Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0K003508.848ON50450426820.0
YMR283C (RIT1)8.848ON51351315180.0
NCAS0C003508.848ON48650315070.0
Skud_13.4558.848ON49451314860.0
Suva_13.4728.848ON51051414810.0
Smik_13.4968.848ON49450514500.0
Kpol_1068.28.848ON49150313960.0
TDEL0A079708.848ON48950413890.0
TPHA0I003008.848ON49351013600.0
KNAG0J002208.848ON49950813570.0
SAKL0D01276g8.848ON50248713510.0
KAFR0B039808.848ON48350513470.0
ZYRO0G14344g8.848ON47251413031e-176
Kwal_27.102198.848ON50050113011e-176
Ecym_46238.848ON48050512971e-175
KLTH0C03696g8.848ON47449412961e-175
KLLA0D01386g8.848ON48950512601e-170
AFR451C8.848ON4084369671e-126
TDEL0G039606.75aON26051741.4
CAGL0F04851g3.502ON59282714.7
KLTH0E07634g4.104ON54442705.3
NDAI0F046401.125ON67295689.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0K00350
         (504 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON...  1037   0.0  
YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON} ...   589   0.0  
NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848...   585   0.0  
Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {...   577   0.0  
Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {...   575   0.0  
Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {...   563   0.0  
Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..381...   542   0.0  
TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON} Anc_8...   539   0.0  
TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}...   528   0.0  
KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.84...   527   0.0  
SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar ...   525   0.0  
KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {O...   523   0.0  
ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]...   506   e-176
Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283...   505   e-176
Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar...   504   e-175
KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} simila...   503   e-175
KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} simila...   489   e-170
AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}...   377   e-126
TDEL0G03960 Chr7 (718226..719008) [783 bp, 260 aa] {ON}                33   1.4  
CAGL0F04851g Chr6 complement(488804..490582) [1779 bp, 592 aa] {...    32   4.7  
KLTH0E07634g Chr5 (697160..698794) [1635 bp, 544 aa] {ON} simila...    32   5.3  
NDAI0F04640 Chr6 (1122327..1124345) [2019 bp, 672 aa] {ON} Anc_1...    31   9.1  

>NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON}
           Anc_8.848 YMR283C
          Length = 504

 Score = 1037 bits (2682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/504 (100%), Positives = 504/504 (100%)

Query: 1   MDQSYFFDSLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLW 60
           MDQSYFFDSLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLW
Sbjct: 1   MDQSYFFDSLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLW 60

Query: 61  YVSPSQYNQTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDAL 120
           YVSPSQYNQTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDAL
Sbjct: 61  YVSPSQYNQTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDAL 120

Query: 121 SKTIPIWCAVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDK 180
           SKTIPIWCAVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDK
Sbjct: 121 SKTIPIWCAVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDK 180

Query: 181 LEIINANELISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAPENIIPIVLCT 240
           LEIINANELISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAPENIIPIVLCT
Sbjct: 181 LEIINANELISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAPENIIPIVLCT 240

Query: 241 ISYQAQDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRH 300
           ISYQAQDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRH
Sbjct: 241 ISYQAQDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRH 300

Query: 301 MIEMKIKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVV 360
           MIEMKIKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVV
Sbjct: 301 MIEMKIKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVV 360

Query: 361 ILSETVTLNSDDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNGKPILI 420
           ILSETVTLNSDDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNGKPILI
Sbjct: 361 ILSETVTLNSDDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNGKPILI 420

Query: 421 CCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTTL 480
           CCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTTL
Sbjct: 421 CCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTTL 480

Query: 481 ISHLEGRNVNPSRATLNSVNDYLM 504
           ISHLEGRNVNPSRATLNSVNDYLM
Sbjct: 481 ISHLEGRNVNPSRATLNSVNDYLM 504

>YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON}
           RIT12'-O-ribosyl phosphate transferase, modifies the
           initiator methionine tRNA at position 64 to distinguish
           it from elongator methionine tRNA
          Length = 513

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/513 (58%), Positives = 378/513 (73%), Gaps = 28/513 (5%)

Query: 1   MDQSYFFDSLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLW 60
           MD++ +  SLSQINKDI+KE KS+RNRLQSILLDN+FL D +I  FP+YP+IPNERCGLW
Sbjct: 20  MDENIYL-SLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLW 78

Query: 61  YVSPSQYNQTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDAL 120
           Y +PS + QTSYFKSTDGH NQWDFSTRRLNFHLLETI  +KGI I+DSTRRGKKIPDAL
Sbjct: 79  YCNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDAL 138

Query: 121 SKTIPIWCAVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDK 180
           SKT+PIWCAVLN +ML+E +     V ++  L++PP TVPKSEYD I +KIP LV KL K
Sbjct: 139 SKTVPIWCAVLNTLMLQETEKN---VAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQK 195

Query: 181 LEIINANELISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAPE--NIIPIVL 238
           L II++ +L   F GKLLRP+W++PGSS+L  S D FTGE  +  AWE PE  NIIPI+L
Sbjct: 196 LNIIDSKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIIL 255

Query: 239 CTISYQAQDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYV 298
           CT+SYQAQDG+DKRYGFTYVQGAADDHELWS GL   +FW+HI YLG+ ++SDD+L +Y+
Sbjct: 256 CTVSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYI 315

Query: 299 RHMIEMKIKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSL 358
             +   K+++      + ++D +F N +D IT EISLGK+ + + I K++  + K  +  
Sbjct: 316 MDLAAAKLRNQCYIQDKGSLDEVFGN-IDKITNEISLGKVSSGLTINKNLKQKLKSEYGK 374

Query: 359 VVILSETVTLNSDDKDEQQSDS---VKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNG 415
           V+I S +VT+  D  DE++S +   + IYKL SG KKSSK LR+  P+I+  ++   TN 
Sbjct: 375 VIIFSNSVTVAEDTDDEEESGTDPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNR 434

Query: 416 ----KPILICCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKT 471
               KP+LICCNTGTD+SIG+IL+ILC  Y       + W+ L  E  D       + K 
Sbjct: 435 DEKIKPMLICCNTGTDMSIGVILSILCTKY------TEEWM-LTSELPD-------ISKL 480

Query: 472 IIRKNLTTLISHLEGRNVNPSRATLNSVNDYLM 504
           I+RK+LT LISHL+GRNVNPSRATLNSVN +LM
Sbjct: 481 IVRKHLTKLISHLKGRNVNPSRATLNSVNSFLM 513

>NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848
           YMR283C
          Length = 486

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/503 (59%), Positives = 370/503 (73%), Gaps = 25/503 (4%)

Query: 6   FFDSLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLWYVSPS 65
             +SL QINKDI+KE KS+RNRLQSILLDN+FLNDE++  FP++PIIPNERCGLWYV P 
Sbjct: 5   LLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWYVPPE 64

Query: 66  QYNQTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDALSKTIP 125
            + QTSYFKSTDGHTNQWDFSTRRLNFHL  T+  S GI I+DSTRRGKKIPDALSKTIP
Sbjct: 65  DFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALSKTIP 124

Query: 126 IWCAVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDKLEIIN 185
           IWCAVLNYIML   +G +DI  + D LF PP T+ K+EYD I ++IP LV KL KL+I++
Sbjct: 125 IWCAVLNYIMLLSQRGSDDI-DITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLDIVD 183

Query: 186 ANELISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAPE--NIIPIVLCTISY 243
            NEL     GKLLRP W+YPGSS+L SSRDVFTGE T   +W  P+  NIIPI+LCTISY
Sbjct: 184 GNELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGD-SWNVPQHANIIPIILCTISY 242

Query: 244 QAQDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRHMIE 303
           +AQDG DKR+GFTYVQGAADDHELWS GLTP LFWSHIN+  N  H+++++ ++V  +++
Sbjct: 243 RAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETLVQ 302

Query: 304 MKIKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVVILS 363
              +D A +  ++  DA   + +D +TP++ LGKI +N+ I K +  +    F+L +ILS
Sbjct: 303 E--QDDAGEQSDIN-DAF--DYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILS 357

Query: 364 ETVTLNSDDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNG--KPILIC 421
           E V L+  D +E    S  I+KL SGSKKSSK LR +I +I  ++   + N   KPILIC
Sbjct: 358 ENVELDPVD-NENLPISTHIFKLQSGSKKSSKLLRNKIEEIIGLVESQMNNALNKPILIC 416

Query: 422 CNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTTLI 481
           CNTGTD+SIGI+L +LC+NY       + W+  E       V  KRLDK +IRK LT LI
Sbjct: 417 CNTGTDMSIGILLALLCRNY------SERWVLGE-------VEAKRLDKIMIRKQLTRLI 463

Query: 482 SHLEGRNVNPSRATLNSVNDYLM 504
           SHLEGR +N SRATLNSVN+YLM
Sbjct: 464 SHLEGRTINTSRATLNSVNNYLM 486

>Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/513 (57%), Positives = 374/513 (72%), Gaps = 28/513 (5%)

Query: 1   MDQSYFFDSLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLW 60
           MD+     SLSQINKD+++E KS+RNRLQSILLDN+FL + +++ FP++PI+PNERCGLW
Sbjct: 1   MDKEILL-SLSQINKDVRRENKSVRNRLQSILLDNKFLQERVVSIFPHFPIVPNERCGLW 59

Query: 61  YVSPSQYNQTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDAL 120
           Y  PS + +TSYFKSTDGH NQWDFSTRRLNFHLLETI   KGI IIDSTRRGKKIPD+L
Sbjct: 60  YCEPSTFKRTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDKKGIIIIDSTRRGKKIPDSL 119

Query: 121 SKTIPIWCAVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDK 180
           SKT+PIWCAVLN IML++ K   DI KV   L+VPP TVPKSEYD I +KIP LV KL K
Sbjct: 120 SKTVPIWCAVLNTIMLQKEKEDVDIDKV---LYVPPETVPKSEYDMIKRKIPELVAKLKK 176

Query: 181 LEIINANELISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAP--ENIIPIVL 238
           L ++++ +L   F GK+LRP+W++PGSS+L+ S D FTGE  +   WEAP  +NIIPI+L
Sbjct: 177 LNVVDSEKLNDLFMGKILRPIWVHPGSSLLNHSVDYFTGELKEQETWEAPKDQNIIPIIL 236

Query: 239 CTISYQAQDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYV 298
           CT+SYQAQDG+DKRYGFTYVQGAADDHELWS GL  E+FWSH++YLG+   SDD+L +Y+
Sbjct: 237 CTVSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSEMFWSHVDYLGDTDKSDDQLHDYI 296

Query: 299 RHMIEMKIKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSL 358
             ++  K+++  +   + ++D IF N +D IT EISLGK+   + I+  +  E K  +  
Sbjct: 297 TDLVAKKLENQLSIKDKGSLDEIFGN-IDIITNEISLGKVIQGLTISVKLKQELKLRYDK 355

Query: 359 VVILSETVTLNSDDKDEQQSDS---VKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTN- 414
           V++ S++V +  D   E++S     + ++KL SG KKSSK LRT  P+I+E ++    N 
Sbjct: 356 VIVFSDSVAITEDTDHEEESSPNSFISVFKLQSGDKKSSKTLRTIFPRIHEELQSAFANR 415

Query: 415 ---GKPILICCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKT 471
               KPILICCNTGTD+SIG+IL+ILC  Y  D      W +L  E  + N       K 
Sbjct: 416 DGGTKPILICCNTGTDMSIGVILSILCTKYTED------W-KLTPELPEVN-------KI 461

Query: 472 IIRKNLTTLISHLEGRNVNPSRATLNSVNDYLM 504
           IIR++LT LISHL GRNVNPSRATLNSVN +LM
Sbjct: 462 IIRRHLTKLISHLRGRNVNPSRATLNSVNSFLM 494

>Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {ON}
           YMR283C (REAL)
          Length = 510

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/514 (57%), Positives = 373/514 (72%), Gaps = 28/514 (5%)

Query: 1   MDQSYFFD-SLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGL 59
           MD+      SLSQINKD++KE KS+RNRLQSILLDN FL D ++  FP +PI+PNERCGL
Sbjct: 15  MDEEILLSLSLSQINKDVRKENKSVRNRLQSILLDNRFLRDRVLPIFPRFPIVPNERCGL 74

Query: 60  WYVSPSQYNQTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDA 119
           WY  PS + QTSYFKSTDGH NQWDFSTRRLNFHLLE I ++KGI I+DSTRRGKKIPDA
Sbjct: 75  WYCEPSSFEQTSYFKSTDGHVNQWDFSTRRLNFHLLEIIQENKGIIIVDSTRRGKKIPDA 134

Query: 120 LSKTIPIWCAVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLD 179
           LSKT+PIWCAVLN IML+E +   DI KV   L+VPP TVPKSEYD I +KIP LV+KL 
Sbjct: 135 LSKTVPIWCAVLNTIMLQETEENVDIDKV---LYVPPETVPKSEYDMIKRKIPELVDKLQ 191

Query: 180 KLEIINANELISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAPE--NIIPIV 237
           KL  I++  L   F GK+LRP+W++PGSS+L+ S D FTGE  +   WE+PE  NIIPI+
Sbjct: 192 KLNAIDSKTLNKLFKGKILRPIWVHPGSSLLNHSVDCFTGEIEEQEIWESPEDQNIIPII 251

Query: 238 LCTISYQAQDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEY 297
           LCT+SYQAQDG+DKRYGFTYVQGAADDHELWS GL  ++FWSHI+YLG+  +SDD+L  Y
Sbjct: 252 LCTVSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWSHIDYLGDTNNSDDQLCAY 311

Query: 298 VRHMIEMKIKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFS 357
           +  +I  K++   +   +  +D IF N +D IT EISLGK+   + I + +  E K  + 
Sbjct: 312 ITDLIGKKLEYQLSIQDKGNLDDIFEN-IDKITNEISLGKVIQGLTINEKLEKELKVHYE 370

Query: 358 LVVILSETVTL--NSDDKDEQQSDS-VKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTN 414
            V+I S +V +  ++D  +E ++DS + +YKL SG KKSSK LR+  P I++ ++    N
Sbjct: 371 KVIIFSNSVAIAAHADSVEESRTDSFISVYKLQSGDKKSSKALRSTFPMIHQEVQPVFAN 430

Query: 415 G----KPILICCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDK 470
                KPIL+CCNTGTD+SIG+IL+ILC  Y       + W+        S +PV  ++K
Sbjct: 431 PAKGMKPILVCCNTGTDMSIGVILSILCAKY------NEEWILT------SELPV--VNK 476

Query: 471 TIIRKNLTTLISHLEGRNVNPSRATLNSVNDYLM 504
            IIRK+LT LISHL GRNVNPSRATLNSVN +LM
Sbjct: 477 IIIRKHLTKLISHLHGRNVNPSRATLNSVNSFLM 510

>Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/505 (57%), Positives = 365/505 (72%), Gaps = 27/505 (5%)

Query: 9   SLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLWYVSPSQYN 68
           SL++IN+D++KE KS+RNRLQSILLDN+FL D +I  FP +P++PNERCG+WY  PS Y 
Sbjct: 8   SLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWYCKPSTYK 67

Query: 69  QTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDALSKTIPIWC 128
           QTSYFKSTDGH NQWDFSTRRLNFHLLETI  +KGI I+DSTRRGKKIPDALSKT+PIWC
Sbjct: 68  QTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSKTVPIWC 127

Query: 129 AVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDKLEIINANE 188
           AVLN IML+E +   DI K    L++PP TVPKSEYD I +KIP LV KL KL II++ +
Sbjct: 128 AVLNTIMLQETEENFDIDK---ALYLPPETVPKSEYDMIKRKIPELVTKLRKLNIIDSKK 184

Query: 189 LISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAPE--NIIPIVLCTISYQAQ 246
           L   F GK+LRP+W++PGSS+L+ S D FTGE  +   WE PE  NIIPI+LCT+SYQAQ
Sbjct: 185 LNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVSYQAQ 244

Query: 247 DGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRHMIEMKI 306
           DG+DKRYGFTYVQGAADDHELWS GL  ++FW+H+ +L +  +SDD+L +Y+  ++  K+
Sbjct: 245 DGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLVAKKL 304

Query: 307 KDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVVILSETV 366
           K       +  +D IF   VD IT EISLGK+   + I + +  E K  +  V+ILS++V
Sbjct: 305 KSQMYIQDKGGLDEIF-GKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILSDSV 363

Query: 367 TLNSDDKDEQQSDS---VKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNG----KPIL 419
           T+  D    + + S   + +YKL SG KKSSK LR+ +PKI+E +     N     +P+L
Sbjct: 364 TVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEEMRPML 423

Query: 420 ICCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTT 479
           +CCNTGTD+SIG+IL+ILC  Y       + W+ L +E  + N       K IIRK+LT 
Sbjct: 424 VCCNTGTDMSIGVILSILCTKY------TEEWM-LTQELPEVN-------KIIIRKHLTK 469

Query: 480 LISHLEGRNVNPSRATLNSVNDYLM 504
           LISHL GRNVNPSRATLNSVN +LM
Sbjct: 470 LISHLHGRNVNPSRATLNSVNSFLM 494

>Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..3818)
           [1476 nt, 492 aa]
          Length = 491

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/503 (54%), Positives = 358/503 (71%), Gaps = 30/503 (5%)

Query: 9   SLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLWYVSPSQYN 68
           S++QI+KDIKKEYKSL+NR+QSILLD  FL D +I  FP +P+IPNERCGLWY +P  + 
Sbjct: 10  SINQIHKDIKKEYKSLKNRIQSILLDARFLEDTVIPFFPEFPVIPNERCGLWYCNPKLFE 69

Query: 69  QTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDALSKTIPIWC 128
           QTSYFKSTDGH NQWDFSTRRLNFHLL T+A++ GI I+DSTRRGKKIPDALSKT+PIWC
Sbjct: 70  QTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPIWC 129

Query: 129 AVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDKLEIINANE 188
           AVLN +ML  +   ND       LFVPP+TVP SEY  IL+K+P L+E+L+KL II+ ++
Sbjct: 130 AVLNSLMLESVDQLND--DYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSD 187

Query: 189 LISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAPEN--IIPIVLCTISYQAQ 246
           L   F+GKLLRP+WI+PGSS+L S+ D+FTGE T  + WE PE+  IIPI+LCT+SY+AQ
Sbjct: 188 LYKQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDV-WETPEDEEIIPIILCTVSYRAQ 246

Query: 247 DGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRHMIEMKI 306
           DGVDKR+GFTYVQGAADDHELWS GL P++FW +I    +   S+D L   V  ++  K 
Sbjct: 247 DGVDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLLAAKQ 306

Query: 307 KDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVVILSETV 366
           K+ +      T++A  P  +D IT +I LGKI + + I  S+  E    FS+V++ SE+ 
Sbjct: 307 KEVSETE---TLEAFNP--LDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESC 361

Query: 367 TLNSDDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNGK-----PILIC 421
            L+    +E+ +  + I +L SGSKKSSK LR  +P+++  +    +  K     PILIC
Sbjct: 362 KLSVSKNEEKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILIC 421

Query: 422 CNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTTLI 481
           CN+GTD+SI ++L +LCK+Y LD +  K                  ++K IIRK+LT LI
Sbjct: 422 CNSGTDMSIALVLMLLCKHYDLDWNTSKP---------------NEVNKIIIRKHLTKLI 466

Query: 482 SHLEGRNVNPSRATLNSVNDYLM 504
           SHL+GRNVNPSRATLNSVN+YLM
Sbjct: 467 SHLKGRNVNPSRATLNSVNEYLM 489

>TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON}
           Anc_8.848 YMR283C
          Length = 489

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/504 (55%), Positives = 360/504 (71%), Gaps = 29/504 (5%)

Query: 6   FFDSLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLWYVSPS 65
           F DSL  INKDIKKEYKSLRNRLQSILLD  FL  E++  FP YP++PNERCGLWY +P 
Sbjct: 10  FIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWYCNPK 69

Query: 66  QYNQTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDALSKTIP 125
            + QTSYFKSTDGHTNQWDFS+RRLNFH++ TIAKS GI I+DSTRRGKK+PDALSKTIP
Sbjct: 70  DFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALSKTIP 129

Query: 126 IWCAVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDKLEIIN 185
           IWCAVLN++ML E +GG+  VK ++ L+VPP TV +SE+  I  +IP LVEKL  LE+IN
Sbjct: 130 IWCAVLNHLML-ESQGGS--VK-QETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVIN 185

Query: 186 ANELISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAPENIIPIVLCTISYQA 245
             EL     GKLLRP WIYPGSSIL S+ D+FTGE T         +IIPI+LCT+SYQA
Sbjct: 186 GKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSDKWIPVDNSIIPIILCTVSYQA 245

Query: 246 QDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRHMIEMK 305
           QDGVDKR GFTYVQGAADDHELWS GL  ++FWS+I+ LGN   S++EL  +V  +  ++
Sbjct: 246 QDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQL-SLR 304

Query: 306 IKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVVILSET 365
             D +    E+     FP  +D +TPE+SLG + +N++    ++ E ++  SLV++LS++
Sbjct: 305 GCDLSK---EIQFSDAFPQ-IDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQS 360

Query: 366 VTLNSDDKD-EQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTN----GKPILI 420
           V       + E  S+ + I+KL SGSK SS+ L+TE+ KI  ++ +++ +     KP+LI
Sbjct: 361 VNFPQKVAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVLI 420

Query: 421 CCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTTL 480
           CCN+GTD+SIG++L +LC+NY +D      W          N P   + K +++K+L  L
Sbjct: 421 CCNSGTDMSIGLLLVVLCRNYNMD------W--------QLNTPTS-VSKIVVKKHLAKL 465

Query: 481 ISHLEGRNVNPSRATLNSVNDYLM 504
           ISHL+GRNVNP RATLNSVN YLM
Sbjct: 466 ISHLKGRNVNPPRATLNSVNSYLM 489

>TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}
           Anc_8.848 YMR283C
          Length = 493

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/510 (53%), Positives = 360/510 (70%), Gaps = 36/510 (7%)

Query: 9   SLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLWYVSPSQYN 68
           S++QI KDI+KE KSL+NR+ SILLD++FL++++I  FP YP++PNERCGLWY   + + 
Sbjct: 6   SVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRANFT 64

Query: 69  QTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDALSKTIPIWC 128
            TSYFKSTDGH NQWDFSTRRLNFHL+  I + KGI IIDSTRRGKKIPDALSKT+PIWC
Sbjct: 65  TTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWC 124

Query: 129 AVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDKLEIINANE 188
           AVLN ++L+  +   D  K  + LFVPPATV KSEY+ I  KIP LVEKL KL++I+  +
Sbjct: 125 AVLNTMILQHCENEED--KSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKK 182

Query: 189 LISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAP---ENIIPIVLCTISYQA 245
           L   F G LLRP+WI+PGSSIL S  D FTGE     +WE P   E IIPIVLCT+SYQ 
Sbjct: 183 LYEQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNSSWEEPSKEEKIIPIVLCTVSYQV 242

Query: 246 QDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRHMIEMK 305
           QDGVD R GFTYVQGAADDHELWS GL+P+LFW +I  L N   S++ L +YV  +    
Sbjct: 243 QDGVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIELLNNLELSEEMLEDYVEEI---- 298

Query: 306 IKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVVILSET 365
           +   + K   L +D +F   +D IT E+ LG I + ++I ++++  F K +SLV+ILS +
Sbjct: 299 LLSESMKITNLEVDGVF-KSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNS 357

Query: 366 VTLNSDDKDEQQSDS-------VKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNG--- 415
           + L SD+++EQ +++       +K+++L SGSKKSSK LR+ +P+I +++ + L++    
Sbjct: 358 IKLASDEQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGST 417

Query: 416 -KPILICCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIR 474
            KPIL+CCN G+D+SI +IL  L K Y       + W R  + T+        ++K  IR
Sbjct: 418 KKPILVCCNNGSDMSIAVILVTLSKFY------TQEWRRTSEHTE--------INKITIR 463

Query: 475 KNLTTLISHLEGRNVNPSRATLNSVNDYLM 504
           K+LT +ISHL GRNVNPSRATLNSVND+LM
Sbjct: 464 KHLTKVISHLGGRNVNPSRATLNSVNDFLM 493

>KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.848
           YMR283C
          Length = 499

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/508 (52%), Positives = 354/508 (69%), Gaps = 24/508 (4%)

Query: 1   MDQSYFFDSLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLW 60
           MD++    SL QI+K++K++ +SLRNR+QSILLDNEFL   +   FP++P+IPNERCGLW
Sbjct: 12  MDRN-LLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLW 70

Query: 61  YVSPSQYNQTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDAL 120
           Y +PS + QTSYFKSTDGH NQWDFSTRRLNFHLL T+ ++ G+ I+DSTRRGKKIPDAL
Sbjct: 71  YCNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDAL 130

Query: 121 SKTIPIWCAVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDK 180
           SKT+P+WCAVLN +ML  +        V D LFVPP TVP+SE D + +K+P LVEKL  
Sbjct: 131 SKTVPLWCAVLNSLMLESVGKK---FNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKI 187

Query: 181 LEIINANELISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAP--ENIIPIVL 238
           L + +  +      GKLLRP W++PGSS+L S  D+FTGE+ +   WE    ENI+PI+L
Sbjct: 188 LNVFDGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQN-KWEVSRDENIVPIIL 246

Query: 239 CTISYQAQDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYV 298
           CT+SYQAQDG+DKR GFTYVQGAADDHELWS GL   +FWS+I+   N +  D EL E V
Sbjct: 247 CTVSYQAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIV 306

Query: 299 RHMIEMKIKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSL 358
             M+  +  +        ++D I   G+D +T  +SLG+I +N+ ++   + + +K +S 
Sbjct: 307 DKMVTQQNNNMQRSAQAGSLDKIM-TGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYST 365

Query: 359 VVILSETVTLNSDDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMREN--LTNGK 416
           V++LSETV L+ D    Q ++ VKI++LTSGSKKSSK LR  +P I + +     L   K
Sbjct: 366 VIVLSETVHLDKD--ASQDNEMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIILQPIK 423

Query: 417 PILICCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKN 476
           P+LICCNTG D+SIG++L +LC+NY       + W  L ++ + S      + K +IR++
Sbjct: 424 PLLICCNTGKDMSIGVLLAVLCQNY------DEVWDLLPEDVKPS------VSKIVIRRH 471

Query: 477 LTTLISHLEGRNVNPSRATLNSVNDYLM 504
           LT LI+HL GRNVNPSRATLNS+N +LM
Sbjct: 472 LTKLIAHLNGRNVNPSRATLNSINSFLM 499

>SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar to
           uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 502

 Score =  525 bits (1351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/487 (53%), Positives = 351/487 (72%), Gaps = 36/487 (7%)

Query: 23  SLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLWYVSPSQYNQTSYFKSTDGHTNQ 82
           SLRNRLQSI+ D++FL   +I TFP+YP++PNERCGLWY +P  ++Q SYFKSTDGH NQ
Sbjct: 47  SLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWYCNPESFSQMSYFKSTDGHINQ 106

Query: 83  WDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDALSKTIPIWCAVLNYIMLRELKGG 142
           WDFSTRRLNFHLL +IA+  GI IIDSTRRGKKIPDALSKTIPIWCAV+N ++L      
Sbjct: 107 WDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALSKTIPIWCAVINTLILEASN-- 164

Query: 143 NDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDKLEIINANELISTFHGKLLRPLW 202
               + E+ LF PP TVP+SEYD I  +IP+LVEKL  L I++ +EL+  F GK+LRPLW
Sbjct: 165 ----RSEEVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIVSGDELLKQFGGKILRPLW 220

Query: 203 IYPGSSILHSSRDVFTGEKTKALAWEAPE--NIIPIVLCTISYQAQDGVDKRYGFTYVQG 260
           +YPGSS+  SS D+FTG++T++  WE PE  + +P++LCT SYQ QDGVDKRYGFTYVQG
Sbjct: 221 VYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCTASYQCQDGVDKRYGFTYVQG 280

Query: 261 AADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRHMIEMKIKDSAAKTVELT--- 317
           AADDHELW+ GLTP++FW + N+LG+ T S+ EL+EYV      + +++  +T E +   
Sbjct: 281 AADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNK----QKREATERTKEASGND 336

Query: 318 MDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVVILSETVTLNSDDKDEQQ 377
           ++  F   VD IT E+ LG + + +++ + +L +    ++L V+LSE+V + S     Q+
Sbjct: 337 LNQCF--SVDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVVLSESVKIASI----QE 390

Query: 378 SDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNGKPILICCNTGTDISIGIILTIL 437
           + + KI+ LTSG+KKSSK LR+++ +I  +++ +L +  PILICCNTG D+S+G++L  L
Sbjct: 391 NPNTKIFPLTSGNKKSSKELRSKLIEICPLIQASLNSPLPILICCNTGKDMSVGVLLATL 450

Query: 438 CKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTTLISHLEGRNVNPSRATLN 497
           C+NY  D      W      +          +KTIIRK+LT LISHL+GRNVNPSRATLN
Sbjct: 451 CQNYDED------WCIGSPNS---------FNKTIIRKHLTRLISHLKGRNVNPSRATLN 495

Query: 498 SVNDYLM 504
           SVN YLM
Sbjct: 496 SVNAYLM 502

>KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {ON}
           Anc_8.848 YMR283C
          Length = 483

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/505 (56%), Positives = 352/505 (69%), Gaps = 29/505 (5%)

Query: 7   FDSLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLWYVSPSQ 66
            DSLS I KDIK EY+SL+NRLQSI+LDN FL +E++  FPNYPIIPNERCGLWY  P  
Sbjct: 1   MDSLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKH 60

Query: 67  YNQTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDALSKTIPI 126
           + QTSYFKSTDGH NQWDFSTRRLNFHLL  +AKS GI I+DSTRRGKKIPDALSKTIPI
Sbjct: 61  FEQTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPI 120

Query: 127 WCAVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDKLEIINA 186
           WCAVLN ++L      N+ +  E  LFVPPATV  SEY  IL+KI  LV KL  LE++  
Sbjct: 121 WCAVLNCLILEH--ASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKP 178

Query: 187 NELISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAP--ENIIPIVLCTISYQ 244
            EL +  +GKL+RP W+YPGSS+LH+  D FTGE T    W  P  ENIIPI+LCT+SYQ
Sbjct: 179 KELYNMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGE-RWSVPENENIIPIILCTVSYQ 237

Query: 245 AQDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRHMIEM 304
           AQDGVDKR GF YVQGAADDHELWSCGL P+ FW +I+YL +   +D  L E+V     +
Sbjct: 238 AQDGVDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVD---TL 294

Query: 305 KIKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVVILSE 364
            ++++  K    ++  IF   ++ +TPEISLGKI +N  I   +  E    FSLV+ILSE
Sbjct: 295 TLEENHEKKASSSIIDIF-ESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSE 353

Query: 365 TVTLNSDDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNG-----KPIL 419
           T+ +     +E  +  +K++KL SGSKKSSK LR ++P+I++ +     +      KPIL
Sbjct: 354 TIEITK--LEEATTKIIKLFKLQSGSKKSSKSLRLQLPEIFDTINPYFQDASNLAKKPIL 411

Query: 420 ICCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTT 479
           ICCN+G D+S+ +ILTIL K Y       + W   + ET D  +    + KT+IRK+L  
Sbjct: 412 ICCNSGNDMSVAVILTILSKKY------SEGW---QLETSDDLL----ISKTVIRKHLAK 458

Query: 480 LISHLEGRNVNPSRATLNSVNDYLM 504
           LIS L+GRNVNPSRATLNS+N YLM
Sbjct: 459 LISSLQGRNVNPSRATLNSINSYLM 483

>ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]
           {ON} similar to uniprot|P23796 Saccharomyces cerevisiae
           YMR283C RIT1 Modifies initiator methionine tRNA to
           distinguish it from elongator methionine tRNA Initiator
           methionine tRNA 2'-O-ribosyl phosphate transferase
          Length = 472

 Score =  506 bits (1303), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 266/514 (51%), Positives = 351/514 (68%), Gaps = 52/514 (10%)

Query: 1   MDQSYFFDSLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLW 60
           MD    F SL+QIN+DIKKEY SLRNR+QSIL DN F+   +I  FPNYP+IPNERCGLW
Sbjct: 1   MDPDLAF-SLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLW 59

Query: 61  YVSPSQYNQTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDAL 120
           Y  P  ++QTSYFKSTDGHTNQWDFSTRRLN HLL  + +  GI I+DSTRRGK +PDAL
Sbjct: 60  YCDPKDFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDAL 119

Query: 121 SKTIPIWCAVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDK 180
           SKTIPIWCAVLN +M  +           + LF PP  V +SE+D I  +IP+LV++L+K
Sbjct: 120 SKTIPIWCAVLNSLMQPD---------KSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEK 170

Query: 181 LEIINANELISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWE-AP-ENIIPIVL 238
           L+I++A +L + F GK+LRP W+YPGS +L SS D FTGE  + + WE  P E IIPI+L
Sbjct: 171 LDILDAQDLRNKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIE-IQWEPGPNEQIIPIIL 229

Query: 239 CTISYQAQDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYV 298
           CT SY+AQDGVDKR+GFTYVQGAADDHELWSCGL P+L W++ +Y  +   +D EL  +V
Sbjct: 230 CTASYRAQDGVDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHV 289

Query: 299 RHMIEMK----IKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKK 354
           + +IE+      ++  A  VE+          DPIT E+SLGK+ ++  IT ++  E   
Sbjct: 290 KTLIELAETTDHRNHLADIVEM----------DPITKELSLGKLKDHTAITPNIARELDS 339

Query: 355 GFSLVVILSETVTLNSDDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTN 414
            FSLV+ILS++VTL+      +  D +K Y L SGSK+SSK LR  + +I  ++  +L  
Sbjct: 340 QFSLVIILSQSVTLS------KPFDFIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNK 393

Query: 415 G----KPILICCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDK 470
                KPI++CCN+GTDIS+G+IL ILCK Y  D      WL  + ++         ++K
Sbjct: 394 DVVKRKPIMVCCNSGTDISVGVILMILCKYYSQD------WLLGKPDS---------VNK 438

Query: 471 TIIRKNLTTLISHLEGRNVNPSRATLNSVNDYLM 504
            +IR++L  +I+ ++ RNVNPSRATLNS+N +LM
Sbjct: 439 FVIRRHLVQIINKIKRRNVNPSRATLNSINSFLM 472

>Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283C
           (RIT1) - Initiator methionine tRNA 2'-O-ribosyl
           phosphate transferase [contig 39] FULL
          Length = 500

 Score =  505 bits (1301), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 251/501 (50%), Positives = 352/501 (70%), Gaps = 33/501 (6%)

Query: 6   FFDSLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLWYVSPS 65
           F  +L+ +NK+IKKE K+LRNRLQSIL D+ FL ++++A FPNYP+IPNERCGLWY  P 
Sbjct: 31  FDQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWYCDPE 90

Query: 66  QYNQTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDALSKTIP 125
           +Y+QTSYFKSTDGH+NQWDFS RRLN HLL TI +  GI I+DSTRRGK++PDALSKT+P
Sbjct: 91  RYSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALSKTVP 150

Query: 126 IWCAVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDKLEIIN 185
           IWCAVLN IML   +        E+ LF PP TV  SE++ I  +IP+LV +  +L +  
Sbjct: 151 IWCAVLNSIMLEGRQSE------EEVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLFT 204

Query: 186 ANELISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAP-ENIIPIVLCTISYQ 244
           ++EL     GK+LRP+W+YPG+S+L+S RD FTG+      WEA  EN +P+VLCT+SYQ
Sbjct: 205 SDELFKILDGKILRPIWVYPGASLLNSHRDPFTGDIVTP-TWEAQNENFMPVVLCTVSYQ 263

Query: 245 AQDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRHMIEM 304
            QDGVDKR+GFTYVQGAADDHELW+ GLT ELFW HI    +   SD EL  YV +++  
Sbjct: 264 CQDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLVTS 323

Query: 305 KIKDSAAK-TVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVVILS 363
              D+  K T  L +D +     + +T E+ LG++  NI++ K+++ + K  +SLVV+LS
Sbjct: 324 --GDANNKLTKSLRLDDML--NANELTRELHLGQVAENIELDKNLVDQLKLKYSLVVLLS 379

Query: 364 ETVTLNSDDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNGKPILICCN 423
            ++++       +++++++I+KL SGSKKSS+ LR  + +I  ++  NL N  P+LICCN
Sbjct: 380 TSISV------YEEAENIRIFKLQSGSKKSSRALRAALTQICPLIEANLQNSLPVLICCN 433

Query: 424 TGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTTLISH 483
            G D+S+ ++L++LC+N+     N ++W +LE+           + K+II+K+L  +I+ 
Sbjct: 434 NGKDMSVCVVLSVLCRNF-----NVESW-QLEQRPS--------VHKSIIKKHLAKMITK 479

Query: 484 LEGRNVNPSRATLNSVNDYLM 504
           L+GRN+NP R +LNSVNDYLM
Sbjct: 480 LDGRNLNPPRVSLNSVNDYLM 500

>Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR451C
          Length = 480

 Score =  504 bits (1297), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 253/505 (50%), Positives = 350/505 (69%), Gaps = 26/505 (5%)

Query: 1   MDQSYFFDSLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLW 60
           M+     D+L QI K+I+++  SLRNRLQS+  D++F+ +E++  FPNYP++PNERCGLW
Sbjct: 1   MEDESGLDTLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLW 60

Query: 61  YVSPSQYNQTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDAL 120
           Y +P +Y QT YFKSTDGHTNQWDFSTRRLNFH+L  +A++ GI I+DSTRRGKK+PDAL
Sbjct: 61  YCNPGKYEQTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDAL 120

Query: 121 SKTIPIWCAVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDK 180
           SKTIPIWCAVLN +ML + KG  D +     LF PP TV K E+D I  K+P LVEKL K
Sbjct: 121 SKTIPIWCAVLNNLML-DYKGKEDSIP---SLFCPPGTVSKLEFDGIHSKVPDLVEKLKK 176

Query: 181 LEIINANELISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAPENIIPIVLCT 240
           L II+  EL + F GK+LRP W+YPGS +L +SRD+FTGE      W++ +N IP++LCT
Sbjct: 177 LNIISGEELYNMFQGKVLRPFWVYPGSPLLDTSRDIFTGE-VLGNVWQSEQNSIPVILCT 235

Query: 241 ISYQAQDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRH 300
            SYQ QDG DK +GFTYVQGAADDHELW+ GL PE+FW +I +LG+P  S+ EL ++V+ 
Sbjct: 236 ASYQCQDGEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQR 295

Query: 301 MIEM-KIKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLV 359
           +    K+   + K  +    + F   VD IT  + LG +   I +T+++  E K  +SL 
Sbjct: 296 IGRTEKLTAQSNKQSDRESSSSFIK-VDEITKNLYLGTVAEGIALTENIEKELKSKYSLC 354

Query: 360 VILSETVTLNSDDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNGKPIL 419
           +I S++VT  +D   E+    +K+Y + + SKKSS+ LR  + +I  ++++++T+  PIL
Sbjct: 355 IICSQSVTAKADCNCER----IKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQLPIL 410

Query: 420 ICCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTT 479
           ICCNTG DISIGI+LT LC++Y L       W   E+ET         ++KTI++K+L  
Sbjct: 411 ICCNTGKDISIGIMLTALCQHYDLQ------WHLEEQET---------VNKTIVKKHLAR 455

Query: 480 LISHLEGRNVNPSRATLNSVNDYLM 504
           +I+ L G N+NPSR+TL +VN +L+
Sbjct: 456 IITKLSGININPSRSTLKNVNAFLL 480

>KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 474

 Score =  503 bits (1296), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 261/494 (52%), Positives = 341/494 (69%), Gaps = 33/494 (6%)

Query: 13  INKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLWYVSPSQYNQTSY 72
           +N++IKKEY+SLRNRLQSI+ D++FL++++ A FP+YPIIPNERCG+WY  P  Y QTSY
Sbjct: 12  LNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKDYLQTSY 71

Query: 73  FKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDALSKTIPIWCAVLN 132
           FKSTDGHTNQWDFS RRLNFHLL  +A S GI ++DSTRRGK++PDALSKT+PIWCAVLN
Sbjct: 72  FKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPIWCAVLN 131

Query: 133 YIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDKLEIINANELIST 192
            ++L E +G        + LF PP TV + E++ I  +IP LV K  K+ I+   ++   
Sbjct: 132 SLLL-EYQGLEG-----EVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGADIDRL 185

Query: 193 FHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAP--ENIIPIVLCTISYQAQDGVD 250
           F GK+LRPLW++PG+S+L S RD FTGE   +  W     EN IP+VLCT+SYQ QDGVD
Sbjct: 186 FKGKILRPLWVFPGASLLSSQRDPFTGE-VLSQKWHTAELENFIPVVLCTVSYQCQDGVD 244

Query: 251 KRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRHMIEMKIKDSA 310
           KR+GFTYVQGAADDHELW+ GLT ELFW HI+ L N   SD EL  +V   I  +  +SA
Sbjct: 245 KRHGFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEPNSA 304

Query: 311 AKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVVILSETVTLNS 370
                L++D I     D +T E+ LGKI +N+ + + ++ E +  +SLV+ILS TVTL+ 
Sbjct: 305 ENG--LSLDQIL--YTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLSE 360

Query: 371 DDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNGKPILICCNTGTDISI 430
           D+       ++KI+KL S  KKSSK LRTE+ KI  +    L N  P+L+CCNTG D+S+
Sbjct: 361 DEA------AIKIFKLQSECKKSSKALRTELIKICPLAEAYLPNSLPMLVCCNTGKDMSV 414

Query: 431 GIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTTLISHLEGRNVN 490
            + L ILC+NY     N  +W        D NV  + + K  I+K+L+ +I+ LEGRNVN
Sbjct: 415 CVSLAILCRNY-----NVGSW--------DLNVQ-QSIHKIDIKKHLSKIITKLEGRNVN 460

Query: 491 PSRATLNSVNDYLM 504
           P RA+LNSVN YLM
Sbjct: 461 PPRASLNSVNAYLM 474

>KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 489

 Score =  489 bits (1260), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 253/505 (50%), Positives = 342/505 (67%), Gaps = 34/505 (6%)

Query: 10  LSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLWYVSPSQYNQ 69
           + +I+K+++KE KSL+NRLQSI+ DN FL +++  TF  YP++PNERCGLWY  P  Y+ 
Sbjct: 9   IKEISKELRKEDKSLKNRLQSIIFDNNFLKEQVFPTF-QYPVVPNERCGLWYCDPKIYDT 67

Query: 70  TSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDALSKTIPIWCA 129
           TSYFKSTDGH NQWDFSTRRLNFHLL  + ++ G+ I+DSTRRGKKIPDALSKT+PIWCA
Sbjct: 68  TSYFKSTDGHMNQWDFSTRRLNFHLLPLLGENGGLVILDSTRRGKKIPDALSKTVPIWCA 127

Query: 130 VLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDKLEIINANEL 189
           VLNY+ML     G      E+ LFVPP+TVP+SE+D +  K+P LV+KL KL+II+  +L
Sbjct: 128 VLNYLMLE--ADGKQWPFEEEILFVPPSTVPESEFDRMFAKLPELVQKLKKLDIIDVKKL 185

Query: 190 -----ISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAPENIIPIVLCTISYQ 244
                I   H KLLRP+W+YPGSS+L    D+F+GE  +   WE P NIIP++LCT+SYQ
Sbjct: 186 RKSLQIEEGHDKLLRPIWVYPGSSLLQLKHDLFSGEVIENTHWEPPSNIIPVILCTVSYQ 245

Query: 245 AQDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRHMIEM 304
            QDG DKRYGFTYVQGAADDHELW+  LTP+LFW +I+ LG+ + SD EL +    +I  
Sbjct: 246 CQDGTDKRYGFTYVQGAADDHELWAENLTPQLFWENIDELGDISKSDAELKDSYNAVI-- 303

Query: 305 KIKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVVILSE 364
            ++     +++++ D      +D IT  + LGKI +  +IT   +    + +S VV+  E
Sbjct: 304 -LRAKVQNSLDISGDISKMLEIDTITARLHLGKITSQFRITPKTVKYLNQKYSAVVLCHE 362

Query: 365 TVTLNSDDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTN-----GKPIL 419
            +++    +  +   S+ I+ L SGSKKSS+ LR+ + KI  ++ E L+        PIL
Sbjct: 363 AISVT---EITELPRSIHIFPLPSGSKKSSRELRSHLIKINALIEEQLSRPDTAANLPIL 419

Query: 420 ICCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTT 479
           I C++G DIS+ I+L  LCK Y LD      W   E + QDS      ++KTII+K+L  
Sbjct: 420 IACDSGKDISVSILLVALCKYYNLD------W---ELQPQDS------VNKTIIKKHLAK 464

Query: 480 LISHLEGRNVNPSRATLNSVNDYLM 504
           +I  L+GRNVNPSRA+LNSVN +LM
Sbjct: 465 IIESLQGRNVNPSRASLNSVNSFLM 489

>AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR283C
           (RIT1)
          Length = 408

 Score =  377 bits (967), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 197/436 (45%), Positives = 274/436 (62%), Gaps = 33/436 (7%)

Query: 70  TSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDALSKTIPIWCA 129
           T YFKSTDGH N WDFS RRLNFHLL  +A+  G  I+DSTRRGKKIPDALSKTIPIWCA
Sbjct: 5   TCYFKSTDGHVNGWDFSVRRLNFHLLPLLAERSGAIIVDSTRRGKKIPDALSKTIPIWCA 64

Query: 130 VLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDKLEIINANEL 189
           VLN ++L   +G  ++      LF PP TV + EY+ I  K+P LV+KL +++ I+  EL
Sbjct: 65  VLNTLILEHTEGSGEV------LFCPPGTVSQLEYNRIQAKLPELVQKLKRVDAISGAEL 118

Query: 190 ISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAPENIIPIVLCTISYQAQDGV 249
            S   G+LLRP W+YPG+++L ++RD+FTGE  +   W+ P  +IP++LCT S Q QDGV
Sbjct: 119 CSLLGGRLLRPFWVYPGAAMLGTTRDLFTGESLQE-PWQPPPGVIPLILCTASRQCQDGV 177

Query: 250 DKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRHMIEM-KIKD 308
           DK  G+ YVQGAADDHELW+ GLTP LFW+++  L + +  +  L  +V  ++E+ K   
Sbjct: 178 DKSQGYAYVQGAADDHELWANGLTPSLFWANVQLLADDSMPEQLLQGHVERIVELHKSTH 237

Query: 309 SAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVVILSETVTL 368
           + A   EL          D +T  + LG +    +I+       ++ +SLVV+   ++ L
Sbjct: 238 TEAVAHELPC-----RETDVVTEHLRLGSV-APCQISDKQAELLEQQYSLVVLCGSSIEL 291

Query: 369 NSDDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNGKPILICCNTGTDI 428
           ++     +    ++IY L SG KKSS+ LR  + +I  ++   L    P+LICC++G+DI
Sbjct: 292 SAAAPHPR----IRIYPLNSGCKKSSRALRPALIEIIPLISTALCEALPVLICCSSGSDI 347

Query: 429 SIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTTLISHLEGRN 488
           S+GI+L  LCKNY L+      W R E +        K + KTII+K+L  L S + GR 
Sbjct: 348 SVGIVLAALCKNYDLE------W-RHEDQ--------KDMTKTIIKKHLIKLTSKIHGRI 392

Query: 489 VNPSRATLNSVNDYLM 504
           +NPSR TLNSVN +LM
Sbjct: 393 INPSRTTLNSVNAFLM 408

>TDEL0G03960 Chr7 (718226..719008) [783 bp, 260 aa] {ON} 
          Length = 260

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 25/51 (49%)

Query: 388 SGSKKSSKRLRTEIPKIYEVMRENLTNGKPILICCNTGTDISIGIILTILC 438
           +G ++   RLR EI  +   + +   +   +L+CC  G  I +   L +LC
Sbjct: 66  TGVREREDRLRAEIAAMNVYVADVFAHHTKLLVCCLNGPAIGLAASLVLLC 116

>CAGL0F04851g Chr6 complement(488804..490582) [1779 bp, 592 aa] {ON}
           similar to uniprot|Q12374 Saccharomyces cerevisiae
           YPR155c NCA2
          Length = 592

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 8/82 (9%)

Query: 171 IPTLVEKLDKLEIINANELISTF-HGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEA 229
           +  +VE  D  E+IN N+LIS   HG L + L IY  + + H  +++ TG   ++L  + 
Sbjct: 379 VSFVVENSDHRELINENQLISQVEHGDLTQFLKIYE-TQLSHPIKNIVTGSLVRSLLIQV 437

Query: 230 PENIIPIVLCTISYQAQDGVDK 251
            +  +   L      A +G+DK
Sbjct: 438 QKTKVDGSL------ALNGIDK 453

>KLTH0E07634g Chr5 (697160..698794) [1635 bp, 544 aa] {ON} similar
          to uniprot|P16639 Saccharomyces cerevisiae YGL017W ATE1
          Arginyl-tRNA-protein transferase catalyzes
          post-translational conjugation of arginine to the amino
          termini of acceptor proteins which are then subject to
          degradation via the N-end rule pathway
          Length = 544

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 38 LNDEIIATFPNYPIIPNERCGLWYVSPSQYNQTSYFKSTDGH 79
          L+D +I + P Y   PNE+CG  Y S  + N+  YF +   H
Sbjct: 3  LSDRLIISKPLYFTEPNEKCG--YCSGKKANKCDYFATESWH 42

>NDAI0F04640 Chr6 (1122327..1124345) [2019 bp, 672 aa] {ON}
           Anc_1.125 YJL209W
          Length = 672

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 48/95 (50%), Gaps = 24/95 (25%)

Query: 21  YKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLWYVSPSQYNQTSYFKSTDGHT 80
           Y+SL+++L + +++NE L   I   F  Y          W + P Q+++ +   + D  T
Sbjct: 38  YQSLKDKLTATIVNNEPLTPHIKKDFQKY----------WKLLPQQFSKQN---NHDNET 84

Query: 81  --NQWDFSTRRLNFHLLETIAKSKGITIIDSTRRG 113
             NQ D +T  +NF     I KSKGI+   ST RG
Sbjct: 85  ILNQIDMTT-FMNF-----INKSKGIS---STARG 110

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,840,187
Number of extensions: 2766228
Number of successful extensions: 9589
Number of sequences better than 10.0: 48
Number of HSP's gapped: 9784
Number of HSP's successfully gapped: 48
Length of query: 504
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 390
Effective length of database: 40,409,475
Effective search space: 15759695250
Effective search space used: 15759695250
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)