Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0K003608.849ON62060331480.0
NCAS0C003208.849ON60858319370.0
TDEL0B001808.849ON58258116330.0
Suva_13.4748.849ON60258316190.0
YMR284W (YKU70)8.849ON60258315910.0
ZYRO0C14850g8.849ON59457615900.0
Smik_13.5008.849ON60257915560.0
KAFR0L019508.849ON58859615510.0
Skud_13.4578.849ON60258415470.0
SAKL0D01188g8.849ON58157514910.0
KNAG0M02650singletonON57459314280.0
KLTH0C03586g8.849ON57857514220.0
TPHA0I003108.849ON60860513810.0
Kwal_27.101998.849ON57258513630.0
TBLA0B028908.849ON64861913361e-177
KLLA0C06226g8.849ON59257612841e-170
Kpol_1068.18.849ON51451412491e-166
CAGL0I02662g8.849ON60658412551e-165
AFR443CsingletonON57657710091e-129
Ecym_46208.849ON5975748831e-110
ABL117C8.849ON6025776631e-77
ZYRO0G02486g2.444ON615138890.038
SAKL0E03652g2.444ON626165890.039
KLTH0A01298g3.59ON185123810.17
TDEL0A021902.444ON626108830.22
TPHA0G024602.444ON626110810.36
TBLA0B090202.444ON681127800.43
TPHA0O010001.427ON101196780.82
YMR106C (YKU80)2.444ON629281761.3
Kwal_26.76242.444ON602147742.7
Kpol_1018.1592.444ON629123733.1
CAGL0K08602g2.468ON35041714.4
ZYRO0F13596g5.82ON42747705.8
Suva_7.5395.82ON42760698.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0K00360
         (620 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849    1217   0.0  
NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}...   750   0.0  
TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849...   633   0.0  
Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284...   628   0.0  
YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subu...   617   0.0  
ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} simi...   617   0.0  
Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284...   603   0.0  
KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8....   602   0.0  
Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284...   600   0.0  
SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON...   578   0.0  
KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {...   554   0.0  
KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} simila...   552   0.0  
TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849...   536   0.0  
Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284...   529   0.0  
TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.8...   519   e-177
KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} simila...   499   e-170
Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON} com...   485   e-166
CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} simila...   488   e-165
AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}...   393   e-129
Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {O...   344   e-110
ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON} S...   259   1e-77
ZYRO0G02486g Chr7 (190261..192108) [1848 bp, 615 aa] {ON} simila...    39   0.038
SAKL0E03652g Chr5 complement(296485..298365) [1881 bp, 626 aa] {...    39   0.039
KLTH0A01298g Chr1 complement(117599..118156) [558 bp, 185 aa] {O...    36   0.17 
TDEL0A02190 Chr1 (394031..395911) [1881 bp, 626 aa] {ON} Anc_2.4...    37   0.22 
TPHA0G02460 Chr7 (504893..506773) [1881 bp, 626 aa] {ON} Anc_2.4...    36   0.36 
TBLA0B09020 Chr2 complement(2138426..2140471) [2046 bp, 681 aa] ...    35   0.43 
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    35   0.82 
YMR106C Chr13 complement(478301..480190) [1890 bp, 629 aa] {ON} ...    34   1.3  
Kwal_26.7624 s26 (447231..449039) [1809 bp, 602 aa] {ON} YMR106C...    33   2.7  
Kpol_1018.159 s1018 (408890..410779) [1890 bp, 629 aa] {ON} (408...    33   3.1  
CAGL0K08602g Chr11 complement(867311..868363) [1053 bp, 350 aa] ...    32   4.4  
ZYRO0F13596g Chr6 complement(1120386..1121669) [1284 bp, 427 aa]...    32   5.8  
Suva_7.539 Chr7 complement(933213..934496) [1284 bp, 427 aa] {ON...    31   8.3  

>NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849
          Length = 620

 Score = 1217 bits (3148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/603 (98%), Positives = 592/603 (98%)

Query: 1   MSEYQLDNEDDEYEPTTTTAPSASYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQXXXX 60
           MSEYQLDNEDDEYEPTTTTAPSASYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQ    
Sbjct: 1   MSEYQLDNEDDEYEPTTTTAPSASYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQLLEI 60

Query: 61  XXXXXXXMSHLVIIRPSTGVGCYIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMK 120
                  MSHLVIIRPSTGVGCYIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMK
Sbjct: 61  LESLLELMSHLVIIRPSTGVGCYIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMK 120

Query: 121 KLSDLFEDLQHERITLMKYFQFDNDENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKI 180
           KLSDLFEDLQHERITLMKYFQFDNDENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKI
Sbjct: 121 KLSDLFEDLQHERITLMKYFQFDNDENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKI 180

Query: 181 FLFTDNDSPIESEEHEAKLRIRRLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGA 240
           FLFTDNDSPIESEEHEAKLRIRRLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGA
Sbjct: 181 FLFTDNDSPIESEEHEAKLRIRRLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGA 240

Query: 241 KTRETSDQDYIDAVDDEYSEFDGPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAE 300
           KTRETSDQDYIDAVDDEYSEFDGPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAE
Sbjct: 241 KTRETSDQDYIDAVDDEYSEFDGPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAE 300

Query: 301 FIIGIRGYMLYSHEKPNTRYKLVYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYG 360
           FIIGIRGYMLYSHEKPNTRYKLVYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYG
Sbjct: 301 FIIGIRGYMLYSHEKPNTRYKLVYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYG 360

Query: 361 DMNIELNDKEVYKVEEEISCPEAFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSI 420
           DMNIELNDKEVYKVEEEISCPEAFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSI
Sbjct: 361 DMNIELNDKEVYKVEEEISCPEAFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSI 420

Query: 421 RTMASLFRTLKKKDKVAIIWGKMKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKF 480
           RTMASLFRTLKKKDKVAIIWGKMKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKF
Sbjct: 421 RTMASLFRTLKKKDKVAIIWGKMKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKF 480

Query: 481 PKLLDYKDRSSNPDYTNLIKITSKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVE 540
           PKLLDYKDRSSNPDYTNLIKITSKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVE
Sbjct: 481 PKLLDYKDRSSNPDYTNLIKITSKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVE 540

Query: 541 QSMAEGDEQHQIQKLLEEDDTLRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKL 600
           QSMAEGDEQHQIQKLLEEDDTLRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKL
Sbjct: 541 QSMAEGDEQHQIQKLLEEDDTLRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKL 600

Query: 601 QEE 603
           QEE
Sbjct: 601 QEE 603

>NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}
           Anc_8.849
          Length = 608

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/583 (62%), Positives = 450/583 (77%), Gaps = 10/583 (1%)

Query: 24  SYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQXXXXXXXXXXXMSHLVIIRPSTGVGCY 83
           S+KKYDIHEGIIFCIELSK MF+EVPELNY VQ           MS LVIIRPSTG+GCY
Sbjct: 13  SFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPSTGIGCY 72

Query: 84  IHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQFD 143
            HYC++ + ++        +GIYE FPLRDVNA DMKK+SDL EDL  +RITL++YF FD
Sbjct: 73  FHYCDRKNGDSK-------NGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFD 125

Query: 144 N--DENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSPIESEEHEAKLRI 201
              D + +K+VPLE LF FLLD+FT    D N YHS+KIFLFTDNDSP E  + +A LRI
Sbjct: 126 PTLDNDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRI 185

Query: 202 RRLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEYSEF 261
           RR+VDDMNDNYINF TFFIG   +PF +SFYS++LKLG+K  + +        D+EYSE+
Sbjct: 186 RRIVDDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEY 245

Query: 262 DGPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTRYK 321
           DGPNT PIPA YIKS+ILRKKEIKR  FQ PLIL E+  FI+ +RGY + + EKP TRYK
Sbjct: 246 DGPNTTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYK 305

Query: 322 LVYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEISCP 381
           LVYE EN+RKEA S RK+LNPNTGEE++ DE  K+FPYGD +IELNDKEV K+ ++ S  
Sbjct: 306 LVYEHENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYSKH 365

Query: 382 EAFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWG 441
           E+FLK+IGFRS    + YFNNI    FVVPDESQYEG+I+TMASLFR LKK+DK  I+WG
Sbjct: 366 ESFLKVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWG 425

Query: 442 KMKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSSNPDYTNLIKI 501
           K+K+NS   LY+L PT+N DRNEGFYLYR+PFL+EIRKFPKLLDY   +++ DY NL++I
Sbjct: 426 KVKSNSNLRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSEDYLNLVRI 485

Query: 502 TSKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAE-GDEQHQIQKLLEEDD 560
           T  I+ YF+L+ GY PS+F+NPSLQR Y+ LHDYLLQVEQ + E GD   Q  + L+EDD
Sbjct: 486 TENIIGYFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKEDD 545

Query: 561 TLRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKLQEE 603
           TL KI  IR+KI++SK+SDD TQQRL KY++LWNT+Y+K+++E
Sbjct: 546 TLNKILHIREKIIASKESDDVTQQRLSKYVSLWNTFYIKMEKE 588

>TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849
           YMR284W
          Length = 582

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/581 (52%), Positives = 410/581 (70%), Gaps = 27/581 (4%)

Query: 20  APSASYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQXXXXXXXXXXXMSHLVIIRPSTG 79
            P   Y++YDIHEGIIFCIELS  MF E+PELNY +Q           MS LVI RPSTG
Sbjct: 11  TPGKGYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTG 70

Query: 80  VGCYIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKY 139
           +GCY   CN+ D           DGIY   PL+DVNA  MKKLSDL EDLQ+ER TL ++
Sbjct: 71  IGCYFFNCNRSDAK---------DGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQF 121

Query: 140 FQFDNDENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSPIESEEHEAKL 199
             +D      K  PLE L   + ++F     D+ +++++KIF FTDNDSP E+ + +AK 
Sbjct: 122 LPYDA----SKHTPLESLLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKS 177

Query: 200 RIRRLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEYS 259
           R+R LV+D++D +INFTTFFIG P  PFD+ FYSD+L+LGA T+ +              
Sbjct: 178 RLRHLVNDLDDRFINFTTFFIGKPGLPFDEGFYSDILRLGATTKASD------------- 224

Query: 260 EFDGPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTR 319
           EFDGPNT PI A YIKSR+LRK+EIKRI FQ PLIL E ++FI+G++GY + SHEKP  R
Sbjct: 225 EFDGPNTTPISAAYIKSRVLRKQEIKRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVR 284

Query: 320 YKLVYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEIS 379
           YKLVYE E++R+EAFS RKYLN  TGEE++ D   K++PYGD++IEL++ ++ ++  + +
Sbjct: 285 YKLVYENEDIRQEAFSRRKYLNAKTGEEIK-DGLTKVYPYGDLDIELSESDIAEIRNDYA 343

Query: 380 CPEAFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAII 439
             E+FLK+IGF+S   CL+Y+NNI   TFVVPDE +YEGSIRT++SLF+ L++K+KVAI+
Sbjct: 344 GEESFLKVIGFQSTETCLHYYNNIEKATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIV 403

Query: 440 WGKMKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSSNPDYTNLI 499
           WGK+K+NS P ++   P+  +  NEGFYLYR+PFL+E+R+ P +L       + DY NL 
Sbjct: 404 WGKLKSNSNPAIFFFVPSDEASPNEGFYLYRVPFLDELRRIPPMLISHGEIQDDDYENLK 463

Query: 500 KITSKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGDEQHQIQKLLEED 559
           + T K++ +F+L+NG+ PSEF+NP LQ+ +++LHDYLLQ+E+   + D + Q  KLLEED
Sbjct: 464 EATKKLINHFNLKNGFEPSEFKNPGLQKHFKILHDYLLQIEEEPEKDDVEWQRSKLLEED 523

Query: 560 DTLRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKL 600
           D+LR+ISQIRDKI  S  S DP +Q+L KY+ +WN+ Y K+
Sbjct: 524 DSLRRISQIRDKIDESANSKDPNKQKLSKYLAIWNSLYDKI 564

>Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/583 (53%), Positives = 418/583 (71%), Gaps = 22/583 (3%)

Query: 23  ASYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQXXXXXXXXXXXMSHLVIIRPSTGVGC 82
           ASY+K+DIHEGI+FCIELS  MF+E PELNY              MS LVI RP T +GC
Sbjct: 21  ASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRPGTSIGC 80

Query: 83  YIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQF 142
           Y +YC + D       AK  +GIYELFPLRD+NA  MK L+DL ED+   RITL +YF F
Sbjct: 81  YFYYCGRDD-------AK--EGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNF 131

Query: 143 DNDENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSPIESEEHEAKLRIR 202
            + E  + Q+PL KLF F+LD F      +    S+KIFLFTDND P ES++ + + R+R
Sbjct: 132 QHSEK-QMQMPLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARLR 190

Query: 203 RLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEYSEFD 262
           RL  D+ DN +NF TFFIG  +  FD+ FYSD+L+LG+   +  D D         SEFD
Sbjct: 191 RLTIDLFDNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLD---------SEFD 241

Query: 263 GPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTRYKL 322
           GPNTKPI AKYIKS+ILRKKE+KRI FQ PLI +ED  FIIG++GY ++SHEK   RYKL
Sbjct: 242 GPNTKPIDAKYIKSKILRKKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKL 301

Query: 323 VYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEISCPE 382
           VYE E++R+EA+S RK+LNP TG ++     VK++PYGD++I L++K+   + E  +  +
Sbjct: 302 VYEHEDIRQEAYSKRKFLNPTTGADVTGST-VKVYPYGDLDINLSEKQNQVIMEAYTQKD 360

Query: 383 AFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWGK 442
            FL+IIGFRS    ++YFNNI  +TF+VPDE++YEGSIRT+ASL +TL+KKDKVAI+WGK
Sbjct: 361 GFLRIIGFRSPTSSIHYFNNIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGK 420

Query: 443 MKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSSNP-DYTNLIKI 501
           +K+NS P L++L P+S  + NEGFYLYR+PFL+EIRKFP LL Y     +  +Y N+ +I
Sbjct: 421 LKSNSHPSLFVLSPSSIEEYNEGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRI 480

Query: 502 TSKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGD-EQHQIQKLLEEDD 560
           +  I+ YF+LR+GY PS+F+NPSLQR ++VLHDYLLQ+E ++ E +  + +I +++ EDD
Sbjct: 481 SQSIMGYFNLRDGYNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDD 540

Query: 561 TLRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKLQEE 603
           +LRK+  IR+KIL S+KS+DP  QRL+KY+ +WNT+Y K  ++
Sbjct: 541 SLRKLYHIRNKILESEKSEDPAIQRLNKYVKIWNTFYNKFNDD 583

>YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subunit
           of the telomeric Ku complex (Yku70p-Yku80p), involved in
           telomere length maintenance, structure and telomere
           position effect; relocates to sites of double-strand
           cleavage to promote nonhomologous end joining during DSB
           repair
          Length = 602

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/583 (53%), Positives = 416/583 (71%), Gaps = 22/583 (3%)

Query: 23  ASYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQXXXXXXXXXXXMSHLVIIRPSTGVGC 82
             Y+K+DIHEGI+FCIELS+ MF+E  +L Y              MS LVI RP T +GC
Sbjct: 21  TGYRKFDIHEGILFCIELSETMFKESSDLEYKSPLLEILESLDELMSQLVITRPGTAIGC 80

Query: 83  YIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQF 142
           Y +YCN+ D       AK  +GIYELFPLRD+NA  MKKL+DL EDL   RI+L  YF F
Sbjct: 81  YFYYCNRED-------AK--EGIYELFPLRDINATFMKKLNDLLEDLSSGRISLYDYFMF 131

Query: 143 DNDENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSPIESEEHEAKLRIR 202
               + +KQV L  LF F+LD F      +    ++++FLFTD D P E+++ + + R+R
Sbjct: 132 QQTGS-EKQVRLSVLFTFMLDTFLEEIPGQKQLSNKRVFLFTDIDKPQEAQDIDERARLR 190

Query: 203 RLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEYSEFD 262
           RL  D+ DN +NF TFFIG  D+PFD+ FYSD+L+LG+ T E +  D         SEFD
Sbjct: 191 RLTIDLFDNKVNFATFFIGYADKPFDNEFYSDILQLGSHTNENTGLD---------SEFD 241

Query: 263 GPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTRYKL 322
           GP+TKPI AKYIKSRILRKKE+KRI FQ PLIL+E   FI+G++GY +Y+HEK   RYKL
Sbjct: 242 GPSTKPIDAKYIKSRILRKKEVKRIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYKL 301

Query: 323 VYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEISCPE 382
           VYE E++R+EA+S RK+LNP TGE++   + VK++PYGD++I L+D +   V E  +  +
Sbjct: 302 VYEHEDIRQEAYSKRKFLNPITGEDVTG-KTVKVYPYGDLDINLSDSQDQIVMEAYTQKD 360

Query: 383 AFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWGK 442
           AFLKIIGFRS ++ ++YFNNI  ++F+VPDE++YEGSIRT+ASL + L+KKDK+AI+WGK
Sbjct: 361 AFLKIIGFRSSSKSIHYFNNIDKSSFIVPDEAKYEGSIRTLASLLKILRKKDKIAILWGK 420

Query: 443 MKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSSNP-DYTNLIKI 501
           +K+NS P LY L P+S  D NEGFYLYR+PFL+EIRKFP LL Y D S +  DY N+ K+
Sbjct: 421 LKSNSHPSLYTLSPSSVKDYNEGFYLYRVPFLDEIRKFPSLLSYDDGSEHKLDYDNMKKV 480

Query: 502 TSKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGDEQHQIQ-KLLEEDD 560
           T  I+ YF+LR+GY PS+F+NP LQ+ Y+VLHDYLLQ+E +  E +  +  + +++ EDD
Sbjct: 481 TQSIMGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQIETTFDENETPNTKKDRMMREDD 540

Query: 561 TLRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKLQEE 603
           +LRK+  IR+KIL S+KS+DP  QRL+KY+ +WN +Y K  ++
Sbjct: 541 SLRKLYYIRNKILESEKSEDPIIQRLNKYVKIWNMFYKKFNDD 583

>ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 594

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/576 (52%), Positives = 404/576 (70%), Gaps = 26/576 (4%)

Query: 22  SASYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQXXXXXXXXXXXMSHLVIIRPSTGVG 81
           S SY+KY++HEGIIFCIELS  MFQE+ ELNY VQ           MS LVI+RP TG+G
Sbjct: 21  SKSYRKYEVHEGIIFCIELSAGMFQELSELNYKVQLVEILETLEQLMSQLVIVRPGTGIG 80

Query: 82  CYIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQ 141
           CY + CNK D           + IYE FPLRD+NA  MKKLSDL +DL ++RITL K+  
Sbjct: 81  CYFYNCNKDDAK---------NHIYEFFPLRDINAKSMKKLSDLLDDLANDRITLQKFLP 131

Query: 142 FDNDENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSPIESEEHEAKLRI 201
           +D  E    + PL+ L+GF+ D+F      + +++++K+FLFTDNDSP E+E++E K R+
Sbjct: 132 YDESE----RTPLDFLYGFIQDEFLKEVEGQKAFNNKKVFLFTDNDSPPEAEDNETKSRL 187

Query: 202 RRLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEYSEF 261
           R LVDDM+D++INFTTFFIG  + PFDDSFYSDVLKLGA              +D  +EF
Sbjct: 188 RHLVDDMDDHFINFTTFFIGKEEAPFDDSFYSDVLKLGA------------TAEDPNTEF 235

Query: 262 DGPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTRYK 321
           DGPNT PI A YIKSR+LRK+E+KRI FQ  LIL E  +F++GI+GY +   E+P  RY+
Sbjct: 236 DGPNTTPISASYIKSRVLRKQEVKRIMFQCCLILEERMQFMVGIKGYTIIIQERPGQRYR 295

Query: 322 LVYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEISCP 381
           LVYE++ VRKEA S RK+L+ NTGE ++ +   K+FPYGD++I + D+E+ +V +  +  
Sbjct: 296 LVYEKDEVRKEANSKRKFLDSNTGEVIE-EGLTKVFPYGDLDITITDEELNEVRKSYTEE 354

Query: 382 EAFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWG 441
           E+FLKIIGFR  N+C++YFNNI    FVVPDE ++EGSIRT+ASLF+ L+ K KVA++WG
Sbjct: 355 ESFLKIIGFRDYNKCIHYFNNIDRALFVVPDEFRFEGSIRTLASLFKNLRAKGKVAVVWG 414

Query: 442 KMKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSSNPDYTNLIKI 501
           K+KTNS P +++L P+ N D NEGFYLYR+PF EE+R+FP+ L   +    P+Y  L   
Sbjct: 415 KLKTNSHPAVFVLSPSRNEDPNEGFYLYRIPFAEELRRFPQSLIRHNSYDTPEYNQLKDT 474

Query: 502 TSKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGDEQHQIQKLLEEDDT 561
           T  I+++F    GY PSEF NP LQ+ +++LHDYLLQVEQ   +   +   Q+LL EDD+
Sbjct: 475 TKSIIDHFQFAKGYRPSEFRNPDLQKHFKILHDYLLQVEQEEEDDSPESSKQRLLSEDDS 534

Query: 562 LRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYY 597
           L K++QIRDKI+ S +S DP + +LD+Y  LWN  Y
Sbjct: 535 LLKLAQIRDKIMDSAQSSDPKKFQLDEYFQLWNRLY 570

>Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/579 (51%), Positives = 410/579 (70%), Gaps = 22/579 (3%)

Query: 24  SYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQXXXXXXXXXXXMSHLVIIRPSTGVGCY 83
            Y+K+D+HEGI+FC+ELS+ MF+E  EL+Y              MS LVI RP T +GCY
Sbjct: 22  GYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVITRPGTAIGCY 81

Query: 84  IHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQFD 143
            +YC + D       AK  +GIYELFPLRD+N   MKKL+DL EDL  ER+TL +YF F 
Sbjct: 82  FYYCYRDD-------AK--EGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNFQ 132

Query: 144 NDENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSPIESEEHEAKLRIRR 203
             EN +KQ+PL  LF F+LD F   +  +   +++++FLFTDND P E++  + + R+RR
Sbjct: 133 KTEN-QKQMPLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRR 191

Query: 204 LVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEYSEFDG 263
           L  D+ DN INFTTFFIG  +  FD+ FYSD+L+LG+   +T   +         SEFDG
Sbjct: 192 LTVDLFDNKINFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLN---------SEFDG 242

Query: 264 PNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTRYKLV 323
           PNTKPI AKYIKSRILRK+E+KRI FQ  LI +E  +FIIGI+GY +YSHEK   RYKLV
Sbjct: 243 PNTKPIDAKYIKSRILRKREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLV 302

Query: 324 YEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEISCPEA 383
           YE E++R+EA+S RK+LN  +GE++  D  VK++PYGD++I L++ +   V E  +  +A
Sbjct: 303 YEHEDIRQEAYSKRKFLNFMSGEDV-TDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKDA 361

Query: 384 FLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWGKM 443
           FLKI GFRS +  ++YFNNI  ++F+VPDE +YEGSIR + SL + L+KKDK+AI+WGK+
Sbjct: 362 FLKITGFRSSSISMHYFNNIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKL 421

Query: 444 KTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSSNP-DYTNLIKIT 502
           K+NS P L++L P++  + NEGFYLYR+PFL+EIRKFP LL Y D S +  DY N+ K+T
Sbjct: 422 KSNSHPSLFVLSPSNIKEYNEGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKVT 481

Query: 503 SKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGDEQH-QIQKLLEEDDT 561
             I+ YF+LR+GY PS+F+NP LQ+ Y+VLHDYLLQ E +  E +    ++ +++ EDD+
Sbjct: 482 QSIIGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDDS 541

Query: 562 LRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKL 600
           LRK+  IR+KIL S+KS+DP  QRL+KY+ +WN +Y K 
Sbjct: 542 LRKLYHIRNKILESEKSEDPAIQRLNKYVKIWNMFYKKF 580

>KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8.849
           YMR284W
          Length = 588

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/596 (48%), Positives = 409/596 (68%), Gaps = 36/596 (6%)

Query: 8   NEDDEYEPTTTTAPSASYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQXXXXXXXXXXX 67
           NEDD+         +ASYKK++ HE +IF +ELS  MF+ VPELN  +Q           
Sbjct: 9   NEDDQ---------NASYKKFESHEAMIFSVELSDGMFETVPELN-KIQLIEILESLEEL 58

Query: 68  MSHLVIIRPSTGVGCYIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFE 127
           MS L+++RP+  +GCY HYC K  N+          GIYE FPL D+NA +MKKLSDL E
Sbjct: 59  MSQLIVVRPNAAIGCYFHYCGKEGNDY---------GIYEFFPLSDINAKNMKKLSDLLE 109

Query: 128 DLQHERITLMKYFQFDNDENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDND 187
           DL+ +RI L+ +FQ++N     K+  +EKLF F L++F++    +  Y  ++IFLFTDND
Sbjct: 110 DLRLDRINLIDFFQYNN----AKKTSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDND 165

Query: 188 SPIESEEHEAKLRIRRLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSD 247
           SPI+ E+ EAK  +R++VDD++++++NF  FFIG PD PF+ + YS++LKLGA+      
Sbjct: 166 SPIDKEDKEAKSILRKIVDDLDESHVNFVPFFIGRPDAPFNSALYSEILKLGARK----- 220

Query: 248 QDYIDAVDDEYSEFDGPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRG 307
                   D  +E+DGPNT PI A YIKS++LRK+EIKR+ F+ PLILNE   FI+G+RG
Sbjct: 221 --------DSSTEYDGPNTTPIQASYIKSKVLRKREIKRVAFRCPLILNEKKNFIVGLRG 272

Query: 308 YMLYSHEKPNTRYKLVYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELN 367
           Y+  SHEK  TRYKLVYE EN+R+EAFS RK+L+  T EE++  E  KIF  GD++IE++
Sbjct: 273 YIFVSHEKVATRYKLVYEYENLRQEAFSRRKFLSSETAEEIKGKELTKIFTLGDLDIEVD 332

Query: 368 DKEVYKVEEEISCPEAFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLF 427
           ++  ++VE+      +FLK++GFRS   C+ Y NNI    FVVPDE QY  SI+ + SLF
Sbjct: 333 ERRFFEVEKADDDVRSFLKVVGFRSIKSCVKYINNIDKVMFVVPDEMQYVNSIKILTSLF 392

Query: 428 RTLKKKDKVAIIWGKMKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYK 487
           +TL+ K K AIIWGK+K NS P L++L P+   D NEGFYL+R+PFL+EIRK P ++ Y+
Sbjct: 393 KTLRTKGKAAIIWGKLKANSNPSLFVLEPSGEKDPNEGFYLHRVPFLDEIRKLPTMITYE 452

Query: 488 DRSSNPDYTNLIKITSKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGD 547
              +  DY NLIK+T  I+ YF+L+ GY P + +NP +Q+++++LHDYLLQ+E   ++  
Sbjct: 453 CGENTSDYENLIKVTEYIMAYFNLKGGYNPMDLKNPCIQKYFKILHDYLLQIEDKTSDES 512

Query: 548 EQHQIQKLLEEDDTLRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKLQEE 603
              + Q+LL EDDTLRK+S IR+KI+SS +S+D   Q+L KY+ +WN +Y K+++E
Sbjct: 513 STERKQRLLREDDTLRKVSHIREKIISSSRSEDAGAQKLSKYIKVWNNFYAKIEKE 568

>Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/584 (51%), Positives = 414/584 (70%), Gaps = 24/584 (4%)

Query: 23  ASYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQXXXXXXXXXXXMSHLVIIRPSTGVGC 82
           A Y+K+DIHEGI+FC+ELS+ MF+E  EL+Y              MS LVI RP T +GC
Sbjct: 21  AGYRKFDIHEGILFCVELSETMFKESQELDYKSPLLEILESLNELMSQLVITRPGTAIGC 80

Query: 83  YIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQF 142
           Y +YC++ D       AK   GI+E  PLRD+NA  MK+L+DL EDL   R+TL +YF F
Sbjct: 81  YFYYCSRDD-------AKQ--GIFEFSPLRDINATFMKRLNDLLEDLSSGRMTLYEYFNF 131

Query: 143 DNDENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSPIESEEHEAKLRIR 202
              E  ++Q+PL  LF F+LD F      +    S+K+FLFTDND P E+++ + + R+R
Sbjct: 132 QPTEK-QRQMPLGVLFTFMLDTFLQDIPGQRQLSSKKVFLFTDNDIPQEAQDTDDRARLR 190

Query: 203 RLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEYSEFD 262
            L  D+ DN +NF+TFFIG  ++ FD+ FYSD+L+LG+ T +    +         SEFD
Sbjct: 191 SLTIDLFDNKVNFSTFFIGYANKSFDNEFYSDILQLGSHTNKGVGLN---------SEFD 241

Query: 263 GPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTRYKL 322
           GPNTKPI AKYIKS+ILRKKEIKRI FQ PL+  E+ +F +G++GY +YSHEK   RYKL
Sbjct: 242 GPNTKPINAKYIKSKILRKKEIKRIMFQCPLMFGENEDFTVGVKGYTMYSHEKAGVRYKL 301

Query: 323 VYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEISCPE 382
           VYE E+VR+EAFS RK+LNP TGE++ +   VK++PYGD++I  ++ +   V E  +  +
Sbjct: 302 VYEHEDVRREAFSKRKFLNPMTGEDVTSST-VKVYPYGDLDINFSENQNQIVMEAYTQKD 360

Query: 383 AFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWGK 442
           AFL+IIGFRS ++ ++YFNNI  + F+VPDE++YEGS+RT+ SLF+TL+KKDK+AI+WGK
Sbjct: 361 AFLRIIGFRSSSKAIHYFNNIEKSAFIVPDEAKYEGSVRTLTSLFKTLRKKDKIAILWGK 420

Query: 443 MKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSS-NPDYTNLIKI 501
           +KTNS   L++L P+S  + NEGFYLYR+PFL+EIRKFP LL Y +      DY N+ KI
Sbjct: 421 LKTNSHASLFVLSPSSIKEYNEGFYLYRVPFLDEIRKFPSLLSYDNGEKYKLDYENMKKI 480

Query: 502 TSKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGDEQ--HQIQKLLEED 559
           T  I+ YF+L++GY PS+F NPSLQ+ ++VLHDYLLQ+E +  EG+E    ++ +++ ED
Sbjct: 481 TQNIMGYFNLKDGYNPSDFRNPSLQKHFKVLHDYLLQIE-TTPEGNETPDAKLNRIIHED 539

Query: 560 DTLRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKLQEE 603
           D+LRK+  IR+KIL S+KS+DP  QRL+KY+ +WN +Y K  ++
Sbjct: 540 DSLRKLYHIRNKILDSEKSEDPAIQRLNKYVKIWNVFYNKFNDD 583

>SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON}
           similar to uniprot|P32807 Saccharomyces cerevisiae
           YMR284W YKU70 Forms heterodimer with Yku80p known as Ku
           binds chromosome ends and is involved in maintaining
           normal telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 581

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/575 (51%), Positives = 397/575 (69%), Gaps = 29/575 (5%)

Query: 25  YKKYDIHEGIIFCIELSKEMFQEVPELNYTVQXXXXXXXXXXXMSHLVIIRPSTGVGCYI 84
           YKKY++H GI+FCIEL+  M+++V ELN+ +Q           MS L++  P+TGVGCY 
Sbjct: 19  YKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTSPNTGVGCYF 78

Query: 85  HYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQFDN 144
             CNK        N++H  GIYE  PL+DVNA +MKKL+DL EDLQ +R TL + F F  
Sbjct: 79  FQCNKD-------NSEH--GIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPFVP 129

Query: 145 DENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSPIESEEHEAKLRIRRL 204
             +    V LE +  FL ++F     +R +Y++ K+FLFTDN  P   E  E++  +R++
Sbjct: 130 SLD----VSLESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKI 185

Query: 205 VDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEYSEFDGP 264
           V+D+ND YINFT FFI T ++PFD SFYSD+LKL AKT      DY+D  +     FDGP
Sbjct: 186 VNDLNDCYINFTPFFIDTEEKPFDQSFYSDILKLRAKT------DYVDGSE----MFDGP 235

Query: 265 NTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTRYKLVY 324
           NT PIPA YIKSR+ RKKE +R+ FQ PLIL++   F I I+GY + SHEKP TRYKLVY
Sbjct: 236 NTTPIPASYIKSRVSRKKETRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVY 295

Query: 325 EQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEISCPEAF 384
           E E +RKEAFS R+YL+ +TG ++ +D+  KIFPYGD NIEL+ +++ K+++      +F
Sbjct: 296 ENEQLRKEAFSHRRYLDASTGVDV-SDKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSF 354

Query: 385 LKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWGKMK 444
           LKIIGFRS +QCL+Y+NN+  T FVVPDE  YEGSIR MASL+R L+ K K A++WGK+K
Sbjct: 355 LKIIGFRSTDQCLFYYNNVDKTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLK 414

Query: 445 TNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSSNPDYTNLIKITSK 504
            NS P +YL+ P++ +D NEGFYL R+PF++EIR+FP +  Y D  S+ DY ++ + T  
Sbjct: 415 INSNPGIYLMTPSTENDPNEGFYLTRIPFIDEIRRFPSVPQYGDVLSSQDYGHMCQATET 474

Query: 505 IVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGDEQHQIQKLLEEDDTLRK 564
           I+ YF+LRNGY PSEF+NP LQ ++ +LHD LL+ ++  +  +EQ  ++     DDTL K
Sbjct: 475 IIAYFNLRNGYKPSEFKNPGLQHYFSLLHDQLLEAKEESSADEEQESLK-----DDTLLK 529

Query: 565 ISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVK 599
           +SQIRDKI+ S KSD+P +QRL KY   WNT Y K
Sbjct: 530 LSQIRDKIIESSKSDEPGRQRLSKYFKGWNTLYNK 564

>KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {ON}
           
          Length = 574

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/593 (47%), Positives = 392/593 (66%), Gaps = 44/593 (7%)

Query: 14  EPTTTTAPSASYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQXXXXXXXXXXXMSHLVI 73
           E   T      YKKYD HEGI+FCIEL+  +F+ V  L                M  LVI
Sbjct: 5   EVNKTVDGEYGYKKYDTHEGILFCIELTGTLFEPVESLQGRSNLLEILYSLKELMYQLVI 64

Query: 74  IRPSTGVGCYIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHER 133
           +RP + VGC  HY        T++N   +DG+YE  PLRDVNA DMK LSD  ED++ +R
Sbjct: 65  VRPGSSVGCIFHY--------TDINGA-VDGVYEFLPLRDVNAKDMKTLSDFLEDIEEKR 115

Query: 134 ITLMKYFQFDNDENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSPIESE 193
           I + +YF+FD      K V LE+LF  + +K++    D   +  ++ FLFTDND+P ES 
Sbjct: 116 INIFQYFKFDGS----KHVSLERLFQLIGEKYSEEREDGKKFTHKRAFLFTDNDAPPESN 171

Query: 194 EHEAKLRIRRLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDA 253
           + EA  RI ++VDD+++  ++FTTFFIG+ + PFD+ FYS+VLKLGA+ +          
Sbjct: 172 DTEATRRISKIVDDLDETAVSFTTFFIGSEEAPFDNRFYSNVLKLGAQLK---------- 221

Query: 254 VDDEYSEFDGPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSH 313
               +S++DGP+ +PI    IK+RILR KEIKR  FQ PL LN+D+ FIIGIRGY + +H
Sbjct: 222 ----HSDYDGPSVRPITGSDIKARILRGKEIKRTMFQCPLYLNKDSNFIIGIRGYAIVTH 277

Query: 314 EKPNTRYKLVYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYK 373
           EK  TRYKL YE+E++R+EAFS RKYLN  TGEE+   +  K+ PYGD+NIEL+ + + +
Sbjct: 278 EKYGTRYKLTYEKEDIRQEAFSKRKYLNSKTGEEVDPKDISKVIPYGDVNIELSAEALQQ 337

Query: 374 VEEEISCPEAFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKK 433
           +         F+K++GFRS + C+ YFNNI   +F+VPDE QYEGSI+T+ASLFRTL+ K
Sbjct: 338 MRASYEEEGPFMKVLGFRSTDLCVKYFNNIDKPSFIVPDELQYEGSIKTLASLFRTLRSK 397

Query: 434 DKVAIIWGKMKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFP-KLLDYKDRSSN 492
           +K AIIWGK K+NS   LY++ P+   DRN+GFY++R+PFL+E+RK P K++D       
Sbjct: 398 NKSAIIWGKPKSNSNSALYIMVPSHREDRNDGFYMHRIPFLDELRKVPIKMVD------- 450

Query: 493 PDYT----NLIKITSKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGDE 548
            D+T    +L+ +T  I++YF+LR GYIPSEF+NP +Q +Y+VLHDY+LQVE+   EG +
Sbjct: 451 NDWTQLDNDLLTVTETILKYFNLRQGYIPSEFKNPGIQNYYKVLHDYILQVEEIKHEGWD 510

Query: 549 QHQIQKLLEEDDTLRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKLQ 601
             Q ++LL +DDTL+KIS IR KI +S  SD    + L  YMN+WN +Y  L+
Sbjct: 511 FSQ-EELLRQDDTLKKISHIRGKIEASNDSD----KVLSGYMNMWNLFYKSLE 558

>KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 578

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/575 (47%), Positives = 395/575 (68%), Gaps = 29/575 (5%)

Query: 23  ASYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQXXXXXXXXXXXMSHLVIIRPSTGVGC 82
           + YKK+++HEGIIFC+ELS+ MF+E  +LN  VQ           M+ ++II P TG+GC
Sbjct: 14  SKYKKFEVHEGIIFCVELSEAMFKEPFDLN-KVQLLEILETLLELMTQVIIILPGTGIGC 72

Query: 83  YIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQF 142
           +   C+               GIYE  PL DVNA  MKKL+DL +DL+    TL + F F
Sbjct: 73  FFFQCSHEGAKG---------GIYEFLPLLDVNARSMKKLNDLLDDLKMNITTLNEQFPF 123

Query: 143 DNDENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSPIESEEHEAKLRIR 202
           ++ +N      LE +F  L ++F+ +   + +Y+++KIFLFTDND P ES++ EAK R+R
Sbjct: 124 NDKQN----TSLEAVFVLLQEQFSRSVQGQKAYNNKKIFLFTDNDRPKESDDREAKNRLR 179

Query: 203 RLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEYSEFD 262
           +++DD++D++IN   FF+G+  RPFD SFYSD+LKLGAK ++ SD  +         +++
Sbjct: 180 KVIDDLDDSFINIIPFFVGSEQRPFDQSFYSDILKLGAK-KKASDGPF---------KYE 229

Query: 263 GPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTRYKL 322
           GPNT PI AK IKSR+LRKKEIKR+ FQ  LILNE ++F + I+GY   SHE+  ++YK 
Sbjct: 230 GPNTTPISAKLIKSRVLRKKEIKRVRFQCSLILNEASDFQVSIKGYTTISHERAGSKYKQ 289

Query: 323 VYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEISCPE 382
           VY+ + +RKEA S RKYL+ NTGE++  +  VK+F + +++IEL++ E+ K+  + S  +
Sbjct: 290 VYDHDGLRKEALSHRKYLDANTGEDV-TERVVKVFKFAEVDIELSEDEIAKMNRDYSSYD 348

Query: 383 AFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWGK 442
           +FLK++GFR  N+C++YFNNI+ ++FVVPD+S ++GSI+TMASLFR L++K K A++WGK
Sbjct: 349 SFLKLVGFRDTNRCVFYFNNISNSSFVVPDDSVFKGSIKTMASLFRKLREKQKSAVVWGK 408

Query: 443 MKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSSNPDYTNLIKIT 502
           +K+NS P LY L P++ +D NEGFYL R+PF++EIRKFP    + + S    +  + KIT
Sbjct: 409 LKSNSNPSLYTLTPSNFNDHNEGFYLTRVPFIDEIRKFPPTAYHGNLSKTKTFEQMCKIT 468

Query: 503 SKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGDEQHQIQKLLEEDDTL 562
             ++ YF LR+ Y PS+FENP+LQ+ + +LHDYLLQVE     G ++H    LL++DDTL
Sbjct: 469 ETLISYFSLRHSYRPSDFENPTLQKHFELLHDYLLQVEVDPTSGSKEH----LLKKDDTL 524

Query: 563 RKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYY 597
            K+ Q+R KIL S +SDDP Q RL  Y+  WN+ Y
Sbjct: 525 LKLHQVRAKILESAESDDPVQARLSNYVKAWNSMY 559

>TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849
           YMR284W
          Length = 608

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/605 (47%), Positives = 388/605 (64%), Gaps = 38/605 (6%)

Query: 7   DNEDDEY-EPTTTTAPSASYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQXXXXXXXXX 65
           D+ED+ Y + ++   P ASY+KY+ HEG +FCIELS+ MF E+ +LNY VQ         
Sbjct: 16  DDEDEFYIDYSSIDNPKASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLM 75

Query: 66  XXMSHLVIIRPSTGVGCYIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDL 125
             MS LVI RPSTGVGC+   C+         N +    IYE  PLRD+N  DMKKL DL
Sbjct: 76  ELMSQLVITRPSTGVGCFFFNCD---------NKESKKRIYEFLPLRDINVSDMKKLHDL 126

Query: 126 FEDLQHERITLMKYFQFD--NDENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLF 183
            +D++ ER+++   F+FD  ND    K   LE LF  + D+F+     +  Y ++K+FLF
Sbjct: 127 LDDVKEERLSIRDAFKFDEIND----KGNSLESLFLLIQDRFSNNIPGQKIYTNKKVFLF 182

Query: 184 TDNDSPIESEEHEAKLRIRRLVDDMNDNYINFTTFFIGTPDRP--FDDSFYSDVLKLGAK 241
           TDND P ES + E  +R+RRL DD++DNYI F TFFI   D    FDDSFYSD+LKL   
Sbjct: 183 TDNDKPKESNDKEKTIRLRRLFDDISDNYIQFVTFFINKIDSSDNFDDSFYSDILKLR-- 240

Query: 242 TRETSDQDYIDAVDDEYSEFDGPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEF 301
                        +    EFDGP+TKPI   YIK+++LRKKEIKRI FQ PLILN D++F
Sbjct: 241 -------------NSNSIEFDGPSTKPISVAYIKNKVLRKKEIKRIMFQCPLILNADSDF 287

Query: 302 IIGIRGYMLYSHEKPNTRYKLVYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGD 361
            + ++GY + SHEKP +RYKLVYE EN+R+EAFS RK LN  TG  +  D+  KIF  G+
Sbjct: 288 QVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKRKLLNGKTGTVVTKDDTEKIFQLGN 347

Query: 362 MNIELNDKEVYKVEEEISCPEAFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIR 421
            +I   + E  K  +     E FLK+IGFRS    L+ FNNI    F+VPDES+  GSIR
Sbjct: 348 FSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENSLHLFNNIGKALFIVPDESRCVGSIR 407

Query: 422 TMASLFRTLKKKDKVAIIWGKMKTNSKPCLYLLCPTS-NSDRNEGFYLYRMPFLEEIRKF 480
           T++S++RT++ K++ AI+WGK+K+NS P +++L P+    D+NEGFYLY++PFL+EIRK 
Sbjct: 408 TLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPSDPTKDQNEGFYLYKVPFLDEIRKI 467

Query: 481 PKLLDY---KDRSSNPDYTNLIKITSKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLL 537
           P    +    +   N DY NL ++T  I+ YF+L NGY P EF+NP LQ++Y++LHDYLL
Sbjct: 468 PSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLTNGYSPLEFKNPLLQKYYKLLHDYLL 527

Query: 538 QVEQ-SMAEGDEQHQIQKLLEEDDTLRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTY 596
           QVE     E  ++   QK+LEEDDT+RK   IRDKI+ S  S +  +QRL    N+WN  
Sbjct: 528 QVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDKIIKSASSTESHKQRLSANFNIWNDI 587

Query: 597 YVKLQ 601
           Y KL+
Sbjct: 588 YSKLE 592

>Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284W
           (YKU70) - DNA binding protein [contig 39] FULL
          Length = 572

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/585 (46%), Positives = 388/585 (66%), Gaps = 30/585 (5%)

Query: 20  APSA-SYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQXXXXXXXXXXXMSHLVIIRPST 78
           AP+   Y+K+++HEGIIFCIELSK MF++  ++N  VQ           MS ++I  P T
Sbjct: 4   APTVIDYQKFEVHEGIIFCIELSKGMFEKSSDMN-KVQLVEILETLLELMSQVIISLPGT 62

Query: 79  GVGCYIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMK 138
           G+GCY  +C     NAT        GIYEL PL DVNA  MKKL+DL +D+     TL K
Sbjct: 63  GIGCYFFHCGH--ENAT-------GGIYELLPLLDVNARSMKKLNDLLDDITAANTTLEK 113

Query: 139 YFQFDNDENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSPIESEEHEAK 198
            F  D     +   PLE +F  L ++F      + +Y+++KIFLFTDNDSP E+ + + +
Sbjct: 114 QFPLDE----QLSTPLETVFILLQEQFLNQVPGQKAYNNKKIFLFTDNDSPKEAHDSDTR 169

Query: 199 LRIRRLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEY 258
           LR+R++VDD++D +INFTTFFIGT  +PFD SFYSD+LKLGAK  +T+ Q          
Sbjct: 170 LRLRKVVDDLDDCHINFTTFFIGTEQKPFDQSFYSDILKLGAK--KTASQGG-------- 219

Query: 259 SEFDGPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNT 318
           S F+GP+T PI A  IK+R LRKKEIKRI FQ  L LNE  +F + I+GY + SHE+  T
Sbjct: 220 STFNGPSTAPINANLIKARALRKKEIKRIRFQCFLELNEATDFKVSIKGYTVVSHERTGT 279

Query: 319 RYKLVYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEI 378
           +YK VY+   +RKE  S RKYLN NTGE++  D   ++F + +++IE +++E+ K+ ++ 
Sbjct: 280 KYKQVYDHNGLRKEVISHRKYLNANTGEDV-TDSIARVFRFAEIDIEFSEEELAKISKDY 338

Query: 379 SCPEAFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAI 438
           S  ++FLK+IGFR  ++CL++++NI  ++FVVPDES  EGSI+TM+SLFR+L KK K A+
Sbjct: 339 SPNDSFLKLIGFRDTSKCLFFYDNIGNSSFVVPDESVLEGSIKTMSSLFRSLSKKQKSAV 398

Query: 439 IWGKMKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSSNPDYTNL 498
           +WGK+K+NS P +Y+L P+++ D NEGFYL R+PF++E+RKFP +  Y +     ++  +
Sbjct: 399 VWGKLKSNSNPAVYILSPSTSKDLNEGFYLTRVPFVDEVRKFPPIPRYDEELGGKNFEQM 458

Query: 499 IKITSKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGDEQHQIQKLLEE 558
            KIT  ++ YF LR  Y PS+F+NP+LQ+ +++L+DYLLQVE   +       +   L+ 
Sbjct: 459 CKITETLISYFSLRRPYKPSDFKNPTLQKHFKLLYDYLLQVEVDCS----SESVDGALKH 514

Query: 559 DDTLRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKLQEE 603
           DDTL K+ Q+R KI  S  S DP ++RL  Y+  WN+ Y K+  +
Sbjct: 515 DDTLLKLYQVRRKIQESLSSKDPEEERLGTYVKAWNSLYNKISNQ 559

>TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.849
           YMR284W
          Length = 648

 Score =  519 bits (1336), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 273/619 (44%), Positives = 392/619 (63%), Gaps = 46/619 (7%)

Query: 19  TAPSASYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQXXXXXXXXXXXMSHLVIIRPST 78
            + +ASYKK+ IHEGIIFC+ELS EMF+ +PEL    Q              L+I RP+T
Sbjct: 17  ASRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIISRPNT 76

Query: 79  GVGCYIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMK 138
            +G Y+ +      + ++   K+  GIYE F L D+N   MKK++DL EDL H+R  L  
Sbjct: 77  AIGFYLFH------HTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLED 130

Query: 139 YFQFDNDENFKKQVPLEKLFGFLLDKFTLANVDR----NSYHSRKIFLFTDNDSPIESEE 194
            F+FDN     +   LE +F  + ++F   N D       ++ +K+FLFT+ND PIESE 
Sbjct: 131 IFKFDNS----RPTKLEDIFNVVQEQF--LNFDSLHHSKGFNIKKVFLFTNNDKPIESEN 184

Query: 195 HEAKLRIRRLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKL--GAKTRETSDQDYID 252
           +E + ++RR+V+D+N++ I F+TFFI  PD  FDD+FYSD+LKL     T E   +DY D
Sbjct: 185 NETRKKLRRMVNDLNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYD 244

Query: 253 --------------------------AVDDEYSEFDGPNTKPIPAKYIKSRILRKKEIKR 286
                                      ++     F  PNTKPI A  IK RILRK+EI+R
Sbjct: 245 DAGENGNHYLLINDLKDTSKSKTTDRKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRR 304

Query: 287 ITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTRYKLVYEQENVRKEAFSSRKYLNPNTGE 346
           + FQ PLIL+E + FIIGI GY ++S EKP TRYKLVYE ENVRKEAFS RK+L+PNTGE
Sbjct: 305 VRFQCPLILDEASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGE 364

Query: 347 ELQNDEYVKIFPYGDMNIELNDKEVYKVEEEISCPEAFLKIIGFRSKNQCLYYFNNITAT 406
           EL+++++ K++ YGD+NIEL+D+    ++ E      F+K++GFRSK+  L Y+NNI   
Sbjct: 365 ELKDEDFQKVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKA 424

Query: 407 TFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWGKMKTNSKPCLYLLCPTSNSDRNEGF 466
           +FVVPDES YEGSI+TMASLFRTL KK KVAI+WG   +   P +++L P++ ++ NEG 
Sbjct: 425 SFVVPDESSYEGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGL 484

Query: 467 YLYRMPFLEEIRKFPKLLDYKDRSSN--PDYTNLIKITSKIVEYFHLRNGYIPSEFENPS 524
           YL+++PFL+EIR+FP L  Y   ++    +Y  + K+T  I+    LR GY PS + NP+
Sbjct: 485 YLFQVPFLDEIRRFPALTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPA 544

Query: 525 LQRFYRVLHDYLLQVEQSMAEGDEQHQIQKLLEEDDTLRKISQIRDKILSSKKSDDPTQQ 584
           LQ++Y++LHDYLLQ+E +      Q  +++ + EDDTL ++ ++R +I+ S ++ +   Q
Sbjct: 545 LQKYYKILHDYLLQIEDTSLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPELYNQ 604

Query: 585 RLDKYMNLWNTYYVKLQEE 603
           RL K++  WN  + K+ E+
Sbjct: 605 RLSKFIEHWNRVFKKINED 623

>KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 592

 Score =  499 bits (1284), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 248/576 (43%), Positives = 374/576 (64%), Gaps = 30/576 (5%)

Query: 25  YKKYDIHEGIIFCIELSKEMFQEVPELNYTVQXXXXXXXXXXXMSHLVIIRPSTGVGCYI 84
           +++Y+ H+GI+FCI+L+  M+   P+L   +Q           MS LV++ PST VGCYI
Sbjct: 28  WRRYEAHDGIVFCIQLTPTMYLSNPDLGGKIQLLEILDSLNDLMSQLVVVMPSTAVGCYI 87

Query: 85  HYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQFDN 144
           + C+ P       NA+  D +YEL PLRDVN  +MK++SDL ED++ +RI L       +
Sbjct: 88  YNCSHP-------NAE--DNVYELIPLRDVNYKNMKRVSDLLEDIEQDRILLKDEIPIAD 138

Query: 145 DENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSPIESEEHEAKLRIRRL 204
             N    + L  +   + + F      +    ++KIF FTD+D P E    +++ R+R++
Sbjct: 139 PNN---PIELSPVLIKVRETFLQPIEGQKQLTNKKIFFFTDDDKPAEFLNVDSRSRLRKV 195

Query: 205 VDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEYSEFDGP 264
           VDD+ D YINF TFFIG+ D+PFDDS Y+D+LK G+K  E   Q ++ +         GP
Sbjct: 196 VDDLYDYYINFVTFFIGSEDKPFDDSMYADILKWGSKINEA--QSWLSS--------HGP 245

Query: 265 NTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTRYKLVY 324
           +T PI A YIKS++ R KEIKRI F+ PL+L+E A+ ++ + GY + SHE P ++YKLVY
Sbjct: 246 STNPINASYIKSKVKRTKEIKRIKFRCPLMLDERADLVVSVNGYTIVSHEIPGSKYKLVY 305

Query: 325 EQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEISCPEAF 384
              +VR+EA+S R+YL+  TGE + N +  K++ +GD  IEL + E  K++   S  E+F
Sbjct: 306 ANGSVRREAYSHREYLDAETGEAVDNSQLSKVYTFGDEIIELTEDENLKIQSGYSEHESF 365

Query: 385 LKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWGKMK 444
           LK+IGFRS  QCL+Y++NI    FVVP+E  Y GSI+T+ASL+RT+  K K A++WGK++
Sbjct: 366 LKLIGFRSTEQCLHYYDNIDVPAFVVPNEEDYAGSIKTLASLYRTMLFKKKSAMVWGKLR 425

Query: 445 TNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSSNPDYTNLIKITSK 504
            NS P +++L P+S  D N+GFYLY++PF+EE+RK P  L++     + DY  + K+T  
Sbjct: 426 PNSPPSMFVLTPSSKKDYNQGFYLYKVPFMEEVRKLPDFLNHSALIESDDYKVMSKVTET 485

Query: 505 IVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGDEQHQIQKLLEEDDTLRK 564
           ++ +F+L+NGY PS+F NP+LQ+ +++L +YLLQ+E   ++ ++        E D+TL+K
Sbjct: 486 LINFFNLKNGYRPSDFHNPALQKHFKILREYLLQIEVDKSKPED--------EGDETLQK 537

Query: 565 ISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKL 600
           + QI  +I SS KSDD  QQRL KY+ LWN++Y +L
Sbjct: 538 VKQIYARIASSAKSDDVKQQRLVKYLKLWNSFYNRL 573

>Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON}
           complement(1..1542) [1542 nt, 514 aa]
          Length = 514

 Score =  485 bits (1249), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 255/514 (49%), Positives = 345/514 (67%), Gaps = 28/514 (5%)

Query: 8   NEDDEYEPTTTTAPSASYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQXXXXXXXXXXX 67
           N  DE E      PS  Y+KYD+HEGI+FC+ELS++MFQ++PELNY VQ           
Sbjct: 26  NHFDESEVPDGKRPS--YRKYDVHEGIMFCVELSEQMFQQLPELNYKVQLLEILESLLEL 83

Query: 68  MSHLVIIRPSTGVGCYIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFE 127
           MS LVI RP TGVGCYI+ C+K ++N    N           PL DVN   MKK++DL +
Sbjct: 84  MSQLVITRPGTGVGCYIYNCHKDNSNNNIFNFI---------PLEDVNVKAMKKVNDLLD 134

Query: 128 DLQHERITLMKYFQFDNDENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDND 187
           DL +ER TL KYF +D  +    + PLE L     D+          ++++K+FLFTDND
Sbjct: 135 DLSNERTTLTKYFPYDKTQ----RTPLESLLELTQDELVKNVSTPKPFNNKKVFLFTDND 190

Query: 188 SPIESEEHEAKLRIRRLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSD 247
           SP E+ +   K R+RRL DD N+N+I F  FFI   ++PFD SFYSD+ KLG     +SD
Sbjct: 191 SPTEASDKAGKARLRRLFDDNNENFITFVPFFINRENKPFDSSFYSDIFKLGNSENPSSD 250

Query: 248 QDYIDAVDDEYSEFDGPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRG 307
            +          EFDGP+T+PI A YIKSR+LRK+EIKR+ FQ  LILN++  F + I+G
Sbjct: 251 YEI---------EFDGPSTRPISASYIKSRVLRKQEIKRVLFQCSLILNKEMNFTVAIKG 301

Query: 308 YMLYSHEKPNTRYKLVYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELN 367
           Y + S EK  +RYK+VYE E+VRKEAFS RK LN  T EE++ +   K+FPYGD+NIEL+
Sbjct: 302 YSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNCITAEEVK-EGLTKVFPYGDLNIELS 360

Query: 368 DKEVYKVEEEISCPEAFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLF 427
           ++++ KV+E       FLK++GFRS    L+Y+NNIT  +FVVPDES+ +GSIR +ASLF
Sbjct: 361 EEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNITKPSFVVPDESKIDGSIRMLASLF 420

Query: 428 RTLKKKDKVAIIWGKMKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLL--D 485
           RT++KK+KVA++WGK+K NS P L++L  ++ SD NEGF+LYR+PFL+EIRKFP +    
Sbjct: 421 RTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPNEGFFLYRIPFLDEIRKFPVITTSS 480

Query: 486 YKDRSSNP-DYTNLIKITSKIVEYFHLRNGYIPS 518
           +K+ + N  +Y N+ + T  IV YF+L++GYIPS
Sbjct: 481 FKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514

>CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284w HDF1
           high-affinity DNA-binding protein
          Length = 606

 Score =  488 bits (1255), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 251/584 (42%), Positives = 370/584 (63%), Gaps = 28/584 (4%)

Query: 23  ASYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQXXXXXXXXXXXMSHLVIIRPSTGVGC 82
           AS+K+++IHEGI+FCIELS+ MF+   EL+   Q           M  L++ RPST +GC
Sbjct: 29  ASFKRFEIHEGIMFCIELSEHMFEVQDELDGKSQIEVILTSLSELMELLIVTRPSTAIGC 88

Query: 83  YIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQF 142
           Y + C + D+          + I+E  PL D+N   MKK++DL ED+ ++RIT  +Y  +
Sbjct: 89  YFYNCEREDSK---------ESIFEFIPLVDLNVQWMKKVNDLLEDVSNQRITFKEYLNY 139

Query: 143 DNDENFKKQVP--LEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSP-IESEEHEAKL 199
           + D+N K  +P  LEKLF  +L+ F      +  ++S+K+FLFTDND P +ES++    +
Sbjct: 140 NIDQNKKLNIPILLEKLFSLILETFNRNIEGQKEFNSKKVFLFTDNDLPNVESQQRSIDV 199

Query: 200 RIRRLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEYS 259
            ++ ++ D++DN INFT FFI   D+PF+ +FYS VL+        +D+DY       Y 
Sbjct: 200 -LKGILKDIDDNMINFTNFFISKKDKPFNPAFYSKVLR--------NDRDYNSLGSQAYF 250

Query: 260 EFDGPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTR 319
              GP+TKPI    IK RI ++KEI+R+ FQ PL+L+E   F+I I+GY +++HEK + R
Sbjct: 251 ---GPSTKPIGVNDIKERIFQRKEIRRVVFQCPLVLDEGTNFVISIKGYSIFNHEKGSVR 307

Query: 320 YKLVYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEIS 379
           YKLVYE + +RKEAFS RK++NP TGE++   + VKI PYG+  IE+ DK +        
Sbjct: 308 YKLVYENQEIRKEAFSKRKFINPKTGEDVSK-QTVKIIPYGEKEIEMEDKNIANALNVYG 366

Query: 380 CPEAFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAII 439
              A L +IGF +++  L ++NNI  T F+ PDE+  EGS    ASLFRTLKK  KV ++
Sbjct: 367 NTSASLTVIGFLNEDNSLVFYNNIDKTLFITPDENVIEGSFTAFASLFRTLKKLKKVGVV 426

Query: 440 WGKMKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSSNPDYTNLI 499
           WG  K+NS P LYLL P+ + D N+GFYL ++PF++EIRK+P L +        +Y N+ 
Sbjct: 427 WGSTKSNSSPSLYLLWPSKDDDNNQGFYLTKVPFIDEIRKYPTLSNININEEWEEYKNVK 486

Query: 500 KITSKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGDEQHQIQKLLEED 559
           ++T  I+ +F+L++GY   EF NP+L R Y++LHDYLLQVE    + D +    + L ED
Sbjct: 487 ELTQGIISHFNLKSGYHAEEFRNPALNRHYKLLHDYLLQVEIPQDDNDIR---DRYLRED 543

Query: 560 DTLRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKLQEE 603
           DTL KI++IR++I+     DD  ++RL KY+ +WN YY K +E+
Sbjct: 544 DTLLKITKIRERIMKDTTIDDVEKRRLSKYLEVWNIYYRKFKED 587

>AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 576

 Score =  393 bits (1009), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 224/577 (38%), Positives = 337/577 (58%), Gaps = 43/577 (7%)

Query: 27  KYDIHEGIIFCIELSKEMFQEVPELNYTVQXXXXXXXXXXXMSHLVIIRPSTGVGCYIHY 86
           +Y++HEGI+FC+ELS  M++  PEL    Q           M  LV + P TGVGCY   
Sbjct: 27  RYNVHEGIVFCVELSHNMYKPSPELEGKKQLLEILEALLELMEQLVAVMPDTGVGCYFFQ 86

Query: 87  CNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQFDNDE 146
           C   +            GIYELFPLRDVN   MKK+  L E ++  + +L +   +D   
Sbjct: 87  CRHREAK---------QGIYELFPLRDVNVAHMKKVFLLLEGIRTGKRSLEEELPYDG-- 135

Query: 147 NFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSPIESEEHEAKLRIRRLVD 206
             +    L+ +F  + D+F     ++  Y+++KIFLFTDNDSP E E   ++ R+R++VD
Sbjct: 136 --RHPTSLDVVFTSIQDQFLQEVPEQRLYNNKKIFLFTDNDSPPEKESLGSRTRLRKVVD 193

Query: 207 DMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEYSEFDGPNT 266
           D+ND YINF+TFFIGT  RPFD+SFYSD+LKLGA+         + A       +DGP+T
Sbjct: 194 DLNDYYINFSTFFIGTEQRPFDESFYSDILKLGAQ---------VAAEGSSKPLYDGPST 244

Query: 267 KPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTRYKLVYEQ 326
           KPI   YI+SR+LRKKE++R+ +  PL LNE+   ++ ++GY   ++E+P  RY++VY+ 
Sbjct: 245 KPISVSYIRSRVLRKKEVRRLRYSCPLFLNEEQGLVVSVKGYAATTYERPGARYRMVYQH 304

Query: 327 ENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDK-EVYKVEEEISCPEAFL 385
           E+V++EAFS R+YL+P+TGEE   D   K++  GD  ++L D  E           ++FL
Sbjct: 305 EDVQREAFSHRRYLDPDTGEEATED-LCKVYQIGDDCLDLPDDLENLITNFAAPTSDSFL 363

Query: 386 KIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWGKMKT 445
           +++G R+    L Y+NNI   TF+VPD+S Y GS   +ASL RTL+   +  +++GK++ 
Sbjct: 364 RMLGSRTAVAVLPYYNNIHHVTFLVPDDSVYAGSAAVLASLHRTLRASQRAVVLYGKLRA 423

Query: 446 NSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSSNPDYTNLIKITSKI 505
            S P LY L P +    +  F L R+PF EE+RKFP L   +   ++PDY  L KITS+I
Sbjct: 424 TSLPALYALAPAAAPLPDAVFILARLPFQEEVRKFPALSPPQASLASPDYAVLQKITSRI 483

Query: 506 VEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGDEQHQIQKLLEEDDTLRKI 565
           ++   L + Y P++F+NP +   +R+L D+L +  Q                 DDT+ ++
Sbjct: 484 IDLLVLSSPYAPADFKNPVIATHFRLLSDHLFETAQDP-------------RTDDTIARL 530

Query: 566 SQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKLQE 602
            ++       +  DDP + RL KY+  WN +Y + Q+
Sbjct: 531 LRL-----RHRVLDDP-ESRLAKYLRHWNAFYARHQQ 561

>Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABL117C
          Length = 597

 Score =  344 bits (883), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 199/574 (34%), Positives = 322/574 (56%), Gaps = 33/574 (5%)

Query: 27  KYDIHEGIIFCIELSKEMFQEVPELNYTVQXXXXXXXXXXXMSHLVIIRPSTGVGCYIHY 86
           K++  + II CIELS  ++Q   E++   Q           M  L ++ P++ V CY++ 
Sbjct: 17  KHERRQSIIVCIELSSRVYQS-SEISPKAQLAEMLEALLELMKQLAMLLPNSEVCCYVYQ 75

Query: 87  CNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQFDNDE 146
           C +       +N K  DGIYEL PL  VN   + K+S L  D++++++ L     F+  +
Sbjct: 76  CRR-------LNVK--DGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEID 126

Query: 147 NFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSPIESEEHEAKLRIRRLVD 206
                 PL  +   +  +      D   + +++I L T ND P E  + E + + +  ++
Sbjct: 127 G----SPLSSVLAKIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTIN 182

Query: 207 DMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEYSEFDGPNT 266
            + D+  +  TFFI +  RPF+D+FY+D+LK     R   D      +D     +DGPNT
Sbjct: 183 ALYDDSFSIVTFFIHSQTRPFNDTFYADLLK---PLRRPED------LDKNIQYYDGPNT 233

Query: 267 KPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTRYKLVYEQ 326
           KPI  K +K ++L+KKE  +  F+   I+N+  +FII ++G+   + EK   R+K +Y++
Sbjct: 234 KPIEIKELKGKLLQKKEGNKFHFKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQK 293

Query: 327 ENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEISCPEAFLK 386
               ++AFS RK+ N N GE   +    K+F  G +NIE  +++  K+    S  E FL+
Sbjct: 294 GAKPQDAFSHRKFYNANDGEA-ADSRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLE 352

Query: 387 IIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWGKMKTN 446
           +IGFRS ++  +Y+NNI+ +++V+PD++ YEGS +T++ L+ ++ KK K AI+WGK+   
Sbjct: 353 LIGFRSVDKVNFYYNNISTSSYVIPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRI 412

Query: 447 SKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSSN-PDYTNLIKITSKI 505
           + P L+L+      + N+GFYL R+PF+EEIR+FP+ L  K+RS N  +Y  + KIT  I
Sbjct: 413 AHPQLFLMVAMDRKNTNQGFYLVRLPFIEEIRRFPQTLQ-KNRSVNIQEYALMKKITGNI 471

Query: 506 VEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGDEQHQIQKLLEEDDTLRKI 565
           + +F+L++ Y  +EF +P L+ FY  L D LLQ   S     +Q  +   L  D TL K+
Sbjct: 472 IAFFNLKSSYRAAEFPSPVLKSFYTTLSDKLLQKSLS-----DQWGMGFKLSNDITLGKV 526

Query: 566 SQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVK 599
             +R+  L +K S +  Q  L KYM  WNTYY K
Sbjct: 527 QHLRE--LINKSSQNMEQPILAKYMKYWNTYYNK 558

>ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 602

 Score =  259 bits (663), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 174/577 (30%), Positives = 289/577 (50%), Gaps = 60/577 (10%)

Query: 29  DIHEGIIFCIELSKEMFQEVPELNYTVQXXXXXXXXXXXMSHLVIIRPSTGVGCYIHYCN 88
           D ++ I+ CIELS+ +      L                +  L+I++P++ VGC      
Sbjct: 25  DRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCL----- 79

Query: 89  KPDNNATEVNAKHI-DGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQFDNDEN 147
                 T  N +   DGI E FPLR ++A+ ++ +SD   DL+ E   + ++F F     
Sbjct: 80  ------TFRNGRRAEDGIVEAFPLRPLDANYVRNISDCVADLE-ETGMVGQHFPF----- 127

Query: 148 FKKQVPLEKLFGFLLDKFTLANVDR-----NSYHSRKIFLFTDNDSPIESEEHEAKLRIR 202
               VP        LD   LA  DR           +IFL TD D+P+E  +     +++
Sbjct: 128 -TATVPAS------LD-VMLAASDRYFTEDTQNADNRIFLVTDVDTPVEFTDPIRLEKVQ 179

Query: 203 RLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEYSEFD 262
             +  +    I+ TTFF+ T    F+DS Y+++LK    TRE             +    
Sbjct: 180 ARLLSLYRRRIDITTFFLHTEHAAFNDSSYAEILK----TRE-------------WGIPG 222

Query: 263 GP-NTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTRYK 321
            P +T P+    ++ ++L +K++ R  F  PL++N+ A+ ++ + GY+  +HE+P TRYK
Sbjct: 223 APQSTSPLSICKLREKMLSQKDLNRAYFSCPLVINKTADLVVSVAGYVATTHERPGTRYK 282

Query: 322 LVYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEISCP 381
            + + +   K     RKY   +  + +++ +   ++  G   IE+ D E+ K+    S  
Sbjct: 283 YIVKHDGRTKSVHQCRKYKTVDNEKYIRDADRSSVYWIGGAGIEVTDAELRKMTRGCSKY 342

Query: 382 EAFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWG 441
           E+FL+I+GFR+ N    Y++NI    +++P E  + GS + +ASL R++ +K K AI+WG
Sbjct: 343 ESFLEILGFRAINTAAPYYSNIGRAYYILPRELPFSGSAKVLASLNRSMFEKGKAAIVWG 402

Query: 442 KMKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSSNPDYTNLIKI 501
           ++K    P L+ L P+          L R+PF+EE+R FP  LD +DR  +     L+K 
Sbjct: 403 QLKAGFHPTLFALIPSDGE--TCALRLVRIPFIEEVRCFPT-LDGEDRLFHTREYELVKT 459

Query: 502 TSK-IVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGDEQHQIQKLLEEDD 560
            S+ ++ +F LR  Y PS+  NP L+ FY  L+      EQS     +  ++Q L E D 
Sbjct: 460 VSQNLIRHFSLRTSYRPSDIRNPLLRNFYSTLYH-----EQSQDAKRKMPELQYLPESDS 514

Query: 561 TLRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYY 597
           TL K+  +RD+I +S   D+P    + +Y+N WN YY
Sbjct: 515 TLHKVQLVRDRIENSIIHDEPPI--ISEYINCWNIYY 549

>ZYRO0G02486g Chr7 (190261..192108) [1848 bp, 615 aa] {ON} similar
           to uniprot|Q0P727 Saccharomyces paradoxus HDF2 HDF2
           protein
          Length = 615

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 66/138 (47%), Gaps = 12/138 (8%)

Query: 385 LKIIGFRSKNQCLYYFNNITATTFVVPDESQYEG--SIRTMASLFRTLKKKDKVAIIWGK 442
           + I+GF  +     +F + + + F+  D ++Y G   +  +++L   LK+ +++AI+   
Sbjct: 334 MDILGFIDQKALPRHFLH-SESRFITAD-TRYGGVQDVVALSALVDALKESNQLAIVRFV 391

Query: 443 MKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIR--KFPKLLDYKDRSS-----NPDY 495
            K  S   + +LCP    D N      R+PF E+ R   FP+L++    S      +   
Sbjct: 392 AKPTSDVQVGVLCPIHVED-NHTLVYCRLPFAEDQRVSDFPRLVNRTTTSGKKIEQDKSQ 450

Query: 496 TNLIKITSKIVEYFHLRN 513
            N+  + SK ++ F + N
Sbjct: 451 GNIDSMMSKYIDAFDMDN 468

>SAKL0E03652g Chr5 complement(296485..298365) [1881 bp, 626 aa] {ON}
           similar to uniprot|Q04437 Saccharomyces cerevisiae
           YMR106C YKU80 Forms heterodimer with Yku70p known as Ku,
           binds chromosome ends and is involved in maintaining
           normal telomere length and structure, in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 626

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 69/165 (41%), Gaps = 25/165 (15%)

Query: 382 EAFLKIIGFRSKNQCLYYFNNITATTFVVPDESQ-YEGSIRTMASLFRTLKKKDKVAIIW 440
           E  L I GF  +     Y+ N + +TF+V D  Q        +++L  +L K +K AI  
Sbjct: 324 EPGLDIRGFLDRKDFPRYYLN-SESTFIVTDTRQGSRADYMALSALVDSLIKLEKFAIAR 382

Query: 441 GKMKTNSKPCLYLLCPTSNSDRN-------------EGFYLYRMPFLEEIRK--FPKLLD 485
              + NS+  + LLCP    D N                 L R+PF E+ R   FPK L 
Sbjct: 383 YVQRKNSEVQMCLLCPILIDDTNGMKRKLGREEQHTRALILSRLPFAEDERSPDFPK-LS 441

Query: 486 YKDRSSNP----DYTNLIKITSKIVEYFHLRNGYIPSE---FENP 523
           Y+  +S      D TNL    S  ++   L +    SE   + NP
Sbjct: 442 YQRTTSGKTLVEDTTNLDSQMSMFIDSMDLDDNTGSSESSWYRNP 486

>KLTH0A01298g Chr1 complement(117599..118156) [558 bp, 185 aa] {ON}
           some similarities with uniprot|Q12322 Saccharomyces
           cerevisiae YOL114C Hypothetical ORF
          Length = 185

 Score = 35.8 bits (81), Expect = 0.17,   Method: Composition-based stats.
 Identities = 38/123 (30%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 477 IRKFP-KLLDYK-DRSSNPDYTNLIKITSKIVEYFHL--RNGYIPSEFENPSLQRFYRVL 532
           +R  P K   Y  DRSS P   N+ K+ SK     H   +  +IP E  +  +QR +R L
Sbjct: 45  VRALPEKAFSYNFDRSSGPGGQNVNKVNSKCTLTIHAFSKCDWIPQEVRDQLVQRRFRYL 104

Query: 533 HD----YLLQVEQSMA-EGDEQHQIQKLLEEDDT---LRKISQIRDKILSSKKSDDPTQQ 584
                  ++Q +QS + E + Q  ++KL+ E  T     K +Q  D    S      +QQ
Sbjct: 105 SSSRDCVVIQSDQSRSRETNRQICLEKLVSELKTTCWFPKEAQPEDLQRWSAIRRKTSQQ 164

Query: 585 RLD 587
           RL+
Sbjct: 165 RLE 167

>TDEL0A02190 Chr1 (394031..395911) [1881 bp, 626 aa] {ON} Anc_2.444
           YMR106C
          Length = 626

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 53/108 (49%), Gaps = 12/108 (11%)

Query: 385 LKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMAS---LFRTLKKKDKVAIIWG 441
           + I GF  + +   YF N + + F++ D     GS+  + S   L  +L ++DK+ +   
Sbjct: 342 IDIRGFLERKRLPRYFLN-SESRFILAD--TRSGSVADIVSFNVLVDSLSEQDKLIVARF 398

Query: 442 KMKTNSKPCLYLLCPT----SNSDRNEGFYLYRMPFLEE--IRKFPKL 483
             K N++  + ++CP      + D+     L R+PF E+  +  FP+L
Sbjct: 399 VAKPNAEVQMCMMCPMLVNDEHGDKIRTLILNRLPFAEDERVASFPRL 446

>TPHA0G02460 Chr7 (504893..506773) [1881 bp, 626 aa] {ON} Anc_2.444
           YMR106C
          Length = 626

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 52/110 (47%), Gaps = 6/110 (5%)

Query: 382 EAFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWG 441
           +A + I GF ++     YF N  +        +  +  + +M +L   L +  K+AI+  
Sbjct: 348 KANIDIRGFMNETSLPRYFLNSESKFIFFDSRNGSKSDVYSMYALVDVLMENKKIAIVRY 407

Query: 442 KMKTNSKPCLYLLCPTSN--SDRN--EGFYLYRMPFLEE--IRKFPKLLD 485
             K N +  +  L P  +  SDRN    F L R+PF E+  +  FPKL++
Sbjct: 408 VQKHNGEVEMCALYPMVSKISDRNIVRYFVLNRLPFAEDERVSDFPKLVN 457

>TBLA0B09020 Chr2 complement(2138426..2140471) [2046 bp, 681 aa]
           {ON} Anc_2.444 YMR106C
          Length = 681

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 53/127 (41%), Gaps = 31/127 (24%)

Query: 385 LKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMAS---LFRTLKKKDKVAIIWG 441
           L I GF  +     ++  I+ +TF+V D     GS   M S   L   L +  K+AI   
Sbjct: 376 LDITGFMDEESLPRHYL-ISESTFIVADSRA--GSTADMMSFEILVDVLYENKKIAIARY 432

Query: 442 KMKTNSKPCLYLLCP------------------TSNSDRNE-----GFYLYRMPFLEE-- 476
             K N+   + +LCP                  + + D NE     G  L R+PF E+  
Sbjct: 433 VQKNNTNAQMVMLCPVLVDHSDILSEQDIQKYRSIHDDDNEEVNMRGLILSRLPFAEDER 492

Query: 477 IRKFPKL 483
           + +FPKL
Sbjct: 493 VSEFPKL 499

>TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1011

 Score = 34.7 bits (78), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 55/96 (57%), Gaps = 8/96 (8%)

Query: 483 LLDYKDRSSNPDYTNLIKITSKIVE--YFHLRNGYIPS-EFENPSLQRFYRVLHDYLLQV 539
           +L  KD++ + D +  IKI  K +E  YF    G++   ++  P+L  +  VL+  LL++
Sbjct: 444 ILAMKDKT-DGDVSGAIKINGKQLEKSYFRKLIGFVDQYDYLFPTLSVYETVLNSALLRL 502

Query: 540 EQSMAEGDEQHQIQKLLEEDDTLRKISQIRDKILSS 575
             SM+   +Q ++ ++L+E     +I +I+D+++ +
Sbjct: 503 PSSMSFAAKQLRVLQVLDE----LRILEIKDRLIGN 534

>YMR106C Chr13 complement(478301..480190) [1890 bp, 629 aa] {ON}
           YKU80Subunit of the telomeric Ku complex
           (Yku70p-Yku80p), involved in telomere length
           maintenance, structure and telomere position effect;
           relocates to sites of double-strand cleavage to promote
           nonhomologous end joining during DSB repair
          Length = 629

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 66/281 (23%), Positives = 113/281 (40%), Gaps = 49/281 (17%)

Query: 231 FYSDVLKLGAKTRETSDQDYIDAVDDEYSEFDGPNTKPIPAKYIKSRILRKKEIKRITFQ 290
            +S  L+LGA    T   +   ++ DE         +  PA    S + RK  ++    Q
Sbjct: 211 VFSGELRLGADILSTQTSNPSGSMQDENCLC--IKVEAFPATKAVSGLNRKTAVEVEDSQ 268

Query: 291 SPLILNEDAEFIIGIRGYMLYS-HEKPNTRYKLVYEQENVRKEAFSSRKYLNPNTGEELQ 349
                    E  +G++  + Y  H + N        ++NV ++  S   Y+ P T   + 
Sbjct: 269 K-------KERYVGVKSIIEYEIHNEGN--------KKNVSEDDQSGSSYI-PVT---IS 309

Query: 350 NDEYVKIFPYGD----MNIELNDKEVYKVEEEISCPEAF--LKIIGFRSKNQCLYYFNNI 403
            D   K + YG     +   L D+ VY         E+F  L + GF ++     YF   
Sbjct: 310 KDSVTKAYRYGADYVVLPSVLVDQTVY---------ESFPGLDLRGFLNREALPRYFLT- 359

Query: 404 TATTFVVPDES-QYEGSIRTMASLFRTLKKKDKVAIIWGKMKTNSKPCLYLLCPT----S 458
           + ++F+  D     +  +   ++L   + +  K+A+     K +S+  +  LCP     S
Sbjct: 360 SESSFITADTRLGCQSDLMAFSALVDVMLENRKIAVARYVSKKDSEVNMCALCPVLIEHS 419

Query: 459 NSDRNEGFY----LYRMPFLEE--IRKFPKLLDYKDRSSNP 493
           N +  + F     L R+PF E+  +  FPKLLD    S  P
Sbjct: 420 NINSEKKFVKSLTLCRLPFAEDERVTDFPKLLDRTTTSGVP 460

>Kwal_26.7624 s26 (447231..449039) [1809 bp, 602 aa] {ON} YMR106C
           (YKU80) - Exhibits DNA binding activity on its own,
           associates with Hdf1p to form major DNA end-binding
           complex [contig 55] FULL
          Length = 602

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 61/147 (41%), Gaps = 25/147 (17%)

Query: 385 LKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWGKMK 444
           L + GF  K     ++ N  +T  V   +          A+L  ++ K +K A+     K
Sbjct: 323 LDLRGFLDKEDIPRHYLNSESTFIVASTKDGSRADFLAFAALVDSMIKLNKFAVARYVQK 382

Query: 445 TNSKPCLYLLCP-TSNSDRNE---------GFYLYRMPFLEE--IRKFPKLLDYKDRSSN 492
           TNS+  + +LCP      R E            L R+PF E+  +  +PKL     RSS 
Sbjct: 383 TNSEVQMCVLCPLLVKKKRRELEDSEPYYRALVLNRLPFAEDERVSDYPKL----SRSSG 438

Query: 493 -PDYTNLIKITSKIVEYFHLRNGYIPS 518
            P+        +KIVE   L + +I S
Sbjct: 439 MPE--------AKIVETDALMDDFIDS 457

>Kpol_1018.159 s1018 (408890..410779) [1890 bp, 629 aa] {ON}
           (408890..410779) [1890 nt, 630 aa]
          Length = 629

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 53/123 (43%), Gaps = 9/123 (7%)

Query: 385 LKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWGKMK 444
           + I GF  K+    Y+ +  +       +      + +M +    + + DKVAI+    K
Sbjct: 348 IDIRGFLDKDLLPRYYLSSESRVIFADTKMGTLADVVSMGAFVDVMIENDKVAIVRYVQK 407

Query: 445 TNSKPCLYLLCP----TSNSDRNEG---FYLYRMPFLEE--IRKFPKLLDYKDRSSNPDY 495
            NS+  +  L P     +  D +E    F L R+PF E+  +  FPKL +    S    +
Sbjct: 408 PNSEVEMCALIPHIFKQNIGDESEDLRVFILNRLPFAEDERVSDFPKLTERYSTSGKKLH 467

Query: 496 TNL 498
           TN+
Sbjct: 468 TNI 470

>CAGL0K08602g Chr11 complement(867311..868363) [1053 bp, 350 aa]
           {ON} some similarities with uniprot|P34252 Saccharomyces
           cerevisiae YKL108w SLD2 chromosomal DNA replication
           protein
          Length = 350

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 107 ELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQFDNDEN 147
           E+ P+R  N  D+   SD   + +  R  +++  QFD DEN
Sbjct: 230 EIVPIRHGNGQDIGDESDEVPEKKKRRTGVLRRLQFDEDEN 270

>ZYRO0F13596g Chr6 complement(1120386..1121669) [1284 bp, 427 aa]
           {ON} highly similar to uniprot|P53312 Saccharomyces
           cerevisiae YGR244C LSC2 Beta subunit of succinyl-CoA
           ligase which is a mitochondrial enzyme of the TCA cycle
           that catalyzes the nucleotide-dependent conversion of
           succinyl-CoA to succinate
          Length = 427

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 28/47 (59%)

Query: 105 IYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQFDNDENFKKQ 151
           +Y+++  RD    ++  LS++  D  H+ + +   F FD++ +F++Q
Sbjct: 215 LYKIYTERDATQIEINPLSEVIGDANHKVMCMDAKFGFDDNASFRQQ 261

>Suva_7.539 Chr7 complement(933213..934496) [1284 bp, 427 aa] {ON}
           YGR244C (REAL)
          Length = 427

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 34/60 (56%)

Query: 92  NNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQFDNDENFKKQ 151
           ++A +  AK +  +Y++F  RD    ++  LS++  D  H+ +     F FD++ +F+++
Sbjct: 208 SDAQDEAAKTVSNLYKIFMERDATQVEINPLSEIEHDPNHKVMCTDAKFGFDDNASFRQE 267

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,049,035
Number of extensions: 3712712
Number of successful extensions: 13035
Number of sequences better than 10.0: 76
Number of HSP's gapped: 13380
Number of HSP's successfully gapped: 76
Length of query: 620
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 504
Effective length of database: 40,180,143
Effective search space: 20250792072
Effective search space used: 20250792072
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)