG L+GGLIV E+ +QWPW+F    
Sbjct: 180 LPNVMGLVGHVYKVGSTRKNLVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFA 239

Query: 246 XXXXXCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXX 305
                 +++ +Y++P+NIPTNV+GF+MDW GSVL VIGLILFNFVWNQ P  GW  AY  
Sbjct: 240 IAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYII 299

Query: 306 XXXXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAF 365
                          YE+KYAKVPLLP AVT+N H++ IL  +FLGWGSFGIWTFYY +F
Sbjct: 300 ALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSF 359

Query: 366 QLNLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVT 425
           QLNLR YSPVW+G                VAL+IK+VGPA LL F+ + F  GSI+ SV 
Sbjct: 360 QLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVL 419

Query: 426 PVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCL 485
           PV Q++W+  FGMQ IL FGMDL FPASSIILSD LPM+YQGMA SLVNT++NYS SLCL
Sbjct: 420 PVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCL 479

Query: 486 GMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNAKDPKD 543
           GMG TVE QINK+G DLLKGYR A+Y GVG+A LG  I+F  +    W+ R  +  KD
Sbjct: 480 GMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQ-KD 536

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/519 (58%), Positives = 366/519 (70%), Gaps = 13/519 (2%)

Query: 21  ESQSTIDCTSSERKTAIKEQDDEIGXXXXXXXXXXLQENNSSWQNPDYFSSSFKEYIFVA 80
           E QS  D  S   K  I   DD               EN+S +QNP+YF + FKE +F+ 
Sbjct: 44  ECQSNSDQLSVTSKGCICSVDD-------------CHENDSPFQNPEYFETGFKEVMFII 90

Query: 81  TCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYG 140
           +CM+A LLNQAGQ+Q LS MNV++D F S++  Q WLMASFPLVSGSFILISGRLGDIYG
Sbjct: 91  SCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYG 150

Query: 141 LKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVG 200
           LK+           WS+ICG   Y +SD FFIV R+FQGLGI+FILPN+MGLVGNIYKVG
Sbjct: 151 LKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVG 210

Query: 201 TLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLVMGYYTVP 260
           TLRKN+VIS IG MAP G+  GAL+GGLIVTE+ +QWPW+F          +++  Y++P
Sbjct: 211 TLRKNIVISCIGCMAPAGAALGALFGGLIVTEDAEQWPWVFYAFGIASFVNMLLALYSIP 270

Query: 261 DNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXXXXXXXXXXXXXXX 320
           +N+PTN+N   MDWIGS+LGV GL+L N VWNQ PIVGW +AY                 
Sbjct: 271 NNVPTNLNNLNMDWIGSLLGVSGLLLLNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVV 330

Query: 321 YEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGXX 380
           YEIKYA  PLLP +V +N  IL IL  LF GWGSFGIWT+YY+AFQLNLR+Y+P+W+G  
Sbjct: 331 YEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGT 390

Query: 381 XXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQI 440
                         VALTIKKVGPA+LL FS + F CGSI++SVTPVHQTYWR   GMQI
Sbjct: 391 HFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQI 450

Query: 441 ILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGD 500
           IL FGMDL FPASSIILSD+LPMQYQGMA SLVNT+VNYSTSLCLGMG TVE+Q N  G 
Sbjct: 451 ILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGA 510

Query: 501 DLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNAK 539
           DLLKGYR+ALY  +G+A  G C++ + +  DI +KR+ K
Sbjct: 511 DLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKRHRK 549

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/537 (55%), Positives = 371/537 (69%), Gaps = 3/537 (0%)

Query: 9   KEPVSVNEANLLESQSTIDCTSSERKTAIKEQDDEIGXXXXXXXXXXLQENNSSWQNPDY 68
           K+ +SV   +      TI     + K  I  +D+E+           +  N+S WQ+P Y
Sbjct: 6   KKKMSVQGTDYQIHDKTI--MKVDDKVVISTEDEEVTTVTSSNESNQV-TNDSPWQDPIY 62

Query: 69  FSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSF 128
           FSS  KE +F+ATCM+A LLNQAGQ+  L  MNV+S SF+S +  Q WLMASFPL +GSF
Sbjct: 63  FSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSF 122

Query: 129 ILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPN 188
           ILISGRLGDIYGLK+           WS+I G + Y++SD FFI  RAFQGLGI+FILPN
Sbjct: 123 ILISGRLGDIYGLKKMLLIGYVIIIIWSIISGLSKYSNSDAFFITCRAFQGLGIAFILPN 182

Query: 189 VMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXX 248
           +MGLVG++YKVG+LRKN+VIS+IG  AP G  FG ++GGLIVTE+P+QWPW+F       
Sbjct: 183 IMGLVGHVYKVGSLRKNLVISVIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAFSIAT 242

Query: 249 XXCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXXX 308
              L+M +Y++P+N+PTNV+G +MDW GS L V+GLILFNFVWNQ PI GW +AY     
Sbjct: 243 FISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYIIVLL 302

Query: 309 XXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLN 368
                       YEIKYA+VPLLP AVT+N H++ IL  +FLGWGSFGIWTFYY +FQLN
Sbjct: 303 ILSVFFLIAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLN 362

Query: 369 LREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVH 428
           LR YSPVW+G                VA +IK++GPAILL F+ + F  GSI+ SV PV 
Sbjct: 363 LRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPVE 422

Query: 429 QTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMG 488
           Q+YW+  F MQ IL FGMDL FPASSIILSD LPMQYQGMA SLVNT++NYS SLCLGMG
Sbjct: 423 QSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMG 482

Query: 489 TTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNAKDPKDLQ 545
            TVERQINKSG +LLKGYRAA+Y G+G+A LG  I+   +  + W+K    + K L+
Sbjct: 483 VTVERQINKSGQNLLKGYRAAIYLGIGLASLGLLISVTYMLENFWNKHKESEKKRLE 539

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/531 (53%), Positives = 351/531 (66%), Gaps = 14/531 (2%)

Query: 15  NEANLLESQSTIDCTSSER--KTAIKEQDDEIGXXXXXXXXXXLQENNSSWQNPDYFSSS 72
           NE  L   +S+ D    E    TA  + +DE            + ++N  WQNP+YF  +
Sbjct: 18  NETELPVKKSSRDNNIGESLTATAFTQSEDE------------MVDSNQKWQNPNYFKYA 65

Query: 73  FKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILIS 132
           ++EY+F+ TCMI+ LLNQAG +Q LS MN++SDSF S    ++WLMASFPLVSGSFILIS
Sbjct: 66  WQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILIS 125

Query: 133 GRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGL 192
           GRLGDIYGLK+           WSLICG T Y+ SDTFFI++RAFQGLGI+F+LPNV+G+
Sbjct: 126 GRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGI 185

Query: 193 VGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCL 252
           +GNIY  GT RKN+VIS +G MAP G+  G L+ GLI TE+PKQWPW F           
Sbjct: 186 IGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINF 245

Query: 253 VMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXXXXXXX 312
           V+  Y +P  IPTN++ F+MDWIGSVLGVIGLIL NFVWNQ PI GW +AY         
Sbjct: 246 VLSIYAIPSTIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISV 305

Query: 313 XXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREY 372
                   YEI++AK PLLP+AV ++ H++ I+  LF GWGSFGI+TFYYF FQLN+R+Y
Sbjct: 306 IFLVVFIIYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQY 365

Query: 373 SPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYW 432
           + +W+G                V  TIK V P++ LFFS + F  GSI+ SVTPVH+TY+
Sbjct: 366 TALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYF 425

Query: 433 RNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVE 492
           R   G  IIL FGMDL FPASSII SD LPM+YQGMA SLVNT+VNYS SLCLGMG TVE
Sbjct: 426 RTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVE 485

Query: 493 RQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNAKDPKD 543
            Q+N  G  LLKGYR A Y G+G+A L   I+ L +       R A+   +
Sbjct: 486 TQVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAE 536

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  568 bits (1464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/517 (55%), Positives = 352/517 (68%)

Query: 21  ESQSTIDCTSSERKTAIKEQDDEIGXXXXXXXXXXLQENNSSWQNPDYFSSSFKEYIFVA 80
           E   +   + +E  + IK  D E             Q  +S WQNPDYF + ++EY+F+ 
Sbjct: 14  EIMESAASSITEETSIIKHGDIEEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIF 73

Query: 81  TCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYG 140
           +CM++ LLNQA   Q LS MN+I+DSF+S  G +TWL+ASFPLVSGSFILISGR+GDIYG
Sbjct: 74  SCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYG 133

Query: 141 LKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVG 200
           LK+           WS+I G T Y+HSDTFFIV+RAFQGL I+FILPNVMG+VGNIYK  
Sbjct: 134 LKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPD 193

Query: 201 TLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLVMGYYTVP 260
           + RKN+VIS+IG  AP G+ FG+L+ GLI TE+P QWPW F          L +  Y++P
Sbjct: 194 SNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIP 253

Query: 261 DNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXXXXXXXXXXXXXXX 320
           +++PTNV+GF MDWIGSVL VIGLIL NFVWNQGPIVGW+ AY                 
Sbjct: 254 NSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIALLVVSVFFLALFFT 313

Query: 321 YEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGXX 380
           YE+KYA+ PLLP  VT+N HI+ IL  LFLGWGSFGI++FYYF+F LNLR YS +W+G  
Sbjct: 314 YEVKYAESPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTT 373

Query: 381 XXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQI 440
                         V   IKK+  A +LF S + F  G I++SVTPV QTY+R   G  I
Sbjct: 374 YFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMI 433

Query: 441 ILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGD 500
           IL FGMD+ FPA++IILSD L MQYQGMA SL NT+VNYS SLCLGMGTTVERQINKSG+
Sbjct: 434 ILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGN 493

Query: 501 DLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRN 537
           DLLKGYR A Y G+G+AGLG  I  + +   +W KR 
Sbjct: 494 DLLKGYRGAEYLGIGLAGLGIIITAIYLGEILWGKRK 530

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/533 (52%), Positives = 354/533 (66%), Gaps = 7/533 (1%)

Query: 14  VNEANLLES-QSTIDCTSSERKT--AIKEQDDEIGXXXXXXXXXXLQE----NNSSWQNP 66
           +NE +L++S +S  D   +E ++  A+K+     G            E    +   WQNP
Sbjct: 1   MNEKSLVKSAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNP 60

Query: 67  DYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSG 126
           +YF +S+ EY+F+ TCMI+ LLNQAG +Q LS MN+I++SF S+   +TWLMASFPLVSG
Sbjct: 61  NYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSG 120

Query: 127 SFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFIL 186
           SFILISGRLGDIYGLK+           WSLICG T Y+ SDTFFI++RAFQGLGI+F+L
Sbjct: 121 SFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVL 180

Query: 187 PNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXX 246
           PNV+G++GNIY  GT RKN+VISL+G MAP G+  G L+ GLI T+NPKQWPW F     
Sbjct: 181 PNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTI 240

Query: 247 XXXXCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXX 306
                L +  Y++P+NIPTN+  F+MDWIGS LGVIGL+L NFVWNQ PI GW++AY   
Sbjct: 241 TSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIV 300

Query: 307 XXXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQ 366
                         YE ++AK PLLP+AV ++ H++ I+  LF GWGSFGI+TFYYF FQ
Sbjct: 301 LLVISVVFLVVFIIYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQ 360

Query: 367 LNLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTP 426
           LN+R YS VW+G                V + IKKV P++ LF S + F  GSI+ SVTP
Sbjct: 361 LNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTP 420

Query: 427 VHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLG 486
           VH+TY+R   G  IIL FGMD  FPASSII SD LPM+YQGMA SLVNT+VNYS SLCLG
Sbjct: 421 VHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLG 480

Query: 487 MGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNAK 539
           MG TVE  ++  G  +LKGYR A Y G+G+A L   I+ L +   I     AK
Sbjct: 481 MGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAK 533

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/505 (55%), Positives = 341/505 (67%)

Query: 35  TAIKEQDDEIGXXXXXXXXXXLQENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQS 94
           T      D++G            + N  WQ+  YF + ++EYIFV TCM++ LLNQA   
Sbjct: 28  TVENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIP 87

Query: 95  QVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXX 154
           Q LS MN+++ SFHS+   QTWLMASFPLVSGSFILISGR+GDIYGLK            
Sbjct: 88  QTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFII 147

Query: 155 WSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIM 214
           W+LI GFTNY HSDTFFIV+R+FQGLG++FILPNVMG VGNIYK  T RKN+VISLIG  
Sbjct: 148 WALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGAC 207

Query: 215 APTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLVMGYYTVPDNIPTNVNGFTMDW 274
           AP G+  GA + GLI T+NP  WPW F          L+   Y++P++IPTNV+GF+MDW
Sbjct: 208 APVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDW 267

Query: 275 IGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKYAKVPLLPKA 334
           IGS L V+GLIL NFVWNQGPI GW KAY                 YE+ YA  PLLP+ 
Sbjct: 268 IGSGLAVVGLILLNFVWNQGPIDGWGKAYIIVLLIVSVFVLTLFFIYEVHYAASPLLPRV 327

Query: 335 VTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGXXXXXXXXXXXXXXTT 394
           +TQN H++ IL  LFLGWGSFGI++FYYFAF LNLR YS VW+G                
Sbjct: 328 ITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVV 387

Query: 395 VALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASS 454
           V L+I+K+  +I+LFFS I F  G I++SVTPV QTY+R   G  IIL FGMD+ FPA++
Sbjct: 388 VGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAA 447

Query: 455 IILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGV 514
           IILSD LP QYQGMA SL NT+VNYS SLCLGMG+TVE QIN++G DLLKGYRAA Y G+
Sbjct: 448 IILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGI 507

Query: 515 GIAGLGACIAFLNVCHDIWSKRNAK 539
           GIA L   ++ + +C  +W  R  +
Sbjct: 508 GIASLAVILSLIYMCERLWIDRKER 532

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/537 (53%), Positives = 349/537 (64%), Gaps = 15/537 (2%)

Query: 15  NEANLLESQSTIDCTSSE--RKTAIKEQDDEIGXXXXXXXXXXLQENNSSWQNPDYFSSS 72
           NEA     +S+ D  S E  R TA    +DE            + E N  WQNP YF  +
Sbjct: 21  NEAVFPPKKSSRDNGSEETLRGTAFTNLEDE------------MVECNQKWQNPKYFKYA 68

Query: 73  FKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILIS 132
           ++EY+F+ TCMI+ LLNQAG +Q LS MN++SDSF S    ++WLMASFPLVSGSFILIS
Sbjct: 69  WQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILIS 128

Query: 133 GRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGL 192
           GRLGDIYGLK+           WSLICG TNY+ SDTFFI+ RAFQGLGI+F+LPNV+G+
Sbjct: 129 GRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGI 188

Query: 193 VGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCL 252
           +GNIY  GT RKN+VIS +G MAP G+  G L+ GLI TENP QWPW F           
Sbjct: 189 IGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINF 248

Query: 253 VMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXXXXXXX 312
            +  Y +P+NIPTN++ F+MDWIGSVLGVIGLIL NFVWNQ PI GW +AY         
Sbjct: 249 GLSIYAIPNNIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWSQAYIIVILIISV 308

Query: 313 XXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREY 372
                   YE+ +AK PLLP AV ++ H++ I+  LF GWGSFGI+TFYYF FQLN+R Y
Sbjct: 309 IFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHY 368

Query: 373 SPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYW 432
           + +W+G                V  TIK V P++ LFFS + F  GSI+ SVTPVH+TY+
Sbjct: 369 TALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYF 428

Query: 433 RNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVE 492
           R   G  IIL FGMDL FPASSII SD LPM+YQGMA SLVNT+VNYS SLCLGMG TVE
Sbjct: 429 RTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVE 488

Query: 493 RQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNAKDPKDLQRCGT 549
            Q++  G  LLKGYR A Y G+G+A L   I+ L +     +   AK   +   C T
Sbjct: 489 TQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAATE-NDCAT 544

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/494 (55%), Positives = 338/494 (68%)

Query: 56  LQENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQT 115
           ++E  S WQ+P+YF   + E +FV +CM+  LLNQAG +  LS M V+     SS+   +
Sbjct: 44  VEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDSSSAKSS 103

Query: 116 WLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVAR 175
           WLMASFPLVSGSFILISGRLGDIYGLK+           WSLICG ++++H+DTFFI +R
Sbjct: 104 WLMASFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSR 163

Query: 176 AFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPK 235
           AFQGLGISF+LPN++G+VGNIYK GT RKN+VISLIG+ AP G+ FG L+ G++V     
Sbjct: 164 AFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDS 223

Query: 236 QWPWIFXXXXXXXXXCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGP 295
            WPW F           ++ Y+ +P++IP NVN F MDWIGS LGV GL+LFNFVWNQ  
Sbjct: 224 DWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQST 283

Query: 296 IVGWEKAYXXXXXXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSF 355
           +VGW   Y                 +EIKYAKVPLLPK VT++  I+ IL  L  GWGSF
Sbjct: 284 VVGWATGYIIALLIVSIFLIALFFIFEIKYAKVPLLPKEVTESRSIIMILASLMAGWGSF 343

Query: 356 GIWTFYYFAFQLNLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGF 415
           GIW FYYF F L LR YSPVW+G               TV  +IK+VGPA+LLFFS I F
Sbjct: 344 GIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAF 403

Query: 416 TCGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNT 475
           TCGSII+SVTPVH+TY+R+  G  +IL FGMDL FPA+SIILSD L MQYQGMA SLVNT
Sbjct: 404 TCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNT 463

Query: 476 IVNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSK 535
           +VNYS SL LG+G T+ERQINKSGD LL+G+RAALYF +G+  LG  I+ + V      +
Sbjct: 464 VVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAALYFAIGVGSLGILISGVFVLQKELMR 523

Query: 536 RNAKDPKDLQRCGT 549
             ++   +L+  G+
Sbjct: 524 SKSRKENELEYNGS 537

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/484 (55%), Positives = 331/484 (68%), Gaps = 2/484 (0%)

Query: 64  QNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPL 123
           Q P YFSS   E+ F+ TC++  LLNQAG +Q +S MN+I++ F S T  Q WL ASFPL
Sbjct: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125

Query: 124 VSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGIS 183
           VSGSFIL+ GR GDIYGLK+           WS+ICG T+Y HSD FFIVA+AFQGLG+S
Sbjct: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185

Query: 184 FILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXX 243
           FILPN++GLVG IY+ G+++KN+ IS IG MAP G+ FG L+ G++V ++ K WPW F  
Sbjct: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245

Query: 244 XXXXXXXCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAY 303
                    V  Y+ VPDN+PTN N   MDWIGS +GV+GL+LF+FVWNQ P+ GW+KAY
Sbjct: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAY 305

Query: 304 XXXXXXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYF 363
                            YEI YA+VPLLPKA+T N HI+ IL  +F+GWG+FGIW+FYYF
Sbjct: 306 IIVLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365

Query: 364 AFQLNLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMS 423
           +F LNLR +SPVW+G              + V   IK + P+I+L  S  GFT G++I +
Sbjct: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFA 425

Query: 424 VTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSL 483
           VTP  QTYWRNTFGM ++L  GMDL FPASSIILSD LP +YQGMA SLVNT+VNYS S 
Sbjct: 426 VTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485

Query: 484 CLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWS--KRNAKDP 541
           CLG+ TTVE+QIN SGDDLLKGYRAA Y GVGI  LG  IA L +    W+  K   K  
Sbjct: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLA 545

Query: 542 KDLQ 545
            D++
Sbjct: 546 NDIE 549

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/534 (50%), Positives = 351/534 (65%), Gaps = 5/534 (0%)

Query: 15  NEANLLESQSTIDCTSSERKTAIKEQDDEIGXXXXXXXXXXLQENNSSWQNPDYFSSSFK 74
            E + LE ++ +    +E  +    ++  +           + +    WQNP+YF   ++
Sbjct: 20  KEEDYLEIENEV-ALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQ 78

Query: 75  EYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGR 134
           EY+F+ TCMI+ LLNQ+G +Q LS MN+++DSF S    ++WLMASFPLVSGSFILISGR
Sbjct: 79  EYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGR 138

Query: 135 LGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVG 194
           +GDI+GLK            WSLICG T Y+ SDTFFIV+RAFQGLGI+F+LPNV+G++G
Sbjct: 139 MGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIG 198

Query: 195 NIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLVM 254
           N+Y  GT RKN+VIS IG MAP G+  G  + GLI T NP QWPW F          L++
Sbjct: 199 NVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLIL 258

Query: 255 GYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXXXXXXXXX 314
             Y +P+NIPTNV+ F+MDWIGS LGVIGL+L N VWNQ PI GW +AY           
Sbjct: 259 SIYAIPNNIPTNVHRFSMDWIGSGLGVIGLVLLNLVWNQAPISGWNQAYIIVLLIISVLF 318

Query: 315 XXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSP 374
                 YEI +AK PLLP+AV ++ H++ I+  LF GWGSFGI+TFYYF FQLN+R Y+P
Sbjct: 319 LVLFGVYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTP 378

Query: 375 VWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRN 434
           +W+G                V  +IK+V P++ LFF+ + F  GSI+ SVTPVH+TY+R 
Sbjct: 379 LWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRM 438

Query: 435 TFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQ 494
             G  IIL FGMDL FPASSII SDYLPM+YQGMA SLVNT+VNYS SLCLGMG TVE Q
Sbjct: 439 QMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQ 498

Query: 495 INKSGDDLLKGYRAALYFGVGIAGLGACIA--FLNVCH--DIWSKRNAKDPKDL 544
           ++  G  +LKGYR A Y G+G+A L   I+  ++  C+  D  +K  A+D + +
Sbjct: 499 LDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAEDKRSM 552

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/486 (54%), Positives = 330/486 (67%), Gaps = 4/486 (0%)

Query: 58  ENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWL 117
           + N  WQNP+YF S+ KEY+F+ +C ++ LLNQAG  Q    MN+++DS  S  G Q WL
Sbjct: 45  DGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWL 104

Query: 118 MASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAF 177
           MA+FPL+SGSFILISGR+GDIYGLK+           WSLICG T YAHSD+FFIV+RAF
Sbjct: 105 MAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAF 164

Query: 178 QGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQW 237
           QGLGIS ILPN++G+VG+IY  G+ RKN+VISLIG MAP G+  GA++ GLI TE+  QW
Sbjct: 165 QGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQW 224

Query: 238 PWIFXXXXXXXXXCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIV 297
           PW F           V+  + +P+ IPTNV+G  MDWIGS LGV+GLI+ NFVWNQ PI 
Sbjct: 225 PWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPID 284

Query: 298 GWEKAYXXXXXXXXXXXXXXXXXYEIKYAK-VPLLPKAVTQNGHILTILTVLFLGWGSFG 356
           GW+ AY                 YE+ +    PLLPK V ++   + +L  LF GWGSFG
Sbjct: 285 GWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALFFGWGSFG 344

Query: 357 IWTFYYFAFQLNLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFT 416
           I++FYYF FQLNLR Y+P+W+G                V  TIKKV P+I+LF S + F 
Sbjct: 345 IFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFN 404

Query: 417 CGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTI 476
           CGSIIMSVTP+HQTY+RN  GM IIL FGMDL FPASSI+LSD LP+QYQGMA SLVNT+
Sbjct: 405 CGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTM 464

Query: 477 VNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACI--AFLNVCHDIWS 534
           VNYS S CLG+   VE+ +N  G D+LKGYR A Y G+G+A + ACI    L +   I  
Sbjct: 465 VNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASM-ACIISGALMLSEIIQG 523

Query: 535 KRNAKD 540
           ++N KD
Sbjct: 524 RKNEKD 529

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/492 (53%), Positives = 330/492 (67%)

Query: 56  LQENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQT 115
           ++  NSS +NPDYF+S+ +EY F+ +CM++ LLN AG +Q LS MNV++   HSS   + 
Sbjct: 35  MELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKV 94

Query: 116 WLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVAR 175
           WL+ASFPLVSGSFIL+SGRLGDIYGLK+           WSLI G + Y+HS  FFI+AR
Sbjct: 95  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIAR 154

Query: 176 AFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPK 235
           AFQGLGIS +LPNV+GL+G IYK GTL+KN+VIS++G M+P G+  G L+ GL+ TE+  
Sbjct: 155 AFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEG 214

Query: 236 QWPWIFXXXXXXXXXCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGP 295
            WPW F            + YY++P+NIPTNVN  +MDWIGS  GV+GLILFNFVWNQ P
Sbjct: 215 SWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAP 274

Query: 296 IVGWEKAYXXXXXXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSF 355
             GW  AY                 YE++YA+ PLLP  + +N  ++ ILT +  GWGSF
Sbjct: 275 ADGWNSAYLIVLLVISVIALIAFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSF 334

Query: 356 GIWTFYYFAFQLNLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGF 415
           GIWTFYYF+F LNLR YSP+W+G               +    +KK+ PA+LL FS +GF
Sbjct: 335 GIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGF 394

Query: 416 TCGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNT 475
             G II SVTPVHQTY+RN  G  IIL  GMDL FPASSIILSD LP Q+QGMA SLVNT
Sbjct: 395 NLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNT 454

Query: 476 IVNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSK 535
           ++NYS SL LG+  TVE+  NK+G DLL+GYR ALYFG+  +G+   IA L +   I+  
Sbjct: 455 VINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDS 514

Query: 536 RNAKDPKDLQRC 547
              +  KD + C
Sbjct: 515 YKDRKEKDCENC 526

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/516 (51%), Positives = 343/516 (66%), Gaps = 8/516 (1%)

Query: 32  ERKTAIKEQDDEIGXXXXXXXXXX--LQENNSSW---QNPDYFSSSFKEYIFVATCMIAN 86
               ++  Q  E+G            +Q ++  W   Q+P YFS+ +KEY+F+   M++ 
Sbjct: 5   RSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQ 64

Query: 87  LLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRXXX 146
           LLNQAG +Q LS +N++S +F SST  QTWLMASFPLVSGSFIL+SG++GDIYGLK+   
Sbjct: 65  LLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLL 124

Query: 147 XXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNV 206
                   WSLICG T+Y  S  FFI++RAFQGLGI+FILPN+MG+VGNIY  GT RKN+
Sbjct: 125 VGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNM 184

Query: 207 VISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLVMGYYTVPDNIPTN 266
           VISLIG  AP G+  G L+ GLI T + ++W W F          + +  + +P+ IPTN
Sbjct: 185 VISLIGACAPIGATMGVLFSGLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIPNTIPTN 243

Query: 267 VNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKYA 326
           V G +MDWIGS +G++G+ILFNFVWNQGPIVGW+ AY                 YE KYA
Sbjct: 244 VRGSSMDWIGSGIGLLGMILFNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETKYA 303

Query: 327 KVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGXXXXXXXX 386
             PL+P+    N  +L  L  +F GWGSFGIWTFYYF F LNLREY+P+W+G        
Sbjct: 304 NDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLI 363

Query: 387 XXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILVFGM 446
                  +V  TIK++ P+++LF S + F CG I++SVTPV QTY+R   GM IIL FGM
Sbjct: 364 WGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGM 423

Query: 447 DLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDDLLKGY 506
           DL FPASSIILSD LPM+ QGMA SLV+T++NYS S+CLG+  TVE QINK+GDDLLKGY
Sbjct: 424 DLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGY 483

Query: 507 RAALYFGVGIAGLGACIAFLNVCHDI--WSKRNAKD 540
           RAALY G+G+A LG  I+ L +  +     +RN K+
Sbjct: 484 RAALYLGIGLASLGVFISALFMLENYLRMRRRNVKE 519

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  526 bits (1355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/534 (48%), Positives = 345/534 (64%), Gaps = 5/534 (0%)

Query: 7   EIKEPVSVNEANLLESQSTIDCTSSERKTAIKEQDDEIGXXXXXXXXXXLQ----ENNSS 62
            ++E  S N  N +   +  DC + E+++ +K  D                    + +SS
Sbjct: 3   SMEENPSDNTINEINYTNNEDCKNPEQQS-LKNIDSRSSLNSSLTQVLSTDTADNDESSS 61

Query: 63  WQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFP 122
           +QNPDYF + ++E+ F+ + MI  LL+QAG +Q LS MNV++    S++  Q WLM+SFP
Sbjct: 62  YQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFP 121

Query: 123 LVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGI 182
           L  GSFIL+SGRLGDIYGLK+           WS+ICG ++YAH+D FFI ARAFQGLG+
Sbjct: 122 LALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGL 181

Query: 183 SFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFX 242
           +F LPN++GL+G IY+ G  RKN++IS+IG M+PTG+  G L+ GL V  +   WPW F 
Sbjct: 182 AFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATLGGLFAGLTVKYDKSNWPWSFY 241

Query: 243 XXXXXXXXCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKA 302
                    L++ +Y +P++IPTN++G  MDW+GSVLGV GLI+ NFV+NQ PIVGW+ A
Sbjct: 242 AFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSA 301

Query: 303 YXXXXXXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYY 362
           Y                 YE+KYAK PL+PKA++ N  +L IL  LF GWGSFGIWTFYY
Sbjct: 302 YIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYY 361

Query: 363 FAFQLNLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIM 422
           F+F+LNLR YSP+W+G                  LTIKK+ P++L   S +GF  G+II 
Sbjct: 362 FSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIF 421

Query: 423 SVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTS 482
           + TPV+QT++RN  G   +L  GMD  FPASSIILSD LPMQYQGMA SLVNT++NYSTS
Sbjct: 422 AATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTS 481

Query: 483 LCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKR 536
           +CLGM  TVE + N  G DLL GYRAA+YF +G+AGL  C++   +   +W  R
Sbjct: 482 ICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDR 535

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  511 bits (1316), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 258/511 (50%), Positives = 326/511 (63%), Gaps = 12/511 (2%)

Query: 32  ERKTAIKEQDDEIGXXXXXXXXXXLQENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQA 91
            RK     +D ++           L  + S  QNPDYF   +KEY+FV + M++ LLNQA
Sbjct: 18  SRKVVDNHEDSDM-----------LLASRSRLQNPDYFDKQWKEYLFVISSMLSQLLNQA 66

Query: 92  GQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXX 151
              Q     +++S+   +    Q WLMASFPLVSGSFIL+SG++GDIYGLK+        
Sbjct: 67  AALQANPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAV 126

Query: 152 XXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLI 211
              WSLICG ++YAH+  FFIVAR+FQGLGI+F+LPNV G+VGNIYK  T  KN+V S+I
Sbjct: 127 VVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMI 186

Query: 212 GIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLVMGYYTVPDNIPTNVNGFT 271
           G  AP G+  G L+ GLI TE+ + W W F           ++ +Y +PDNIPTNV+ F 
Sbjct: 187 GACAPIGATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFK 245

Query: 272 MDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKYAKVPLL 331
           MDW+GS LGV GLI+FNFVWNQ P  GW+ AY                 +E ++AK PLL
Sbjct: 246 MDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFAKEPLL 305

Query: 332 PKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGXXXXXXXXXXXXX 391
           P+AV  N  ++ IL  LFLGWGSFGIWT+YY AF LNLR Y+P+W+G             
Sbjct: 306 PRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIA 365

Query: 392 XTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFP 451
              V  TI K GPAI+L  S I F  G I++SVTPV QTY+R + G  +IL FGMDL FP
Sbjct: 366 AFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFP 425

Query: 452 ASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALY 511
           ASSIILSD LP QYQGMA SLVNT++NYS SLCLG+  T ERQ+NK G DLLKGYRAALY
Sbjct: 426 ASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALY 485

Query: 512 FGVGIAGLGACIAFLNVCHDIWSKRNAKDPK 542
            G+G+A +G  ++      D W++R  +  +
Sbjct: 486 VGIGLASVGIFVSGAYAIEDWWTRRRERSVR 516

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  509 bits (1312), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 260/512 (50%), Positives = 327/512 (63%), Gaps = 10/512 (1%)

Query: 37  IKEQDDEIGXXXXXXXXXXLQENN---------SSWQNPDYFSSSFKEYIFVATCMIANL 87
           +KE DDE             +E +         S  QNPDYF   +KEYIFV + M++ L
Sbjct: 3   MKENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQL 62

Query: 88  LNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRXXXX 147
           LNQA  +Q     +V+S   ++    Q WLMASFPLVSGSFIL+SG++GDIYGLK+    
Sbjct: 63  LNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLG 122

Query: 148 XXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNVV 207
                  WSLICG ++YAH+  FF+VAR+FQGLGI+F+LPNVMG+VGNIYK  T  KN+V
Sbjct: 123 GYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLV 182

Query: 208 ISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLVMGYYTVPDNIPTNV 267
            SLIG  AP G+  G ++ GLI       W W F           ++  + +P+NIPTNV
Sbjct: 183 FSLIGACAPIGATLGCVFSGLIGART-DLWGWTFYAYAITAALNGLVALWIIPNNIPTNV 241

Query: 268 NGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKYAK 327
           N + MDWIGS +GV GLILFNFVWNQ PI GW  AY                 YEI++AK
Sbjct: 242 NEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFITYEIRFAK 301

Query: 328 VPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGXXXXXXXXX 387
            PLLP +V  N  ++ IL+ LF GWGSFGIWTFYY +F LNLR YSP+W+G         
Sbjct: 302 QPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIW 361

Query: 388 XXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILVFGMD 447
                  V  TI K GPA++LF S + F CG I+++VTPVHQTY+R T G+ IIL FGMD
Sbjct: 362 GIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMD 421

Query: 448 LPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDDLLKGYR 507
           L FPA+SIILSD LP QYQGMA SLV+T+++YS SLCLG+  T E Q+NK+G DLLKGY+
Sbjct: 422 LSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQ 481

Query: 508 AALYFGVGIAGLGACIAFLNVCHDIWSKRNAK 539
           AALY G+G+A LG  I+   +  D W+ R  +
Sbjct: 482 AALYVGIGLASLGVVISGAFMIEDWWTSRRKR 513

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  506 bits (1302), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 261/485 (53%), Positives = 324/485 (66%), Gaps = 4/485 (0%)

Query: 30  SSERKTAIKEQ---DDEIGXXXXXXXXXXLQENNSSWQNPDYFSSSFKEYIFVATCMIAN 86
           +  R ++IKE    D  I           ++E  S WQ+P YF +SF+EY+FV +CM   
Sbjct: 2   AESRTSSIKEHIQSDISIDKSSNEKCEVIVREK-SKWQDPGYFKNSFQEYLFVGSCMTTQ 60

Query: 87  LLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRXXX 146
           LLNQA   Q LS MNV+SDSF+SS   QTWL+ASFPLV+GSFILISGR+GDIYGLK+   
Sbjct: 61  LLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLI 120

Query: 147 XXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNV 206
                   WSLICGFT Y+ SDTF I+ARAFQGLGI+F LPNV+G +GNIY VG+LRKN+
Sbjct: 121 GGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNM 180

Query: 207 VISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLVMGYYTVPDNIPTN 266
           VISLI   AP G+  G  + GLIVTE+P QWPW F          L++  Y++P NIPTN
Sbjct: 181 VISLIAASAPVGAAIGGAFAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTN 240

Query: 267 VNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKYA 326
           VNGF MDWIGS L V GLILFNF WNQGPIVGW+ AY                 YEI +A
Sbjct: 241 VNGFKMDWIGSALIVTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFA 300

Query: 327 KVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGXXXXXXXX 386
             PL+ + +T + +++  +  LFLGWGS+GIW+FYYF+F LNLR YSPVW+G        
Sbjct: 301 PSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGI 360

Query: 387 XXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILVFGM 446
                   V ++IKK+   ++L FS + F  G+ ++SV PV Q+Y++ T     IL  G+
Sbjct: 361 FGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGL 420

Query: 447 DLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDDLLKGY 506
           D  FPA++IILSD LPM+YQGMA SL  T+VNYS SLCLGMG TVERQINK G D+LKGY
Sbjct: 421 DTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGY 480

Query: 507 RAALY 511
           R+A Y
Sbjct: 481 RSAEY 485

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  486 bits (1252), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 243/562 (43%), Positives = 351/562 (62%), Gaps = 23/562 (4%)

Query: 12  VSVNEANLLESQSTIDCTSSERKTAIK-----EQDDE--------IGXXXXXXXXXXLQE 58
           +S++ A  L+  +T +  S ERK   +      QD +        IG          +  
Sbjct: 20  ISLSTAETLDIDATPE--SKERKDYFQLKKNYSQDSQTNTSMNEVIGSISSVSNDSDINS 77

Query: 59  NNSSWQN----PDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQ 114
            N   +N    P YF +   EY+F+ +CM++  ++QAG +Q LS MN++++  ++    Q
Sbjct: 78  ENLQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQ 137

Query: 115 TWLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVA 174
            WLMASF L  GSFIL+SGRLGDIYGLK+           WSLICGF++Y+H+D FFI +
Sbjct: 138 AWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITS 197

Query: 175 RAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENP 234
           RAFQGLG++F+LPN +GL+G IY+ G+++KN++I  +G M+P G+  G L+ G+I T++P
Sbjct: 198 RAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDP 257

Query: 235 KQWPWIFXXXXXXXXXCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQG 294
           KQWPW F          +++ +Y++P+NIPTN+   +MDWIG++LG+ GL++ NFV+NQ 
Sbjct: 258 KQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWIGAILGIFGLLILNFVFNQA 317

Query: 295 PIVGWEKAYXXXXXXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGS 354
           PIVGW+ AY                 YE+KYAK PL+PKA++ N  +L IL  LF GWG+
Sbjct: 318 PIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGA 377

Query: 355 FGIWTFYYFAFQLNLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIG 414
           FG WTFYYF+F LN+R Y+  W+G              T     +KKV P+++L+ S IG
Sbjct: 378 FGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIG 437

Query: 415 FTCGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVN 474
           F  G ++++VTP+HQ+Y++N  G+  +L  G+DL FPA+SIILSD LP+QYQGMA SLV 
Sbjct: 438 FMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVY 497

Query: 475 TIVNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIA-FLNVCHDIW 533
           TI NYSTS+CLGM  +VE   N +G ++LKGYR A+ F   +AGLG  ++    V + I 
Sbjct: 498 TITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLIT 557

Query: 534 SKRNAK---DPKDLQRCGTGSN 552
            + N+K    PK L+   T + 
Sbjct: 558 IRENSKSTNKPKHLETYSTDAE 579

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  426 bits (1094), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 205/476 (43%), Positives = 287/476 (60%)

Query: 64  QNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPL 123
           + PD F + F+E+ FV   +I   L+Q G +QVLS MN++++  H++   Q WLMA+FPL
Sbjct: 111 RRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQVLSTMNILAEELHTTKMRQPWLMAAFPL 170

Query: 124 VSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGIS 183
             G  ILISGRLGDI+GLK+           W+LICGF++YAHSD  FIV+R FQGLG++
Sbjct: 171 GLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLICGFSSYAHSDDLFIVSRTFQGLGLA 230

Query: 184 FILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXX 243
             LPN+  L+G IYK    +KN++  +IG M+P G+  G ++ GL V  N K WPW F  
Sbjct: 231 CALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKNWPWSFYS 290

Query: 244 XXXXXXXCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAY 303
                    ++ ++ +P++I  N  G  MDWIGS LG+ GL++ NFV+NQ PI GW  AY
Sbjct: 291 FAIVAFLNGIIAWFCIPNDIEKNPQGLKMDWIGSALGLFGLVVLNFVFNQTPIDGWSSAY 350

Query: 304 XXXXXXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYF 363
                            YE+  A  PL+PK +  N  ++ IL  LF GWG F IWTFYYF
Sbjct: 351 LIVLLVVSVVALILFVIYELTMANFPLIPKGIHSNYRLILILLTLFCGWGGFAIWTFYYF 410

Query: 364 AFQLNLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMS 423
           AFQLNLR YSP+W+                   L ++++ P ILLFFS +GF  G+I+ +
Sbjct: 411 AFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAVQRMKPPILLFFSMLGFLGGNILFA 470

Query: 424 VTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSL 483
           VTP+HQT++RN FG   +   GM   FP++S++ ++ LP  Y+ MA SLVN  +NY+TS+
Sbjct: 471 VTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLPTHYKSMAGSLVNVAINYATSI 530

Query: 484 CLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNAK 539
           C+GM  +     N  G DLL G+RAA Y  +G++G    ++ L +   IW+ RN K
Sbjct: 531 CVGMAGSANVNHNNHGQDLLHGFRAASYLAIGLSGFSVFLSGLYMIGSIWTDRNQK 586

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  314 bits (805), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/457 (38%), Positives = 257/457 (56%), Gaps = 13/457 (2%)

Query: 75  EYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQ-TWLMASFPLVSGSFILISG 133
           E  FV     A L+ QAG  Q L+ +++I DSF ++  GQ +W  +++ L  G+FILI+G
Sbjct: 43  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAG 102

Query: 134 RLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLV 193
           RLGDI+G K+           WSL+ GF+ Y++   FF   RAFQG+G +F+LPN + ++
Sbjct: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 194 GNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLV 253
           G  YK G  RKN+V SL G  AP G   GA++  ++       WPW +           V
Sbjct: 162 GRTYKPGR-RKNMVFSLFGASAPGGFVLGAVFSSML--GQLAWWPWAYWLMGIACFLLAV 218

Query: 254 MGYYTVPDN-IPT-NVNGFTM----DWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXX 307
            GYY +P   +P  +V  F +    D+ GSV GV+GLILFNF WNQGP+VGW+  Y    
Sbjct: 219 AGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 278

Query: 308 XXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQL 367
                         E + A  PLLP A   +     +L+ +  GW SFGIW FY + F  
Sbjct: 279 LIVGTVFLIIFAFIESR-AAFPLLPFAALSSDTAF-VLSCIAAGWASFGIWIFYTWQFME 336

Query: 368 NLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPV 427
           + R  +P+ S                     +    P+ ++FF+   FT G+I+++  PV
Sbjct: 337 DSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPV 396

Query: 428 HQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGM 487
           HQTYW  TF   I++ +GMD+ FPA++I+LSD +P ++QG+A SLVNT+VNYS S+ LG+
Sbjct: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 456

Query: 488 GTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIA 524
             T+E  +N  G ++LKGYR + Y G+G++G G  +A
Sbjct: 457 AGTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFVA 493

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  312 bits (800), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 189/524 (36%), Positives = 280/524 (53%), Gaps = 32/524 (6%)

Query: 32  ERKTAIKEQDDEIGXXXXXXXXXXLQENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQA 91
           +  T   ++DDE+           L E +   + P    S   E  FV     A L+ QA
Sbjct: 13  DTNTGTLKKDDEV----------VLDEFDIQDETP---GSLLWETAFVGVLCSAQLMTQA 59

Query: 92  GQSQVLSAMNVISDSFHSSTGGQ-TWLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXX 150
           G  Q L+ +++I  SF ++  GQ +W  +++ L  G+FILI+GRLGDI+G K+       
Sbjct: 60  GLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFF 119

Query: 151 XXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISL 210
               WSL+ GF+ Y++   FF   RAFQG+G +F+LPN + ++G  YK G  RKN+V SL
Sbjct: 120 WYALWSLLAGFSVYSN-KIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKNMVFSL 177

Query: 211 IGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLVMGYYTVPDN-IPT-NVN 268
            G  AP G   GA++  L+       WPW +           + GY+ +P   +P+ + +
Sbjct: 178 FGACAPGGFVLGAVFSSLL--GQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHAS 235

Query: 269 GFTM----DWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXXXXXXXXXXXXXXXYEIK 324
            F +    D+ GSV GVIGLILFNF WNQGP+VGW+  Y                  E +
Sbjct: 236 SFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESR 295

Query: 325 YAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGXXXXXX 384
            A  PLLP A   +     +L+ +  GW SFGIW FY + F  + R  +P+ S       
Sbjct: 296 -AAFPLLPFAALSSDTAF-VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPV 353

Query: 385 XXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILVF 444
                    T    + +  P+ ++ F+   FT G+I+++  PVHQTYW  TF   I++ +
Sbjct: 354 AVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPW 413

Query: 445 GMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDDLLK 504
           GMD+ FPA++I+LSD +P ++QG+A SLVNT+VNYS S+ LG+  T+E  +N  G   LK
Sbjct: 414 GMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLK 473

Query: 505 GYRAALYFGVGIAGLGACIAFLNVCHDIWS--KRNAKDPKDLQR 546
           GYR + Y G+G++GLG  +A +      WS  K++ K   + Q 
Sbjct: 474 GYRCSWYMGIGLSGLGIFVAAIYA----WSTFKKSKKRTSEKQH 513

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  312 bits (799), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 175/457 (38%), Positives = 258/457 (56%), Gaps = 13/457 (2%)

Query: 75  EYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQ-TWLMASFPLVSGSFILISG 133
           E  FV     A L+ QAG  Q L+ +++I +SF ++  GQ +W  +++ L  G+FILI+G
Sbjct: 42  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAG 101

Query: 134 RLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLV 193
           RLGDI+G K+           WSL+ GF+ Y++   FF   RAFQG+G +F+LPN + ++
Sbjct: 102 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAIL 160

Query: 194 GNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLV 253
           G  YK G  RKN+V SL G  AP G   GA++  ++       WPW +           V
Sbjct: 161 GRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSML--GQLAWWPWAYWIMGIACFVLAV 217

Query: 254 MGYYTVPDN-IPT-NVNGFTM----DWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXX 307
            GY+ +P   +P+ + + F +    D+ GSV GV+GLILFNF WNQGP+VGW+  Y    
Sbjct: 218 AGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 277

Query: 308 XXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQL 367
                         E + A  PLLP A   +     +L+ +  GW SFGIW FY + F  
Sbjct: 278 LIVGTFFLVIFAYIESR-AAFPLLPFAALSSDTAF-VLSCIAAGWASFGIWIFYTWQFME 335

Query: 368 NLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPV 427
           + R  +P+ S                T    +    P+ ++ F+   FT G+I+++  PV
Sbjct: 336 DSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPV 395

Query: 428 HQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGM 487
           HQTYW  TF   I++ +GMD+ FPA++I+LSD +P ++QG+A SLVNT+VNYS S+ LG+
Sbjct: 396 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 455

Query: 488 GTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIA 524
             T+E ++N  G   LKGYR + Y G+G++GLG  +A
Sbjct: 456 AGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVA 492

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  311 bits (797), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 181/479 (37%), Positives = 265/479 (55%), Gaps = 14/479 (2%)

Query: 75  EYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQ-TWLMASFPLVSGSFILISG 133
           E  FV     A L+ QAG  Q ++ +++I DSF ++  GQ +W  +S+ L  G+FILI+G
Sbjct: 43  EAAFVGVLCSAQLMTQAGLGQSIAPLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAG 102

Query: 134 RLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLV 193
           RLGDI+G ++           WSL+ GF+ Y++   FF   RAFQG+G +F+LPN + ++
Sbjct: 103 RLGDIFGHRKFFILGFFWYALWSLLAGFSVYSN-KIFFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 194 GNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLV 253
           G  YK G  RKN+V SL G  AP G   GA++  ++       WPW +           V
Sbjct: 162 GRTYKPGK-RKNMVFSLFGASAPGGFVLGAVFSSML--GQLAWWPWAYWIMGIACFLLAV 218

Query: 254 MGYYTVPD-NIPT-NVNGFTM----DWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXX 307
            GY+ +P   +P+ +   F M    D+ GSV GVIGLILFNF WNQGP+VGWE  Y    
Sbjct: 219 AGYFVIPHVQMPSRDSPSFNMLERVDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVL 278

Query: 308 XXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQL 367
                         E + A  PLLP A   +     +L  +  GW SFGIW FY + F  
Sbjct: 279 LIVGTVFLGVFVFIESR-AAYPLLPFAALSSDAAF-VLGCIAAGWSSFGIWIFYTWQFME 336

Query: 368 NLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPV 427
             R+ SP+ S                T    +     + ++ F+   FT G I+++  PV
Sbjct: 337 ESRKQSPLLSSAQFAPVAISGFCAAVTTGFLLSHTPASTVMLFAMTAFTVGIILIATAPV 396

Query: 428 HQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGM 487
           HQTYW  TF   I++ +GMD+ FPA++I+LS+ +P ++QG+A SLVNT+VNYS S+ LG+
Sbjct: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGI 456

Query: 488 GTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHD-IWSKRNAKDPKDLQ 545
             T+E Q+N  G + LKGYR + Y G+G++GLG  +A +      + SK+ A + + ++
Sbjct: 457 AGTIESQVNDGGANALKGYRCSWYMGIGLSGLGIFVAAVYASSTFLKSKKKASEKQYIE 515

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  303 bits (777), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 178/493 (36%), Positives = 266/493 (53%), Gaps = 17/493 (3%)

Query: 57  QENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQ-T 115
           Q +++  Q P+   S   E  FV     A L+ QAG  Q ++ +++I DSF +   GQ +
Sbjct: 30  QPHHNGIQKPE---SLLGEAAFVGVICGAQLMTQAGLGQSIAPLHIIGDSFGTRNPGQLS 86

Query: 116 WLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVAR 175
           W  A++ L  G+FILI+GRLGD+YG K+           WSL+ GF+ Y++   FF   R
Sbjct: 87  WFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFFWYALWSLLAGFSVYSN-QIFFDCCR 145

Query: 176 AFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPK 235
           AFQG+G + +LPN + ++G  Y  G  RK +++SL G  AP G   GA++  +       
Sbjct: 146 AFQGIGPALLLPNAIAILGRTYVPGR-RKAMILSLFGATAPAGFVLGAVFSSIF--GQLT 202

Query: 236 QWPWIFXXXXXXXXXCLVMGYYTVPD----NIPTNVNGFT-MDWIGSVLGVIGLILFNFV 290
            WPW +           V G   +P      + T+V+ +  +D  GSV GVIGL+L NF 
Sbjct: 203 WWPWAYWAMGIVCFFLAVAGILVIPRMPLPELDTSVSTYQRLDIPGSVTGVIGLVLLNFA 262

Query: 291 WNQGPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFL 350
           WNQGP+VGW+  Y                  E + A  PLLP +   +     +L  +  
Sbjct: 263 WNQGPVVGWQTPYTYSLLIVSAVFLCVFAFIESR-APHPLLPLSALSSDAAF-VLGCVGA 320

Query: 351 GWGSFGIWTFYYFAFQLNLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFF 410
           GW SFGIW +Y++ F   LR +SP+ +                T    I +V  ++++ F
Sbjct: 321 GWSSFGIWIYYFWLFLEELRGHSPLLTSAQFAPVAISGLCAALTTGFVITRVRASLVMLF 380

Query: 411 SAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAV 470
           +   FT G I+++  PV Q YW   F   I++ +GMD+ FPA++I+LSD +P ++QG+A 
Sbjct: 381 AMTAFTVGGILIATAPVKQVYWAQAFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAA 440

Query: 471 SLVNTIVNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCH 530
           SLVN +VNYS S+ LG+  TVE ++N  G +LLKGYR A Y G+G++G G  IAF+   H
Sbjct: 441 SLVNVVVNYSISIGLGLAGTVEGRVNNGGANLLKGYRGAWYMGIGLSGFGILIAFMYEYH 500

Query: 531 DIWSKRNAKDPKD 543
               K++ K P +
Sbjct: 501 TF--KKSKKMPSE 511

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  294 bits (753), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 169/461 (36%), Positives = 248/461 (53%), Gaps = 12/461 (2%)

Query: 57  QENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQ-T 115
           ++++   QN   ++S  KE   +     A L+ QAG +Q +  + +I DSF     GQ +
Sbjct: 11  EQDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLS 70

Query: 116 WLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVAR 175
           W  ++F L  G+FILI+GRLGD +G K+           WS++ GF+ Y++   FF   R
Sbjct: 71  WFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSN-QIFFDCCR 129

Query: 176 AFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPK 235
           AFQG+G +F LPN + ++   Y+ G  ++N++ SL G  AP+G   GA++  L+      
Sbjct: 130 AFQGIGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL--SEFA 186

Query: 236 QWPWIFXXXXXXXXXCLVMGYYTVPDNIPTNVNGF-----TMDWIGSVLGVIGLILFNFV 290
            WPW +           V GY  +P + P + +        +D  GSV GV+GLILFNF 
Sbjct: 187 WWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFA 246

Query: 291 WNQGPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFL 350
           WNQGP+VGWE +Y                  E + AK PLLP     +  I  ++  +  
Sbjct: 247 WNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSSDTIF-VMGCIAA 304

Query: 351 GWGSFGIWTFYYFAFQLNLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFF 410
           GW SFGIW +Y +    NLR+  P+ S                +    + +  P+ ++  
Sbjct: 305 GWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMII 364

Query: 411 SAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAV 470
           + I FT GSI+++  PV QTYW  TF   I++ +GMD+ FPA++IILS  +P  +QG+A 
Sbjct: 365 AMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAA 424

Query: 471 SLVNTIVNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALY 511
           SLVNTI+NYS S+ LG   T+E QI+   DDLLKGYR A Y
Sbjct: 425 SLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRGAYY 465

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  285 bits (730), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 171/503 (33%), Positives = 261/503 (51%), Gaps = 21/503 (4%)

Query: 56  LQENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQ- 114
           LQ   S  + P    S  +E +FV     A L+ QAG +Q ++ + +I +SF  S  GQ 
Sbjct: 23  LQLVQSHVEKPQ---SLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQL 79

Query: 115 TWLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVA 174
           +W  A++ L  G+FILI+GRLGD++G K+           WSL+ GF+ Y++   FF   
Sbjct: 80  SWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSN-QIFFDCC 138

Query: 175 RAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENP 234
           RA QG+G +F+LPN + ++G  Y  G  RK +V S+ G  AP G   G+++  +      
Sbjct: 139 RALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSIF--SQL 195

Query: 235 KQWPWIFXXXXXXXXXCLVMGYYTVPDNIPTNVN---GF--TMDWIGSVLGVIGLILFNF 289
             WPW +           V G   +P   P  ++   G    +D  G+  G++GL L NF
Sbjct: 196 AWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDAAGATTGILGLALVNF 255

Query: 290 VWNQGPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLF 349
            WNQGP+VGW+  Y                  E + A+ PLLP A      +  +L  + 
Sbjct: 256 AWNQGPVVGWQTPYTYALLIVGFVFLLVFSLIESR-ARFPLLPFAALST-DLAYVLGCIA 313

Query: 350 LGWGSFGIWTFYYFAFQLNLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLF 409
            GW SFGIW FY++ F  + R  SP+ +                T    +  V    ++ 
Sbjct: 314 AGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVML 373

Query: 410 FSAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMA 469
            + I FT G ++++  P++QTYW  TF   II+ +GMD+ FPA++I++S+ +P ++QG+A
Sbjct: 374 IAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLA 433

Query: 470 VSLVNTIVNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVC 529
            SLVNT+VNYS SL LG   T+E ++N  G + L+GYR A Y G+G++GLG  +A     
Sbjct: 434 ASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAI---- 489

Query: 530 HDIWSKRNAKDPKDLQRCGTGSN 552
             +++    K  K+ Q     SN
Sbjct: 490 --VYAWSTLKKFKEEQLSEKSSN 510

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  276 bits (706), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 164/513 (31%), Positives = 259/513 (50%), Gaps = 29/513 (5%)

Query: 14  VNEANLLESQSTIDCTSSERKTAIKEQDDEIGXXXXXXXXXXLQENNSSWQNPDYFSSSF 73
           +N+ +  E Q       +ER  +  ++  +               +  SW     F    
Sbjct: 1   MNKKHDKEDQYVFFSECTERSISCNQESSKEAY------------DRCSWLKSSNFHFLC 48

Query: 74  KEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISG 133
           KEY FV T ++A   NQAG + +L  +NV+SDSFH       +L+ S+P+V GSF+LI G
Sbjct: 49  KEYAFVFTGVMAQAFNQAGGTMILPLVNVLSDSFHGK-----FLLNSYPMVCGSFMLIGG 103

Query: 134 RLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLV 193
           RLG+++G K             SL+ G + Y+ S  F+++ RAFQG+G++ ILPN     
Sbjct: 104 RLGEVHGYKETLLGGYIILILSSLLGGLSRYSKSSIFYVICRAFQGVGMALILPNFSAAY 163

Query: 194 GNIYK--VGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXC 251
              Y+      RK ++ ++IG  A TG+  G    G+ VT +   W W +          
Sbjct: 164 DYRYQSQAKAHRKTILSTIIGCGASTGAFLGTFLSGICVTRSESNWSWAYYTYTIAATLT 223

Query: 252 LVMGYYTVPDNIPTN----VNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXX 307
           L + YY+VPDNI       +NG  + W  +     GL++ N   N   +     ++    
Sbjct: 224 LALSYYSVPDNITKKNKPCLNG--LGWFSNR--SCGLLMLNVACNLAAVASSNWSHIIVL 279

Query: 308 XXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQL 367
                        +E+K+++ P+  K +  N  +  +L  +F GWG++GIW+ Y+F F L
Sbjct: 280 LVVFVCLLLLFLVFELKFSEDPVFSKELFTNASVSLVLASIFFGWGTYGIWSGYFFRFLL 339

Query: 368 NLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPV 427
           NLR YSP+ +G                +++ +K+ GP + L FS++GFTC  II+SVTP+
Sbjct: 340 NLRNYSPLAAGSTYLTLVIGGYVAEIGISMLVKRTGPKLFLLFSSLGFTCSIIILSVTPI 399

Query: 428 HQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGM 487
           HQ+Y+R+T G  I L  G+D  FP+S+IIL + LP +Y  M   L N I NY+ S   G+
Sbjct: 400 HQSYFRSTLGSMIFLALGLDFSFPSSAIILQNELPSKYHEMTAVLTNGIFNYAISFWPGI 459

Query: 488 GTTVERQINKSGDDLLKGYRAALYFGVGIAGLG 520
             +  R +  S  +L+K YR   YF +G++ +G
Sbjct: 460 CNSALRSL--SSIELIKYYRYVYYFAIGLSAIG 490

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  183 bits (464), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 140/536 (26%), Positives = 227/536 (42%), Gaps = 26/536 (4%)

Query: 27  DCTSSERKTAIKEQDDEIGXXXXXXXXXXLQENNSSWQNPDYFSSSFKEYIFVATCMIAN 86
           D +S  R+    + DD +             +   + +      S   E IFV     + 
Sbjct: 34  DDSSKTRR----DSDDNVSDINKSAPAPEEHDPPCTGEEATLNMSLLHEIIFVLLVSSSQ 89

Query: 87  LLNQAGQSQVLSAMNVISDSF---HSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKR 143
           +L  AG  Q +  M+VI + F   H S  G  W    +    GSF+LI+G++GD+ G K 
Sbjct: 90  VLGLAGAVQGIPQMDVIVEWFKLTHPSDSG--WCNGGYATTYGSFVLIAGKMGDMNGHKS 147

Query: 144 XXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLR 203
                      WSL+ GF+ Y  S  FF   RA QG+G +F   + + ++G  Y     R
Sbjct: 148 MFLIGYAWLALWSLLTGFSRYCPSSHFFFFCRAAQGIGAAFTFTSALSILGKSYPPCK-R 206

Query: 204 KNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLVMGYYTVPDNI 263
           KN + S  G     G   G ++  L        W W +          +++  + +P ++
Sbjct: 207 KNFIFSFFGACGSFGVVLGMVFSALFT--QLAHWSWAYWSMAIACVVIIILSIFFIPGDV 264

Query: 264 ---PTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXXXXXXXXXXXXXXX 320
                  N F  D++G+ L V GL+LF+  WNQ P  G+ + Y                 
Sbjct: 265 VEKHETSNVFYFDYLGAFLFVTGLVLFSVAWNQAPTYGFGRTYVYVLLIVSVVILALAMY 324

Query: 321 YEIKYAKVPLLP-KAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGX 379
            E K    PLLP   ++ N   L +L  +F  + SF +W  Y F F L  +  + + +  
Sbjct: 325 VETKVDD-PLLPWTHISAN--TLKVLLAIFFAYASFTMWAAYTFRFNLMAKGDTLLLAAA 381

Query: 380 XXXXXXXXXXXXXTTVALTIK-KVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGM 438
                           AL +   V   I +  S + F    I+M+     QTYW   F  
Sbjct: 382 KMTPMAVSGVFAALFSALLLNIHVQVQIRMLISLLAFLVPPILMATMGAGQTYWGEVFVT 441

Query: 439 QIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQ---- 494
            I++ FG+D+ FP+++++LS+ +P +++G+  SLV  ++NY+T+L      +V R     
Sbjct: 442 TIVISFGLDISFPSATLLLSNRIPDKFKGLGASLVGAVLNYATALGPPTAASVLRYQCPD 501

Query: 495 -INKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNAKDPKDLQRCGT 549
            +   G+   K      Y G+G AGLG  +A   V  + + K   K  +D +   T
Sbjct: 502 CMAHKGNAFTKTINIIGYVGIGTAGLGTLVAIFGVITE-YPKVAGKKGEDRKHSLT 556

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  159 bits (402), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 128/488 (26%), Positives = 219/488 (44%), Gaps = 21/488 (4%)

Query: 73  FKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQT---WLMASFPLVSGSFI 129
           FKE I V        ++  G  Q +  M  I+ +F           W  A++   + +F+
Sbjct: 46  FKEIIIVLLISSGQFISLLGAVQGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFV 105

Query: 130 LISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDT-FFIVARAFQGLGISFILPN 188
           +I+G+LGDI G K            WSL+ GF+ YA ++  FF   R  QG+G +F+ P 
Sbjct: 106 IIAGKLGDINGHKNMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPT 165

Query: 189 VMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXX 248
            + L+G  Y     RKN V S  G   P G   G+++  L        W W +       
Sbjct: 166 GLALLGKHYP-PCKRKNYVFSFYGACGPFGIVAGSVFSALFTQLT--TWAWTYWSMAVTC 222

Query: 249 XXCLVMGYYTVP-DNIPTNVNG--FTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXX 305
               ++ Y  +P DN P       ++ D++G   G+ G+ILF+ VWNQ P+  ++  Y  
Sbjct: 223 LIITILSYIFIPKDNTPKRERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVY 282

Query: 306 XXXXXXXXXXXXXXXYEIKYAKVPLLP-KAVTQNGHILTILTVLFLGWGSFGIWTFYYFA 364
                           + +  K PL+P K++  N  ++  L V+F G+  F IW FY + 
Sbjct: 283 SLLIVSVVFMTMALIIDSR-VKDPLIPWKSMCSN--VIKALIVVFFGFLGFTIWLFYSWR 339

Query: 365 FQLNLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAI-GFTCGSIIMS 423
           F L  +  S + +                   L + K  P  L   +A+  F   +I++S
Sbjct: 340 FYLVAKNDSLLLAAAKFIPLGISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILIS 399

Query: 424 VTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSL 483
              + +TYW N F   +I+  G+D+ FP+++++LS+ +  + QG+A +L  T +NY T+L
Sbjct: 400 TMTLQETYWGNAFVATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTAL 459

Query: 484 CLGMGTTV-----ERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNA 538
             G+ T +     +  + +S    +     A Y  +G AG+   +A      + + +R  
Sbjct: 460 GPGVATLIITYQCDDCLARSDGRFVHAVHIAGYVAIGTAGIAVVVAIFGSITEYYKER-M 518

Query: 539 KDPKDLQR 546
            D ++ +R
Sbjct: 519 DDLREKKR 526

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  148 bits (373), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 72/125 (57%), Positives = 90/125 (72%)

Query: 83  MIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLK 142
           M++ LLNQ G +Q L  +NV+S  F SST  QT L+AS PLVSGSFIL+SG++GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 143 RXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTL 202
                       WS ICG T YA S  FF++ARAFQGLG++F+LPNVMG V N+Y  G++
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 203 RKNVV 207
           RKN+V
Sbjct: 121 RKNMV 125

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 6/43 (13%)

Query: 461 LPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDDLL 503
           +P   +G A      ++ YS  +CLG+  TVE +++K G D L
Sbjct: 147 IPTNVRGQA------MLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  140 bits (352), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 126/520 (24%), Positives = 222/520 (42%), Gaps = 36/520 (6%)

Query: 56  LQENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFH--SSTGG 113
           L E ++S + P  +    +E   V   + + L+   G  Q +     + + +    + GG
Sbjct: 22  LTEVDTSIRLPKTW---IREIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGG 78

Query: 114 QT-WLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSD-TFF 171
              W  AS+ L S   +LI+G+LGD+ G KR           WSLI GF+ Y   +  F+
Sbjct: 79  LVGWANASYMLGSAVMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFY 138

Query: 172 IVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVT 231
             ARA QG+G  FI+PN + ++G  Y    L+K ++ S+ G+M  TG   G  +  L   
Sbjct: 139 YTARALQGIGSGFIVPNSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQ 198

Query: 232 ENPKQWPWIFXXXXXXXXXCLVMGY------YTVPDNIPTNVNGFTM----DWIGSVLGV 281
               +W W +         C+ + Y      +  PDNI    N   +    D++G++ GV
Sbjct: 199 LT--KWAWNYWALA-----CVCVLYTVGAILFIPPDNIVHKPNSKPLYKRFDYLGAITGV 251

Query: 282 IGLILFNFVWNQGPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHI 341
            GL+LF+  + Q   +GW   +                  + +    PL+P        +
Sbjct: 252 SGLVLFDVAFTQASALGWSPPHTYITLIIGVILILIAMFVDWRVDD-PLVPLQ-HLRADV 309

Query: 342 LTILTVLFLGWGSFGIWTFYYFAFQLNLREYSP--VWSGXXXXXXXXXXXXXXTTVALTI 399
           + IL  ++ G+ SF IW  +++ F   +   SP  + +               T   L +
Sbjct: 310 VVILICVYFGFLSFVIWANWFWQFYELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQL 369

Query: 400 KKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSD 459
               P +++  S + F   +I+M+    + TYW   F   II  F +D+  P ++++ SD
Sbjct: 370 NIKAPTMMVI-SMVCFLVPNILMATVTPNTTYWAQPFVSSIIAPFAVDITVPTATLLFSD 428

Query: 460 YLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDDLLKG-----YRAALYFGV 514
            +  + QG+A SL+ T+++Y+ S+       V   +   G+D   G       +    G+
Sbjct: 429 SVRKESQGIAASLIITVISYAISIGPSYTAMVMWYVAPLGNDSTPGGFTHSLHSNFICGI 488

Query: 515 GIAGLGACIAFLN--VCHDIWSKRNAKDPKDLQRCGTGSN 552
            ++G+G   A +   + + I        P  L + G  S 
Sbjct: 489 VLSGIGLVTAVIAGLIDYKITRTHCGDIPPPLSKIGRKSK 528

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  125 bits (315), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 128/531 (24%), Positives = 213/531 (40%), Gaps = 38/531 (7%)

Query: 15  NEANLLESQSTIDCTSSERKTAIKEQDDEIGXXXXXXXXXXLQENNSSWQNPDYFSSSFK 74
           N  + L S ST     S+R    KEQ   +             ++     NP    S  +
Sbjct: 22  NTDHYLPSNSTASSLHSQRT---KEQCSNLQPAQA--------QDQLESMNPPPGPSRLR 70

Query: 75  EYIFVATCMIANLLNQAGQSQVLSAMNVISDSFH---SSTGGQTWLMASFPLVSGSFILI 131
           E +F+     +  ++ A  SQ +  M+ I+  F      +    W  A+F +  G+FI+ 
Sbjct: 71  ECMFIVIIASSQFISLAAASQAILQMDAITAWFQLPADRSLEAGWANAAFAITCGTFIIP 130

Query: 132 SGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHS--DTFFIVARAFQGLGISFILPNV 189
           +G+L D+ G K            WSL+ G + YA     TFF   R  QG+G + + P+ 
Sbjct: 131 AGKLCDLIGSKTVFIFGYAWYTLWSLLVGISRYAPKGQATFFFFGRGCQGIGAAALFPSS 190

Query: 190 MGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIF-XXXXXXX 248
           + L+G  Y   + +KN+V SL G   P G   G ++  +        W W +        
Sbjct: 191 LALLGKYYP-PSCKKNIVFSLYGFCVPLGVVVGGVFSAIFT--QLAHWSWNYWSMAIVSA 247

Query: 249 XXCLVMGYYTVPDNIPTNVNGFT---------MDWIGSVLGVIGLILFNFVWNQGPIVGW 299
              L+  +Y  PD I  +               D++G+ L V  L+LF   WNQ     +
Sbjct: 248 FFTLISCFYIPPDEIIKSEEQKKKRAWFHLPKFDYLGTFLYVASLLLFAVCWNQATGFKF 307

Query: 300 EKAYXXXXXXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWT 359
           +                     E  Y   P++P A   +   +  L V+F  + SF IW 
Sbjct: 308 KSVQVYVTLIVSLVCFVAMVIVEF-YVDDPIIP-ARKIHPQTIKALLVVFFSYLSFTIWL 365

Query: 360 FYYFAFQLNLREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPA-ILLFFSAIGFTCG 418
           FY + +   +R  + +                     L I    P  I L   A  F   
Sbjct: 366 FYLWKYFTVVRNDTVLLGAAKFVPLSIAGFIAALFSILLISTAVPVQIRLLAGACSFLLA 425

Query: 419 SIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVN 478
            I+       ++YW   F   II+  G+D+ FP+++++LS+ +P + +G++ +LV T +N
Sbjct: 426 HILFITLSRTESYWARPFLTIIIISIGLDISFPSATLLLSNGVPQELRGISAALVGTALN 485

Query: 479 YSTSLCLGMGTT-VERQINK---SG--DDLLKGYRAALYFGVGIAGLGACI 523
           Y T +   +  T +  Q +K   SG  D  +K    A   G+G +G+   +
Sbjct: 486 YGTGIGPPIAQTIIGYQCDKCMASGDMDQFVKAIHIAAAVGIGASGIAVVV 536

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  125 bits (314), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 120/527 (22%), Positives = 211/527 (40%), Gaps = 73/527 (13%)

Query: 64  QNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFH---SSTGGQTWLMAS 120
           Q+P   +S   + IF+     +  +  A  SQ +  M+ +S  F    +ST    W+ AS
Sbjct: 62  QSPT--NSYLNDIIFIFLICSSQFITLASASQAILQMDSLSVWFKIPPTSTLQLGWVNAS 119

Query: 121 FPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFI-VARAFQG 179
           F +  G+FI+++G+L DI   +            W+LI GF +Y   +  F+ + R  QG
Sbjct: 120 FAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWTLITGFASYVPKNMIFLYICRGCQG 179

Query: 180 LGISFILPNVMGLVGNIYKVGTL------------------------------------- 202
           +G + + P+ + L+   Y V                                        
Sbjct: 180 IGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSPSHDIEKNLSSDDDNDGDSSI 239

Query: 203 ---------RKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLV 253
                     K++  SL G  AP G   G ++  +        WPW +           +
Sbjct: 240 ADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSAIF--TQLATWPWNYWSMSIVTTLLSI 297

Query: 254 MGYYTVPDNIP-----TNVNGF----TMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYX 304
           + Y+ V   IP     +N N        D++G +LG+  LILF   W+Q  +  ++  + 
Sbjct: 298 LSYFYVVVPIPVEKLDSNPNSLKNWKNFDFLGVILGISALILFGVSWDQATMYKFKTIHV 357

Query: 305 XXXXXXXXXXXXXXXXYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFA 364
                           +E  Y   P++P      G I  +L V+F  + SF  W FY + 
Sbjct: 358 YLTLLFSLVSFIAMIIWE-YYFNNPIIPIRQIHPGTIKALL-VVFFSYISFTQWLFYTWK 415

Query: 365 FQLNLREYSPVWSGXXXXXXXXXXXXXXT-TVALTIKKVGPAILLFFSAIGFTCGSIIMS 423
               +++ SP+                 T ++ L +K+V   I L   A  F    I++ 
Sbjct: 416 LFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIVKRVPVQIRLLAGASSFLLSHILLL 475

Query: 424 VTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSL 483
              +  +YW   F   I +  G+D+ FP+++++L++ +P + QG+  +LV +++NY T++
Sbjct: 476 TCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTNGIPPEIQGICAALVGSVLNYGTAI 535

Query: 484 CLGMGTT-VERQINKSGDD------LLKGYRAALYFGVGIAGLGACI 523
              +  T ++ Q      D       LKG   A   GVG +G+   I
Sbjct: 536 GPPIAQTIIQYQCESCMSDPHDKKAFLKGIHIAGAVGVGCSGIAVLI 582

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 96/474 (20%), Positives = 171/474 (36%), Gaps = 50/474 (10%)

Query: 60  NSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMA 119
            S++QN      SF  YI +   M++   +    + VLSA   I +++       +W + 
Sbjct: 13  RSNFQNI-----SFHRYINLVLIMVSCAFDLINVTAVLSATRDIENTYQIEFTTASWALT 67

Query: 120 SFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQG 179
           ++ +    FI   GR+GDI G               SLIC   N   +   F V RA QG
Sbjct: 68  AYAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAVVNNFGT---FAVFRALQG 124

Query: 180 LGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPW 239
           +  + I+P+   L+  +     ++    I   G     G   G + GG   T     +  
Sbjct: 125 IAAAGIVPSGYALIPTLSDEHEVQSFFAIVSCGFSTSFG--IGFIIGGAF-TLTRIGYKG 181

Query: 240 IFXXXXXXXXXCLVMGYYTV----------PDNIPTN--VNGFTMDWIGSVLGVIGLILF 287
           IF           ++ Y+++           D+  T    +  ++D+IGS + +   IL 
Sbjct: 182 IFYLTFAVMLVISIISYFSIGTSANQKPCTKDSPKTTKWSDALSLDFIGSFMFISSTILI 241

Query: 288 NFVWNQGPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKY---------AKVP--------- 329
                +G    W+K                   + I Y         A  P         
Sbjct: 242 VVGLTEGG-ESWKKPSAYVTLIVGIALFVLFFIWNICYGVLVKNLKSASNPKVYNYFRTI 300

Query: 330 --LLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGXXXXXXXXX 387
             L+PK V    + + I   +F  +G      +    +   + + SP+ +          
Sbjct: 301 QVLIPKDVLMMKNFIPITVAVFANYGCLFSNLYIVNQYCQYVSKNSPLLAAVKLLPLVVS 360

Query: 388 XXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVH----QTYWRNTFGMQIILV 443
                  +A+    + P   +         GSII+    +H      YW+  F  Q ++ 
Sbjct: 361 MLIPNVVIAIKSDLISPRKAVVLGFFIMFIGSIIL--IQLHLITDNLYWKIFFCSQSLIA 418

Query: 444 FGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINK 497
           FG  + FP S  IL  + P +Y+G+A  ++ T   +   +   + T++   IN+
Sbjct: 419 FGAAIFFPYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGNINE 472

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 106/528 (20%), Positives = 188/528 (35%), Gaps = 73/528 (13%)

Query: 41  DDEIGXXXXXXXXXXLQENNSSWQ-----NPDYFSSSFKEYIFVATCMIANLLNQAGQSQ 95
            DE G          L+  NS +Q        +F  +F            +LLN AG   
Sbjct: 2   QDEFGKLRNGLKCLRLKCQNSRYQLGINITLIFFGCTF------------DLLNVAG--- 46

Query: 96  VLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXW 155
           V+S +  + +++     G +W + S+ +    FI   GRLGDI G              +
Sbjct: 47  VISVIEDLGETYKLGYTGASWALTSYAITFAGFIAFMGRLGDIVGNSVLFTISCFLFTLF 106

Query: 156 SLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMA 215
           SL+C       +   F V RA QG+  + I+P    L+  + +   ++K   I   G  +
Sbjct: 107 SLLCAVVRDFPT---FAVFRALQGISAAGIVPCGYALIPLLAEPQDIQKFFSIVSCGFSS 163

Query: 216 PTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLVMGYYT---------------VP 260
             G   G + GG             +          +   +YT               +P
Sbjct: 164 TIG--IGLIVGGAFALTKVGYAGIFYLSFAGMLVVSIAASFYTYRIEERKFLEVKVEDIP 221

Query: 261 DNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXXXXXXXXXXXXXXX 320
            + P      ++D++GS++ V G +L      +G    W +                   
Sbjct: 222 HDHPKVA---SLDFVGSLIFVSGSVLIVAGLTEGG-ESWRRPVAYVPFSIGVLLFCSFFI 277

Query: 321 YEIKYAKVPLLPKAV-------TQNGHILTILTVLFL----------GWGSFGIWTFYYF 363
           +   Y K+    KAV         N  +L    VLF+             +  +++  Y 
Sbjct: 278 WNCYYQKMVSRLKAVGFNTPQYLNNVQVLVPKDVLFMPNFIPIILSFACNNACLFSVIYI 337

Query: 364 AFQLN--LREYSPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSII 421
             Q +  + + SP+ +G              TT A+   ++ P + +    +   CGSII
Sbjct: 338 IDQYSQYVEKNSPLIAGVRLIPLIVSMVIGNTTCAIRSLQLRPKVGVVLGFLFMLCGSII 397

Query: 422 MSV--TPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNY 479
           +    T  +  +W+  F  QI +  G  + +P +  ++    P   +G+A  +  T   +
Sbjct: 398 LIQLHTIENGIFWKLFFCSQISVGLGAAIFYPYALKLVVGGAPDGAKGIASGMTQTFAQF 457

Query: 480 STSL-------CLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLG 520
              +        LG  T V+  +N S +     ++   YF V +A LG
Sbjct: 458 GVEVTFSVMVSVLGNITDVKETLN-SQETFKDRFQNCAYFSVAVAALG 504

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 56/245 (22%), Positives = 98/245 (40%), Gaps = 11/245 (4%)

Query: 57  QENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTW 116
            E + ++     F     +++     +IA  L+ A    ++  +  I   F+ S     W
Sbjct: 3   SEKSVTFPKGSLFHQDTLKHLKFICILIACGLDLASVGAMIVLVTDIETRFNVSHTQSGW 62

Query: 117 LMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFT-NYAHSDTFFIVAR 175
            + S+ +    FI   GR+GDI G              +SL+C    N+      F V R
Sbjct: 63  ALTSYVITFAGFIAFFGRVGDIVGNGIMMCVFSVIFGIFSLLCAVVPNFIA----FTVFR 118

Query: 176 AFQGLGISFILPNVMGLVGNIYKVGTLRK--NVVISLIGIMAPTGSCFGALWGGLIVTEN 233
           AFQG+  + I+P    LV  +++   L++  +++ S+I  MA  G   G  +G   +   
Sbjct: 119 AFQGMAGAGIVPCAYALVNKMFQGPNLQRYFSILSSVISAMAGVGFIIGGAFGETALGYK 178

Query: 234 PKQWPWIFXXXXXXXXXCLVMGYYTVPDNIPTNVNGF----TMDWIGSVLGVIGLILFNF 289
              +             C+++GY  +  N  +    F     +D IG +L + G IL   
Sbjct: 179 SFFYFLFAASLATAAVICVLIGYPELLLNRHSYKEKFQRVYKLDVIGCLLFISGSILLVV 238

Query: 290 VWNQG 294
              QG
Sbjct: 239 GLTQG 243

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 109/531 (20%), Positives = 196/531 (36%), Gaps = 61/531 (11%)

Query: 56  LQENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQT 115
           LQE  +  Q   Y  +     IF+      +LLN A    ++S ++ ++  ++ S    +
Sbjct: 13  LQEIRNKCQKSPYQLNVNVGLIFLGCTF--DLLNVA---SMISLIDDLAKKYNISYTTAS 67

Query: 116 WLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICG-FTNYAHSDTFFIVA 174
           W + S+ +    FI   GRLGDI G               SL+C    N+      F V 
Sbjct: 68  WSLTSYAVTFAGFIACMGRLGDIVGNSVLFTISCSCFAILSLLCAVMPNFPA----FAVF 123

Query: 175 RAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENP 234
           RA QG+  + ++P    L+  +     ++K   I   G  +  G   G + GG       
Sbjct: 124 RAIQGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIG--LGLIIGGAFAATKI 181

Query: 235 KQWPWIFXXXXXXXXXCLVMGYYTV--------PDNIPTNVNGFTMDWIGSVLGVIGLIL 286
                 +          ++  ++T         P  I    +  ++D+IGS++ V G IL
Sbjct: 182 GYRGIFYLTFAVMSLISVIAFFFTYNVENFDKKPQKIQAQTSVKSLDFIGSLIFVAGSIL 241

Query: 287 FNFVWNQGPIVGWEKAYXXXXXXXXXXXXXXXXXYEIKYAKVPLLPKAVT-------QNG 339
                 +G    W +                   +   YAK+    + V        +  
Sbjct: 242 IVVGLTEGG-ESWNRPVTYVTLIIGILLFFGFFVWNCTYAKIVRGIRFVGIDTSKYFEKV 300

Query: 340 HILTILTVLFLG-----WGSFGIWTFYYFAFQLNLREY-------SPVWSGXXXXXXXXX 387
            +L  + VLF+        +F +     F+    + +Y       SP+ +G         
Sbjct: 301 QLLIPVDVLFMKNFIPIVLAFALNNACLFSCLYIIDQYSQYAEKDSPLLAGVKLVPLIIC 360

Query: 388 XXXXXTTVALTIKKVGPAILLFFSAIGFT---CGSIIMSVTPVH----QTYWRNTFGMQI 440
                   A    K+ P + +   A+GF+    GSII+    +H      +W+  F  Q 
Sbjct: 361 MVVGNALCAFESTKLKPRVGV---ALGFSLALAGSIIL--IQLHLIKDNVFWKIFFSSQA 415

Query: 441 ILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQIN--KS 498
           ++ FG+ + +P +  I     P Q +G+A  +  T       +   +  +V   IN  K 
Sbjct: 416 LVGFGVAIFYPYALQIAVGGAPDQSKGIASGVAQTFGQLGIEITFSVMASVLGDINEMKG 475

Query: 499 GDDLLKGYRAAL----YFGVGIAGLGACIAFLNVCHDIWSKRNAKDPKDLQ 545
            +D ++ +R       YF V +  LG  +  + +  DI +  +  D  DL+
Sbjct: 476 KEDAIQNFRTGFQNCSYFTVAVGALGFLVTAICI-RDIHTPND--DISDLE 523

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 98/242 (40%), Gaps = 19/242 (7%)

Query: 57  QENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTW 116
           +E+N   +    ++ S  ++  + +  + + L+    + V + MN +++ F  S   Q W
Sbjct: 21  EEDNGLEEQYHEYNLSLPKFPILLSLWLGSFLSSLDSTIVANIMNKVAEEFEESDKKQ-W 79

Query: 117 LMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARA 176
           +  SF L + +F  + G+L DI G K            + L C  T +A + T F +ARA
Sbjct: 80  IATSFLLTNTAFQPLYGKLSDITGRK---FAVLTSHFFFGLGCFLTCFAQNITQFSIARA 136

Query: 177 FQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQ 236
             G+G   +  N M  +       T  + +      I+   G   GA  GGL +  +   
Sbjct: 137 ICGIGAGGV--NAMSSITVSDICSTRERGIYQGYANIVFGLGQLLGAPLGGLFI--DSVG 192

Query: 237 WPWIFXXXXXXXXXCLVMGYYTVP---DNIPTNVNGFT------MDWIGS--VLGVIGLI 285
           W  IF         C  +    +     +IP     FT      +D  GS  ++G I  +
Sbjct: 193 WRVIFGVQVPMLLLCSTLATRNINVKLAHIPPRKERFTWKNLSRIDIFGSLALVGTISSL 252

Query: 286 LF 287
           LF
Sbjct: 253 LF 254

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 88/213 (41%), Gaps = 23/213 (10%)

Query: 84  IANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKR 143
           +AN L    ++ + + MN +++ F  S   Q W+  SF L S  F  I G+L D+ G + 
Sbjct: 55  MANFLASMDRTIIANIMNSVTEEFKESHRIQ-WVATSFLLTSTVFQPIYGKLSDVTGRR- 112

Query: 144 XXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLR 203
                      + L C  T YA +   F   RA  G+G   I    +  +G+++ V    
Sbjct: 113 --FVLVLAYSLFLLGCLVTAYARNIWEFAFGRAICGIGAGGIPTMCVITMGDMFSVK--E 168

Query: 204 KNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLVMGYYTVPDN- 262
           +++  S   I+   G   GA  GG+ +      W  IF         C+   Y T+ D+ 
Sbjct: 169 QSIYQSYAHIIYTIGEVLGAPIGGIAL--ETVGWRAIFLAQVPVLTICI---YLTLCDDD 223

Query: 263 -----IPTNVNGFT------MDWIGSVLGVIGL 284
                IP +    T      MD  GS+L +I L
Sbjct: 224 LAQQHIPPHGERLTWKNISRMDLSGSILLIISL 256

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/220 (25%), Positives = 89/220 (40%), Gaps = 17/220 (7%)

Query: 84  IANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKR 143
           + + L     S V + MN I++ FH S   Q W+  SF L + +F  + GR  DI G K 
Sbjct: 52  LGSFLASIDASIVANIMNKIAEEFHESDKKQ-WMATSFLLTNAAFQPLYGRCSDIVGRKC 110

Query: 144 XXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLR 203
                       +L+   T +A + T F +ARA  G+G   I       V +I    T  
Sbjct: 111 ALLIAQSFFLLGTLL---TCFARNVTEFAIARAICGMGGGGIGAMSSITVSDI--CTTKE 165

Query: 204 KNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLVMGYYTVP--- 260
           + +      ++   G   GA  GGLI+      W  IF         C+++ Y  +    
Sbjct: 166 RGMYQGYANVIFGAGQVLGAPVGGLIM--ETFNWRIIFAAQVVAIMICMILAYRNINLKL 223

Query: 261 DNIP------TNVNGFTMDWIGSVLGVIGLILFNFVWNQG 294
            +IP      T  N   +D  GS +    L+ F  +++ G
Sbjct: 224 LHIPPFHQRFTRKNLSRIDLFGSSMLSCSLVSFLMLFSSG 263

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 39/88 (44%), Gaps = 3/88 (3%)

Query: 94  SQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXX 153
           S ++S ++ +S  +  S    +W + S+ +    FI   GRLGDI G  R          
Sbjct: 46  SSMISLIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFA 105

Query: 154 XWSLICGFTNYAHSDTFFIVARAFQGLG 181
             SL+CG      +   F V RA QG+ 
Sbjct: 106 ILSLLCGLMPNFEA---FAVMRALQGIA 130

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 48/98 (48%), Gaps = 4/98 (4%)

Query: 84  IANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKR 143
           + + L+    + V + MN +++ F  S+  Q W+  SF L + +F  + G+L DI G K 
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEEFSESSKKQ-WIATSFLLTNTAFQPLYGKLSDITGRK- 101

Query: 144 XXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLG 181
                      + L C  T +A + T F +ARA  G+G
Sbjct: 102 --SALLTAQFFFGLGCLLTCFARNVTEFSIARAICGIG 137

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 58/135 (42%), Gaps = 6/135 (4%)

Query: 96  VLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXW 155
           V + MN +++ F  S   Q W+  SF L + +F  + G+L DI G K            +
Sbjct: 63  VANIMNRVAEEFAESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRK---FAVLTAHFFF 118

Query: 156 SLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMA 215
            L C  T +A + T F +ARA  G+G   I  N M  +       T  + +      I+ 
Sbjct: 119 GLGCLLTCFAQNVTQFSIARAICGMGAGGI--NAMSSITTSDICTTRERGIFQGYANIVF 176

Query: 216 PTGSCFGALWGGLIV 230
             G   GA  GGL +
Sbjct: 177 GMGQVLGAPLGGLFL 191

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 48/98 (48%), Gaps = 4/98 (4%)

Query: 84  IANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKR 143
           + + L+    + V + MN +++ F  S+  Q W+  SF L + +F  + G+L DI G K 
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEDFSESSRKQ-WIATSFLLTNTAFQPLYGKLSDITGRK- 101

Query: 144 XXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLG 181
                      + L C  T +A + T F +ARA  G+G
Sbjct: 102 --SALLIAQFFFGLGCLLTCFARNVTEFSIARAICGIG 137

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 48/98 (48%), Gaps = 4/98 (4%)

Query: 84  IANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKR 143
           + + L+    + V + MN +++ F  S+  Q W+  SF L + +F  + G+L DI G + 
Sbjct: 44  LGSFLSSLDSTIVANIMNRVAEEFSESSKKQ-WIATSFLLTNTAFQPLYGKLSDIIGRR- 101

Query: 144 XXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLG 181
                      + L C  T +A + T F +ARA  G+G
Sbjct: 102 --PALLTAQFFFGLGCLMTCFARNVTEFSIARAVCGIG 137

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 71/172 (41%), Gaps = 24/172 (13%)

Query: 96  VLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXW 155
           V + MN +++ F  S   Q W+  SF L + +F  + G+L DI G K            +
Sbjct: 71  VANIMNRVAEEFQESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRK---FALLVAHTFF 126

Query: 156 SLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRK--------NVV 207
            L C  T +A + T F +ARA    GI     + M  +  +  + T R+        NVV
Sbjct: 127 CLGCLLTCFARNVTEFSIARAI--CGIGGGGISAMSSI-TVSDICTARERGAYQGYANVV 183

Query: 208 ISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLVMGYYTV 259
            S       TG   GA  GG  +  +   W  IF         C+V+GY  V
Sbjct: 184 FS-------TGQLLGAPLGGFAL--DRIGWRAIFGLQVPMLLICMVLGYRNV 226

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 48/98 (48%), Gaps = 4/98 (4%)

Query: 84  IANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKR 143
           + + L+    + V + MN +++ F  S+  Q W+  SF L + +F  + G+L DI G K 
Sbjct: 44  LGSFLSSLDGTIVANIMNRVAEEFSESSRKQ-WIATSFLLTNTAFQPLYGKLSDITGRKS 102

Query: 144 XXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLG 181
                      + + C  T +A + T F +ARA  G+G
Sbjct: 103 ---ALLTAHFFFGIGCLLTCFARNVTEFSIARAICGIG 137

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 95/476 (19%), Positives = 173/476 (36%), Gaps = 56/476 (11%)

Query: 86  NLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRXX 145
           +LLN A    ++S ++ ++ +++ S    +W + S+ +    FI   GRLGDI G     
Sbjct: 41  DLLNVA---SMISLIDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRLGDIIGNSVLF 97

Query: 146 XXXXXXXXXWSLICG-FTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRK 204
                     SL+C    N+      F V RA QG+  + ++P    L+  +     ++K
Sbjct: 98  TISCSCFAVLSLLCAVMPNFPA----FAVFRAIQGICAAGLVPCAYALIPILAPKEKVQK 153

Query: 205 NVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLVMGYYTV----- 259
              I   G  +  G   G + GG   T         +          ++  ++T      
Sbjct: 154 YFSIVSCGFSSTIG--LGLIIGGAFATTKIGYRGIFYLTFAVMTLISIIAFFFTYGVEKL 211

Query: 260 -----PDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXXXXXXXXX 314
                 D   T+V   ++D+IGS++ V G IL      +G    W +             
Sbjct: 212 NKKPQKDQASTSVK--SLDFIGSLIFVAGSILIVVGLTEGG-ESWNRPVTYVTLVIGIIL 268

Query: 315 XXXXXXYEIKYAKVP-------LLPKAVTQNGHILTILTVLFLG-----WGSFGIWTFYY 362
                 +   Y K+        +      +   +L  + VLF+        +F +     
Sbjct: 269 FFGFFVWNCTYTKIVRGFKYCGIDTSKYFEKVQLLIPIDVLFMKNFIPIVLAFALNNACL 328

Query: 363 FAFQLNLREY-------SPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGF 415
           F+    + +Y       SP+ +G                 A    K+ P + +   AIGF
Sbjct: 329 FSCLYIIDQYSQYAERNSPLLAGVKLVPLIICMVIGNALCAFESTKLRPRVGV---AIGF 385

Query: 416 ---TCGSIIMSVTPV--HQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAV 470
                GSII+    +     +W+  F  Q ++ FG+ + +P +  I     P + +G+A 
Sbjct: 386 FLALAGSIILIQLHLVKEDLFWKIFFSAQALVGFGVAIFYPYALQIAVGGAPDESRGIAS 445

Query: 471 SLVNTIVNYSTSLCLGMGTTVERQIN--KSGDDLLKGYRAAL----YFGVGIAGLG 520
            +  T       +   +  +V   IN  K   + ++ +R       YF V +  LG
Sbjct: 446 GVAQTFGQLGIEITFSVMASVLGNINEMKGKSNAIQKFRTGFQNCSYFTVAVGALG 501

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 57/124 (45%), Gaps = 4/124 (3%)

Query: 58  ENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWL 117
           E ++  Q     + S  +   V +  + + L+    + V + MN +++ F  S   Q W+
Sbjct: 19  EQDALEQEYHEHNLSLPKLPIVLSLWLGSFLSSLDGTIVANIMNRVAEEFQESDKKQ-WI 77

Query: 118 MASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAF 177
             S+ L + +F  + G+L D+ G K            + L C  T +A+S T F +ARA 
Sbjct: 78  ATSYLLTNTAFQPLYGKLSDLTGRK---FAVLTAHFFFGLGCLLTCFANSVTQFAIARAI 134

Query: 178 QGLG 181
            G+G
Sbjct: 135 CGVG 138

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 72/176 (40%), Gaps = 8/176 (4%)

Query: 84  IANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKR 143
           + + L     + V + MN +++ F  S   Q W++ SF L + +F  + G+L D+ G K 
Sbjct: 48  MGSFLGSLDSTIVANIMNKVAEEFEESDKKQ-WIVTSFLLTNTAFQPLYGKLSDLAGRK- 105

Query: 144 XXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLR 203
                      + + C FT  + +   F +ARA  G+G   I       V +I       
Sbjct: 106 --TALMVAHSFFLVGCLFTALSRNLVEFSIARAVCGMGAGGISALSSISVSDI--CTPKE 161

Query: 204 KNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLVMGYYTV 259
           + V      ++  TGS  G   GG ++  +   W  IF         C+ +GY  V
Sbjct: 162 RGVYQGYANVVFGTGSMLGGPIGGWLM--DSFGWKVIFAGQVPLIMTCMFLGYRNV 215

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 98/501 (19%), Positives = 178/501 (35%), Gaps = 67/501 (13%)

Query: 86  NLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRXX 145
           +LLN A    ++S ++ ++  +  S    +W + S+ +    FI   GRLGDI G     
Sbjct: 41  DLLNVA---SMISLIDDLAQKYDISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSILF 97

Query: 146 XXXXXXXXXWSLICG-FTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRK 204
                     SL+C    N+      F V RA QG+  + ++P    L+  +     ++K
Sbjct: 98  TVSCFFFAILSLLCAVMPNFPA----FAVFRAIQGISAAGLVPCAYALIPMLAPEEEVQK 153

Query: 205 NVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFXXXXXXXXXCLVMGYYTV----- 259
              I   G  +  G   G + GG             +          +V  ++T      
Sbjct: 154 YFSIVSCGFSSTIG--LGLIIGGAFAATKIGYKGIFYLTFAVMFLISIVAFFFTYGVENL 211

Query: 260 ---PDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYXXXXXXXXXXXXX 316
              P          ++D+IGS++ V G IL      +G    W +               
Sbjct: 212 SEPPRKDQATNRVRSLDFIGSLIFVTGSILIVVGLTEGG-ESWNRPATYVTLVIGIILFF 270

Query: 317 XXXXYEIKYAKVP-------------------LLPKAVTQNGHILTILTVLFLGWGSFGI 357
               +   YA++                    L+P  V    + + I  VL     +  +
Sbjct: 271 GFFFWNCSYARIVRGIRCCGIDTSRYFEKVQLLIPVDVLFMKNFIPI--VLAFALNNACL 328

Query: 358 WTFYYFAFQLNLREY--SPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGF 415
           ++  Y   Q +  E   SP+++G                 A    K+ P + +    +GF
Sbjct: 329 FSCIYIIDQYSQYEEKNSPLYAGVKLVPLIICMVIGNGLCAFESTKLKPKVGV---VLGF 385

Query: 416 T---CGSIIMSVTPVH----QTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGM 468
           +    GSII+  T +H      +W+  F  Q ++ FG+ + +P +  I     P + +G+
Sbjct: 386 SLALAGSIIL--TQLHLIKEDMFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDRSKGI 443

Query: 469 AVSLVNTIVNYSTSLCLGMGTTVERQIN----KSG--DDLLKGYRAALYFGVGIAGLGAC 522
           A  +  T       +   +  +V   I+    KSG       G++   YF V +  LG  
Sbjct: 444 ASGVAQTFGQLGIEITFSVMASVLGNIDGIRGKSGASQKFRTGFQNCTYFTVAVGALGFL 503

Query: 523 IAFLNVCHDIWSKRNAKDPKD 543
           +    +       ++ + P D
Sbjct: 504 VTLFGL-------KDTRPPTD 517

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 37.7 bits (86), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 92/242 (38%), Gaps = 29/242 (11%)

Query: 3   THITEIKEPVSVNEANLLESQSTIDCTSSERKTAIKEQDDEIGXXXXXXXXXXLQENNSS 62
           T I+EIK+    +     E QS+I       +TA    + EI                  
Sbjct: 56  TDISEIKD-TDFDSDKSKEEQSSIVRNEKHPETAFTALEPEIAY---------------- 98

Query: 63  WQNPDYFSSSFKEYIFVATCMIA---NLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMA 119
             NP Y  S+F  Y  V+  +I      L     +  + A+ ++   F++ST      +A
Sbjct: 99  --NPPY--SAFSNYQVVSILLIIIYIGFLGPVTGNIYIPALPILQSEFNTSTTAINGTVA 154

Query: 120 SFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQG 179
           +F  V      +     D  G K             +++       H    +I+ R FQ 
Sbjct: 155 AFMGVFAVGPFLWAVHADFGGRKFLYIFSLMIALIANVLLAAVP-KHLAALYIL-RVFQA 212

Query: 180 LGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPW 239
           +G S ++P  +G V ++       K V   ++G     G   G ++GGLI+  N  QW W
Sbjct: 213 IGTSAVIPLGVGTVSDLISPMNRAKGVSYFMLG--PNMGPILGPIFGGLILM-NGNQWRW 269

Query: 240 IF 241
           +F
Sbjct: 270 LF 271

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 46/103 (44%), Gaps = 8/103 (7%)

Query: 86  NLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRXX 145
           +LLN AG   V+S +  + +++       +W + S+ +     I   GRLGDI G     
Sbjct: 44  DLLNVAG---VISVIEDLGETYGLEYTTASWALTSYAITFAGLIAFMGRLGDIIGNSVLF 100

Query: 146 XXXXXXXXXWSLICG-FTNYAHSDTFFIVARAFQGLGISFILP 187
                    + L+C   TN+      F V RA QG+  + ++P
Sbjct: 101 TISGFFFSLFCLLCAVVTNFPA----FAVLRALQGIAAAGLVP 139

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 69/181 (38%), Gaps = 8/181 (4%)

Query: 373 SPVWSGXXXXXXXXXXXXXXTTVALTIKKVGPAILLFFSAIGFTCGSIIM-SVTPVHQT- 430
           SP+ +G              T  A    K+ P I +    +   CGSII+  +  V +  
Sbjct: 353 SPLLAGVKLVPLIITMVIGNTICASKSVKLRPRIGVALGFLSMVCGSIILIQLHLVEENL 412

Query: 431 YWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTT 490
           YW+  F  QI++ FG  + +P +  ++    P   +G+A  +  T       +   +  +
Sbjct: 413 YWKIMFCSQILVGFGAAIFYPYALKLVVGDAPSGAKGIASGVTQTFAQLGIEMTFSVMVS 472

Query: 491 VERQINK------SGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNAKDPKDL 544
           V   I +      S +    G++   YF +     G  +    V    +S  + KD   L
Sbjct: 473 VLGNITQVKSRPDSFERFRDGFQKCTYFTLASGAFGLVLTTFFVRGPRFSNGSPKDATAL 532

Query: 545 Q 545
           +
Sbjct: 533 E 533

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 52/126 (41%), Gaps = 7/126 (5%)

Query: 116 WLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVAR 175
           WLMA + L +  F+L+ GR+  + GLK             SL+ G  N   S    I AR
Sbjct: 46  WLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAGSLMAGAAN---SMGMLIGAR 102

Query: 176 AFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPK 235
              G G S I   V G+  +I  V    +  VI+++GI        G   GG +      
Sbjct: 103 VISGFGGSGIESLVYGVGTSI--VEEKHRARVITVLGIAYMLAEGAGPFVGGGLAEH--V 158

Query: 236 QWPWIF 241
            W W F
Sbjct: 159 SWRWCF 164

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 61/148 (41%), Gaps = 12/148 (8%)

Query: 96  VLSAMNVISDSF--HSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXX 153
           V++ +N I+D F  +S  G   WL+  + L +  F L+ GR   I+G K           
Sbjct: 40  VVTILNTIADKFNAYSKIG---WLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFE 96

Query: 154 XWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGI 213
             SL+   +N   S    I  R   G G S I   V  +  ++    T  +  +++L+ +
Sbjct: 97  IGSLVIAVSN---SMDMIIGGRVIAGCGASGIQTLVFAIATSLVDEHT--RGTIVTLLSL 151

Query: 214 MAPTGSCFGALWGGLIVTENPKQWPWIF 241
                S  G   GG + TE    W W F
Sbjct: 152 SYAVASALGPYIGGAL-TEYV-TWRWCF 177

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 78/228 (34%), Gaps = 56/228 (24%)

Query: 116 WLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVAR 175
           WL+  + L +  F L+ GRL  I GLK             SLI   +N   S    I  R
Sbjct: 46  WLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIVAVSN---SMGMIIGGR 102

Query: 176 AFQGLGISFILPNVMGLVGNIYKVGT-----LRKNVVISLIGIMAPTGSCFGALWGGLIV 230
              G G S       G+   ++ VGT       + +VI+++G+        G + GG   
Sbjct: 103 VVAGCGGS-------GIQSLVFVVGTSLVEERNRGMVITVLGLAFAVAFAVGPVIGGAF- 154

Query: 231 TENPKQWPWIFXXXXXXXXXCLVM---GYYTVPDNIPT---------------------- 265
           TEN   W W F          L M    Y T   ++                        
Sbjct: 155 TENVS-WRWCFYINLPIGGVALTMLTFSYNTTEKSVQETLTYNCRQLQTYRYGQWVTASF 213

Query: 266 -----NVNGFTMDWIGSVLGVIGLILF---------NFVWNQGPIVGW 299
                N   F +D+IG  L   G +LF          + WN G I+ +
Sbjct: 214 WRRAYNFLMFDLDFIGFALSSTGFVLFMLGLTFGGNTYAWNSGTIISF 261

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 33.9 bits (76), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 55/122 (45%), Gaps = 6/122 (4%)

Query: 57  QENNSSWQNPDY--FSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQ 114
            E +    + +Y  ++ S  ++  + +  + + L+    + V + MN +++ F  S   Q
Sbjct: 13  DEQHCDALDEEYTKYNLSLPKFPILVSLWLGSFLSSIDSTIVANIMNKVAEEFQESQEKQ 72

Query: 115 TWLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVA 174
            W+  SF L + +F  + G+L DI G K            + L C  T+ + +   F +A
Sbjct: 73  -WIATSFLLTNTAFQPLYGKLSDITGRK---FALLTALSFFGLGCFLTSLSTNIKQFAIA 128

Query: 175 RA 176
           RA
Sbjct: 129 RA 130

>KLTH0G09350g Chr7 (778062..779753) [1692 bp, 563 aa] {ON} similar
           to uniprot|P40474 Saccharomyces cerevisiae YIL121W QDR2
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS- MDR)
          Length = 563

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 69/173 (39%), Gaps = 19/173 (10%)

Query: 72  SFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILI 131
           S ++ + VA C  + + +         A+  I + FH ST      +  + L  G    +
Sbjct: 40  SNEKLVLVAICAASGIFSTIAGPIYYPALTTIENQFHISTELVNVSVVLYFLFQGLAPTL 99

Query: 132 SGRLGDIYGLKRXXXXXXXXXXXWSL---ICGFTNYAHSDTF--FIVARAFQGLGISFIL 186
            G L D +G +            WS+   +      A S T+   +V R  Q  GIS ++
Sbjct: 100 MGGLADSFGRR--------PIVMWSIALYLAACIGIACSRTYAQILVLRCLQSAGISPVI 151

Query: 187 PNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPW 239
               G++G++      ++   + L       GS FGAL GG IV+     W W
Sbjct: 152 AVNSGIMGDVTTRA--QRGGYVGLTAGFQVLGSAFGALIGGGIVS----TWGW 198

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 50/134 (37%), Gaps = 10/134 (7%)

Query: 108 HSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHS 167
           +S TG   W+ A + L +    L+ GR+  I G K             SLI G  N   S
Sbjct: 112 YSKTG---WIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSLISGVAN---S 165

Query: 168 DTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGG 227
               I  R   G+G S I      +  N+  V   R+ ++I+ +       S  G   GG
Sbjct: 166 MNMLIGGRVIAGVGGSGIQSLAFVIGSNL--VDERRRGLIIACMSSAFAVASVIGPFLGG 223

Query: 228 LIVTENPKQWPWIF 241
              T     W W F
Sbjct: 224 AFTTH--ATWRWCF 235

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 38/81 (46%), Gaps = 4/81 (4%)

Query: 96  VLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXW 155
           V + MN +++ F  S   Q W+  SF L + +F  + G+L DI G +            +
Sbjct: 53  VANIMNRVAEEFEESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRR---FALLTAHFFF 108

Query: 156 SLICGFTNYAHSDTFFIVARA 176
            L C  T +A S   F +ARA
Sbjct: 109 GLGCLLTCFAQSVEQFALARA 129

>Smik_18.10 Chr18 complement(16419..18014) [1596 bp, 531 aa] {ON}
           YAL067C (REAL)
          Length = 531

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 38/87 (43%), Gaps = 3/87 (3%)

Query: 190 MGLVGNIYKVGTLRKNVVISLIGIMA---PTGSCFGALWGGLIVTENPKQWPWIFXXXXX 246
           M L G+ +K G + +     ++G  A    TG+   A++G L  +     W W F     
Sbjct: 197 MYLFGSFFKSGEVARRSGFMIVGQYAGLMSTGAMQSAIFGALNTSHGLSGWRWYFIIVGA 256

Query: 247 XXXXCLVMGYYTVPDNIPTNVNGFTMD 273
                 ++G+Y++P +I    + F  D
Sbjct: 257 ISIVVALLGFYSLPGDIHNCYSIFLTD 283

>Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W -
           Hypothetical ORF [contig 5] FULL
          Length = 529

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 88/235 (37%), Gaps = 34/235 (14%)

Query: 74  KEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISG 133
           ++++ V  C      +    +    A+N I   FH ST      +  + L  G    + G
Sbjct: 18  EKFVLVLVCASTGFFSTIAGAIYYPALNTIEGQFHISTELVNVSIVLYFLFQGLSPTLMG 77

Query: 134 RLGDIYGLKRXXXXXXXXXXXWSL---ICGFTNYAHSDTF--FIVARAFQGLGISFILPN 188
            L D +G +            WS+   +      A S T+   +V R  Q  GIS ++  
Sbjct: 78  GLADSFGRR--------PVVLWSVALYMAACIGIACSKTYAQILVLRCLQSAGISPVIAV 129

Query: 189 VMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPW--IFXXXXX 246
             G++G++      ++   + L       GS FGAL GG IV+     W W  +F     
Sbjct: 130 NSGIMGDV--TTREQRGGYVGLTAGFQVIGSAFGALIGGGIVS----TWSWRAVFWFLAI 183

Query: 247 XXXXCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEK 301
                LV+ +  +P+   + V               G I  N +W+  P++   K
Sbjct: 184 ASGFSLVVTFIMLPETKRSIVGN-------------GSIQPNTIWHIAPVLMLPK 225

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 39/81 (48%), Gaps = 4/81 (4%)

Query: 96  VLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXW 155
           V + MN I+  F  S   Q W+  S+ L + +F  + G+L DI G K            +
Sbjct: 62  VANIMNSIAAEFAESDKKQ-WIATSYLLTNTAFQPLYGKLSDITGRK---VAVITAHFFF 117

Query: 156 SLICGFTNYAHSDTFFIVARA 176
           +L C  T +A + T F +ARA
Sbjct: 118 ALGCLLTCFAQNVTQFSIARA 138

>Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 bp,
           602 aa] {ON} ANNOTATED BY YGOB -
          Length = 602

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 48/128 (37%), Gaps = 7/128 (5%)

Query: 71  SSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFIL 130
           S   +   V  C ++   +   Q+    A+++I   F+ S       +  + L  G F +
Sbjct: 79  SKHDKLFLVVICALSGFYSTIAQTIYFPALSIIEKEFNVSVSLVNVTVVVYSLCQGIFPV 138

Query: 131 ISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTF--FIVARAFQGLGISFILPN 188
           I G L D  G +                C     A   TF   I  R  QG GIS I+  
Sbjct: 139 IMGGLADRLGRRPVAMFCIMVY-----FCACIGIACCRTFGEMIFLRCLQGGGISPIIAI 193

Query: 189 VMGLVGNI 196
             GL+G+I
Sbjct: 194 NNGLMGDI 201

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 50/117 (42%), Gaps = 2/117 (1%)

Query: 72  SFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILI 131
           S+K+++F+ +   +          V   +  IS  F  +T   TW +    ++     ++
Sbjct: 70  SYKQWLFILSAFASFTWEAFDFFTVTLNVKKISHDFDVTTKQVTWGITLVLMLRVVGAVL 129

Query: 132 SGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVARAFQGLGISFILPN 188
            G +GD YG K              +I GF    H+  +F++ARAF G+ +  I  N
Sbjct: 130 FGYIGDRYGRKVSFIINLFFMMVLEIITGFIK--HNFKYFLIARAFFGVVLGGIFGN 184

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 40/86 (46%), Gaps = 3/86 (3%)

Query: 96  VLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXW 155
           V + MN I++ F  S   Q W+  SF L + +F  + G+L D+   ++            
Sbjct: 60  VANVMNRIAEEFQESDKKQ-WIATSFLLTNTAFQPLYGKLSDVATGRKLATLIAQFFFFL 118

Query: 156 SLICGFTNYAHSDTFFIVARAFQGLG 181
            LI   + +A + T F + RA  G+G
Sbjct: 119 GLI--ISCFAQNVTQFAIGRAVCGIG 142

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 56/144 (38%), Gaps = 12/144 (8%)

Query: 100 MNVISDSF--HSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSL 157
           ++V+++ F  +S TG   WL+  + L +    LI GR   I G +             SL
Sbjct: 61  IDVVAEQFGNYSKTG---WLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSL 117

Query: 158 ICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPT 217
           I      A S    I  R   G+G S +    +  V     VG   + +VIS++      
Sbjct: 118 IAAL---ASSMNMLIFGRVVAGVGGSGL--QTLCFVIGCTMVGERSRPLVISILSCAFAV 172

Query: 218 GSCFGALWGGLIVTENPKQWPWIF 241
            +  G + GG   T     W W F
Sbjct: 173 AAIVGPIIGGAFTTH--VTWRWCF 194

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 58/151 (38%), Gaps = 18/151 (11%)

Query: 96  VLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXW 155
           V++  + I   FH   G   WL+  + L +  F+L+ GRL +I G K             
Sbjct: 28  VVTLYDTIGIKFHD-FGNIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIG 86

Query: 156 SLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGT--LRKN---VVISL 210
           SLI   +N   S    I  R   G G S       G+    + VGT  +R+N   ++I+ 
Sbjct: 87  SLISALSN---SMATLISGRVVAGFGGS-------GIESLAFVVGTSIVRENHRGIMITA 136

Query: 211 IGIMAPTGSCFGALWGGLIVTENPKQWPWIF 241
           + I        G   GG         W W F
Sbjct: 137 LAISYVIAEGVGPFIGGAF--NEHLSWRWCF 165

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
           YLL048C (REAL)
          Length = 1661

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 3/35 (8%)

Query: 341 ILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPV 375
           ILTI TVLF+   ++ IW  YY+   L+L++ +P+
Sbjct: 36  ILTIFTVLFV---TYNIWKHYYYYNVLHLKQKNPI 67

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 50/134 (37%), Gaps = 10/134 (7%)

Query: 108 HSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHS 167
           +S TG   W+ A + L S    LI GR+  + G K             SL+    N   S
Sbjct: 89  YSKTG---WIYAGYSLPSALLTLIWGRIAAVCGFKSSMLTAIIIFEVGSLVAALAN---S 142

Query: 168 DTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGG 227
               I  R   GLG S I      ++  +  V   ++ ++I+ +G      S  G   GG
Sbjct: 143 MDMLIGGRVIAGLGGSGIQTLCFVIISTL--VEESKRGLLIACMGSAFGIASVVGPFLGG 200

Query: 228 LIVTENPKQWPWIF 241
              T     W W F
Sbjct: 201 AFTTH--VTWRWCF 212

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 100 MNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLK 142
           MN +++ F++S   Q W+  S+ L + +F  + GRL DI G K
Sbjct: 90  MNRVAEDFNASNQKQ-WIATSYLLTNTAFQPLYGRLSDIIGRK 131

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 60/282 (21%), Positives = 97/282 (34%), Gaps = 24/282 (8%)

Query: 1   MPTHITEIKEPVSVNEANLLESQSTIDCTSSERKTAIKEQDDEIGXXXXXXXXXXLQENN 60
           M   I ++ E   V+    +  +S+   T   R     + D+ +           L +  
Sbjct: 1   MSEQIDKLNEQEKVD----ITPRSSDGYTHKVRSYHNDDDDESVINISDINPKNQLCQTK 56

Query: 61  SSWQNPDYFSSSFKEY------IFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQ 114
           S+   PD  S  +  +      I V  C      +    +     ++VI + F+ +    
Sbjct: 57  SNQNEPDIASPPYSRFGTTEKMILVIQCAFTGFFSSIAGAIYYPVLSVIENEFNITEEMV 116

Query: 115 TWLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXWSLICGFTNYAHSDTFFIVA 174
              +  + +  G    I G L D  G +            +   C     +H+    IV 
Sbjct: 117 NITVVVYFIFQGIAPSIMGGLADSMGRR---PVVLSSVLVYCCACIGLACSHTYAQIIVL 173

Query: 175 RAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWG-GLIVTEN 233
           R  Q  GIS ++    G++G+I       +   +  +      GS FGAL G GL  T  
Sbjct: 174 RCLQAAGISPVIAINSGIMGDITTRA--ERGGYVGYVSGFQVIGSAFGALIGAGLSAT-- 229

Query: 234 PKQWPW--IFXXXXXXXXXCLVMGYYTVPDNIPTNV-NGFTM 272
              W W  IF         CLV     +P+   T V NG  M
Sbjct: 230 ---WSWRSIFWFLAIGSGVCLVASIIILPETKRTVVGNGSIM 268

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 4/81 (4%)

Query: 96  VLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRXXXXXXXXXXXW 155
           V + MN +++ F  S   Q W+  SF L + +F  + G+L D+ G K             
Sbjct: 55  VANIMNRVAEEFSESDKKQ-WIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVIG 113

Query: 156 SLICGFTNYAHSDTFFIVARA 176
              C  T  A + T F VARA
Sbjct: 114 ---CLLTCLARNVTEFAVARA 131

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.139    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,659,876
Number of extensions: 1941605
Number of successful extensions: 4570
Number of sequences better than 10.0: 125
Number of HSP's gapped: 4507
Number of HSP's successfully gapped: 132
Length of query: 553
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 438
Effective length of database: 40,294,809
Effective search space: 17649126342
Effective search space used: 17649126342
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 68 (30.8 bits)