Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0K003408.847ON62462433140.0
NCAS0C003708.847ON4955526594e-78
SAKL0D01298g8.847ON5514904075e-42
ZYRO0G14322g8.847ON5504833882e-39
TDEL0B005108.847ON5504373671e-36
KLTH0C03718g8.847ON5514393563e-35
Kpol_1068.38.847ON5664893432e-33
Skud_13.4548.847ON5804493292e-31
YMR282C (AEP2)8.847ON5804473263e-31
Kwal_27.102248.847ON5464293236e-31
Smik_13.4958.847ON5764493016e-28
Suva_13.4718.847ON5814412882e-26
TPHA0I002908.847ON5695472847e-26
CAGL0M03069g8.847ON5484332286e-19
KAFR0B039708.847ON4744362251e-18
KNAG0J002308.847ON4744022222e-18
Ecym_46188.847ON5275701973e-15
TBLA0B033108.847ON6134121869e-14
KLLA0D01408g8.847ON5184821502e-09
NCAS0G043101.535ON16578770.43
KLTH0D01430g7.43ON1024162790.77
Skud_6.658.69ON2143141780.92
TPHA0H003008.155ON2698138761.7
NCAS0B054608.155ON2688153742.9
NCAS0F031605.402ON373264716.6
NDAI0B027208.155ON2675104709.3
NDAI0G05680singletonON626896910.0
NOTE: 1 genes in the same pillar as NDAI0K00340 were not hit in these BLAST results
LIST: ABL119C

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0K00340
         (624 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON...  1281   0.0  
NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847...   258   4e-78
SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly s...   161   5e-42
ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]...   154   2e-39
TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847...   145   1e-36
KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly...   141   3e-35
Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..599...   136   2e-33
Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {...   131   2e-31
YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON} ...   130   3e-31
Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282...   129   6e-31
Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {...   120   6e-28
Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {...   115   2e-26
TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}...   114   7e-26
CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa] ...    92   6e-19
KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {O...    91   1e-18
KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.84...    90   2e-18
Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {O...    80   3e-15
TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {O...    76   9e-14
KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly...    62   2e-09
NCAS0G04310 Chr7 (802074..802571) [498 bp, 165 aa] {ON} Anc_1.53...    34   0.43 
KLTH0D01430g Chr4 complement(133354..136428) [3075 bp, 1024 aa] ...    35   0.77 
Skud_6.65 Chr6 (125679..132110) [6432 bp, 2143 aa] {ON} YFL007W ...    35   0.92 
TPHA0H00300 Chr8 (53718..61814) [8097 bp, 2698 aa] {ON} Anc_8.15...    34   1.7  
NCAS0B05460 Chr2 (1024533..1032599) [8067 bp, 2688 aa] {ON} Anc_...    33   2.9  
NCAS0F03160 Chr6 (633224..644422) [11199 bp, 3732 aa] {ON} Anc_5...    32   6.6  
NDAI0B02720 Chr2 complement(676766..684793) [8028 bp, 2675 aa] {...    32   9.3  
NDAI0G05680 Chr7 complement(1410181..1412061) [1881 bp, 626 aa] ...    31   10.0 

>NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON}
           Anc_8.847 YMR282C
          Length = 624

 Score = 1281 bits (3314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/624 (100%), Positives = 624/624 (100%)

Query: 1   MMLRMFIGIQGHNSKEILLGNKIRSNNVITRIIVSRQVIRMFSRAKTLSSPSTLDELPNN 60
           MMLRMFIGIQGHNSKEILLGNKIRSNNVITRIIVSRQVIRMFSRAKTLSSPSTLDELPNN
Sbjct: 1   MMLRMFIGIQGHNSKEILLGNKIRSNNVITRIIVSRQVIRMFSRAKTLSSPSTLDELPNN 60

Query: 61  RSSENALIDDQLSKTNTKKRYTFNPKKKQPLIRTSLKPTIHNSKARKGLLHLLLAQKDNG 120
           RSSENALIDDQLSKTNTKKRYTFNPKKKQPLIRTSLKPTIHNSKARKGLLHLLLAQKDNG
Sbjct: 61  RSSENALIDDQLSKTNTKKRYTFNPKKKQPLIRTSLKPTIHNSKARKGLLHLLLAQKDNG 120

Query: 121 KVLTTILDHCLYSPNEQATTRQLVKENNHLTTLLSHEEMSIFICRVLKNFPTIISEKKYE 180
           KVLTTILDHCLYSPNEQATTRQLVKENNHLTTLLSHEEMSIFICRVLKNFPTIISEKKYE
Sbjct: 121 KVLTTILDHCLYSPNEQATTRQLVKENNHLTTLLSHEEMSIFICRVLKNFPTIISEKKYE 180

Query: 181 ILTNEGRYELYKPEVIFSLFNICKDEYCNNTNQLNPLMVYDLNQFIKYFLREGQLKKAQL 240
           ILTNEGRYELYKPEVIFSLFNICKDEYCNNTNQLNPLMVYDLNQFIKYFLREGQLKKAQL
Sbjct: 181 ILTNEGRYELYKPEVIFSLFNICKDEYCNNTNQLNPLMVYDLNQFIKYFLREGQLKKAQL 240

Query: 241 VLDYIIDRFGGIEQLIKSKDLTTLDNHLKLKNGAIYKNWKPLTDSESNTFLQYRLSLEDK 300
           VLDYIIDRFGGIEQLIKSKDLTTLDNHLKLKNGAIYKNWKPLTDSESNTFLQYRLSLEDK
Sbjct: 241 VLDYIIDRFGGIEQLIKSKDLTTLDNHLKLKNGAIYKNWKPLTDSESNTFLQYRLSLEDK 300

Query: 301 SHNFKGFKNYKFLDGWSLLKIIDMVLTDKTHCLNILNESILYSLGTLRQIEFMEHFIKQI 360
           SHNFKGFKNYKFLDGWSLLKIIDMVLTDKTHCLNILNESILYSLGTLRQIEFMEHFIKQI
Sbjct: 301 SHNFKGFKNYKFLDGWSLLKIIDMVLTDKTHCLNILNESILYSLGTLRQIEFMEHFIKQI 360

Query: 361 WDVHPDDAVEERNHQLDKYNLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPM 420
           WDVHPDDAVEERNHQLDKYNLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPM
Sbjct: 361 WDVHPDDAVEERNHQLDKYNLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPM 420

Query: 421 KSRLNDNKFWIKMLQWGIKIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDD 480
           KSRLNDNKFWIKMLQWGIKIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDD
Sbjct: 421 KSRLNDNKFWIKMLQWGIKIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDD 480

Query: 481 DYGSILINLLHNIMKERKNVDIGLKAIENFVQKLKLGSVNKYYERNLTHVLYGLQKCIFR 540
           DYGSILINLLHNIMKERKNVDIGLKAIENFVQKLKLGSVNKYYERNLTHVLYGLQKCIFR
Sbjct: 481 DYGSILINLLHNIMKERKNVDIGLKAIENFVQKLKLGSVNKYYERNLTHVLYGLQKCIFR 540

Query: 541 KIAESGSYNKGLALIDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQ 600
           KIAESGSYNKGLALIDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQ
Sbjct: 541 KIAESGSYNKGLALIDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQ 600

Query: 601 DEFEKLQQKYDEIEEEGMIIGKLW 624
           DEFEKLQQKYDEIEEEGMIIGKLW
Sbjct: 601 DEFEKLQQKYDEIEEEGMIIGKLW 624

>NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847
           YMR282C
          Length = 495

 Score =  258 bits (659), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 189/552 (34%), Positives = 285/552 (51%), Gaps = 86/552 (15%)

Query: 76  NTKKRYTFNPKKKQPLIRTSLKPTIHNSKARKGLLHLLLAQKDNGKVLTTILDHCLYSPN 135
           N+      N   K+P I  S+      S +R      LL + +  K      +H L    
Sbjct: 27  NSPASSIANATSKEPTISISMDKGTIASNSRVRFSSTLLKKNEFNKY-----EHFLRGGR 81

Query: 136 EQATTRQLVKENNHLTTLLSHEEMSIFICRVLKNFPTIISEKKYEILTNEGRYELYKPEV 195
            +     ++     +    + EE S+F+ +VL       S K  ++  N          V
Sbjct: 82  IKDLISMILNPMVSIHEHFTLEEYSLFLGKVL-------SMKDSDVNVN----------V 124

Query: 196 IFSLFNICKDEYCNNTNQLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGIEQL 255
           +F LF I    YC     LN L +YDLN+ IKYF++  QLK+ Q+VLD+II ++GGIE +
Sbjct: 125 VFQLFEIYARMYCGE-GSLNALQIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENM 183

Query: 256 IKSKDLTTLDNHLKLKNGAIYKNWKPLTDSESNTFLQYRLSLEDKSHNFKGFKNYKFLDG 315
           I  +DL +L+NHLKLKNG++ K+WK   + ++  +LQ R          +G  NYKFLDG
Sbjct: 184 IAHRDLISLNNHLKLKNGSLVKDWK--FEGKNLRYLQSR----------QGRLNYKFLDG 231

Query: 316 WSLLKIIDMVLTDKTHCLNILNESILYSLGTLRQIEFMEHFIKQIW--DVHPDDAVEERN 373
           WSLLKI D+VL D   C N+L  SI+YSLG LRQ+E ++HFI Q+W  +  P + +    
Sbjct: 232 WSLLKIADLVLNDPMKCQNVLTNSIIYSLGHLRQVELLDHFIDQMWMQETRPRNGL---- 287

Query: 374 HQLDKYNLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRLN-DNKFWIK 432
                  L PDTN +IAI+TSYC  Y +MD++F +LD++++KY     S L  D  FW +
Sbjct: 288 -------LYPDTNNIIAIITSYCYNYGNMDKSFDVLDRILEKY-----SGLKFDKFFWRR 335

Query: 433 MLQWGIKIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINLLHN 492
           + QW I + + N N   G  +  C  +ME       K+  +E       +  +L+ LL  
Sbjct: 336 LFQWCI-LTEPNAN--KGFILGQCWSLME-------KQEKVE-------FDGVLLELLRE 378

Query: 493 IMKERKNVDIGLKAIENFVQKLKLGSVNKYYERNLTHVLYGLQKCIFRKIAESGSYNKGL 552
            + + ++V + L+ ++  V +LK   VN   E ++  +L   QK +F K+ E     K +
Sbjct: 379 KIVKVRDVPLALRVLKMIVIELK--KVNFINELDM-ELLLKYQKFVFSKLGEINKTVKAM 435

Query: 553 ALIDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQDEFEKLQQKYDE 612
            L+    YT N   ++ +R YY    +E R K  R N            +++ LQ+KYDE
Sbjct: 436 ELLSCDDYTINKENKAFMRAYYFENKREKRKKNKRSN------------QYDDLQRKYDE 483

Query: 613 IEEEGMIIGKLW 624
           ++EE MIIGKLW
Sbjct: 484 MDEEDMIIGKLW 495

>SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  161 bits (407), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 146/490 (29%), Positives = 241/490 (49%), Gaps = 84/490 (17%)

Query: 153 LLSHEEMSIFICRVLKNFPTIISEKKYEILTNEGRYELYKPEVIFSLFNICKDEYCNNTN 212
           L++  E S+F+ ++L N   + SE     LTN     ++  EV+F L+ I +D    N  
Sbjct: 128 LITKLEYSVFVNKLLSN-TNLKSE-----LTNLIPGTVHT-EVLFKLYEIYRDSVVGNAT 180

Query: 213 QLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGIEQLIKSKDLTTLDNHLKLKN 272
            L P+ +YDLNQFIK F  + QL KAQ VL ++++ +G I      +D  TL N+L+LK 
Sbjct: 181 -LTPVQLYDLNQFIKRFTGDAQLAKAQQVLGFVLENYGSI-----PRDPQTLINYLELKC 234

Query: 273 GAIYKNWK-PLTDSESNTFLQYRLSLEDKSHNFKGFKNYKFLDGWSLLKIIDMVLTD--- 328
           GA+ +NW  PL+  E    L  +  + + +H      +YK L+  +LL +ID ++ D   
Sbjct: 235 GAMPRNWSIPLSRPELGKTLGSQSFMSNLAH------SYKVLETEALLPLIDEMMKDRAW 288

Query: 329 --KTHCLNILNESILYSLGTLRQIEFMEHFIKQIWDVHPDDAVEERNHQLDKYNLPPDTN 386
             K +C   L  +++YSLG + Q   +E +IK  W V           ++ K NL P +N
Sbjct: 289 HYKRNC--DLEAAVIYSLGYMGQFALLERYIKHTWGVSVSSNTSTEV-EVPK-NLYPTSN 344

Query: 387 ELIAILTSYCQTYKSMDRAFLLLDKLIQKYP----EPMKSRLNDNKFWIKMLQWGIKIAD 442
            LI+I++ Y     ++ +A  ++D  + K+P    EP+        FW ++ QW  ++ +
Sbjct: 345 LLISIVSCYAMK-GNLHQALQIIDSFLSKFPQIELEPL--------FWRRLFQWSTRLWN 395

Query: 443 KNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINLLHNIMKERKNVDI 502
           +   +  G   + C ++M++W  K K+              S+ I+L   I+ ER  V  
Sbjct: 396 QK-TDPKGELSNGCWQVMKQWHNKQKR--------------SLPIDL--GILNERYYV-- 436

Query: 503 GLKAIENFVQKLKL---GSVNKYYERNL----THVLYGLQKCIFRKIAESGSYNKGLALI 555
            LK   NF + L++        Y +RNL      V+   QK I +K+A  G Y+K L  I
Sbjct: 437 -LKRTNNFTEALRIHDEALAGLYMKRNLIDPEVDVIKKFQKLILKKMAGRGYYHKPLKYI 495

Query: 556 DNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQ-SNIQDREQDEFEKLQQKYDEIE 614
                 + + +E  +REY+            R  KA  + I+ R+Q + E  Q  +D  E
Sbjct: 496 SEWCLNKRNELE--MREYF-----------DRHRKAYITRIEQRKQKQ-ETAQVTFDAEE 541

Query: 615 EEGMIIGKLW 624
           E+ M++G+LW
Sbjct: 542 EDDMLLGRLW 551

>ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282C AEP2 Mitochondrial protein likely
           involved in translation of the mitochondrial OLI1 mRNA
           exhibits genetic interaction with the OLI1 mRNA 5'-
           untranslated leader
          Length = 550

 Score =  154 bits (388), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 142/483 (29%), Positives = 238/483 (49%), Gaps = 65/483 (13%)

Query: 151 TTLLSHEEMSIFICRVLKNFPTIISEKKYEILTNEGRYELYKPEVIFSLFNICKDEYCNN 210
           T  L+  E S+FI ++L       SE++ ++  +    +    E+I+ L+    D   + 
Sbjct: 124 TGGLTKSEYSLFINKLL-------SEEELDVKLSNVIPDTPHTELIYKLYEFYCDHIVDQ 176

Query: 211 TNQLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGIEQLIKSKDLTTLDNHLKL 270
            N L PL +YDLN F+K F+ E QL KA  VLD+I+ R   +  L+ + D+  L   L+L
Sbjct: 177 HN-LTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLR-RPLNDLLANTDVEILIQFLRL 234

Query: 271 KNGAIYKNWKPLTDSESNTFLQYRLSLEDKSHNFKGFKNYKFLDGWSLLKIIDMVLTD-- 328
           K GA+ K WK    S+ N+     ++L +K+ +    K+YKF +   LL+II+ VL +  
Sbjct: 235 KCGALSKFWKIQPASQRNS---TAITLGEKASDCHLAKSYKFQNEKVLLQIINSVLGEHN 291

Query: 329 -KTHCLNILNESILYSLGTLRQIEFMEHFIKQIWDVHPDDAVEERNHQLDKYNLPPDTNE 387
            K      L+ +I+YSLG L Q + +E ++ + W    D+ V+            P+++ 
Sbjct: 292 WKNRRSPKLDAAIIYSLGYLGQTDLIEKYVNRTWSPSKDEGVKTN----------PNSDL 341

Query: 388 LIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRLNDNKFWIKMLQWGIKIADKNGNN 447
           L+A+LTSYC    +M +   +LD+ I+ YPE       D  FW ++LQ    + DK  + 
Sbjct: 342 LVAVLTSYCVKEGNMRKGLEVLDRFIRDYPEVEL----DPLFWRRLLQLSSLLWDKKRDR 397

Query: 448 VNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINLLHNIMKERKNVDIGLKAI 507
              T    C  IM++W  + ++       KI  DYG  ++  L+ I    KN +  L+ I
Sbjct: 398 -KATLSHGCWTIMKQWHAQRQR-------KIPYDYG--IMKELYPIFVRTKNKNGALEVI 447

Query: 508 EN-----FVQKLKLGSVNKYYER-NLTHVLYGLQKCIFRKIAESGSYNKGLALIDNGAYT 561
                  F+Q        ++  R N   +L   Q+ I + IA  G+Y+KG       +++
Sbjct: 448 TKSFFGAFIQP-------EFTIRPNELSLLCKYQRFILKMIALKGNYHKGFEFCQEWSFS 500

Query: 562 QNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQDEFEKLQQKYDEIEEEGMIIG 621
             +  E  L+ Y++    + R    +R  +QS  +         LQ+KYDE+EE+ M++G
Sbjct: 501 STNKFE--LQSYFM----KWRGIHEQRRTSQSKQK-------AALQEKYDEMEEDDMLLG 547

Query: 622 KLW 624
           +LW
Sbjct: 548 RLW 550

>TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847
           YMR282C
          Length = 550

 Score =  145 bits (367), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 126/437 (28%), Positives = 212/437 (48%), Gaps = 51/437 (11%)

Query: 194 EVIFSLFNI-CKDEYCNNTNQLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGI 252
           E+IF+L+ I C     ++ N L PL V+D+N+FIK F+ E QLKKAQ  L ++ID+  G+
Sbjct: 159 EIIFNLYQIYCTYVIKDSQNGLTPLQVHDINRFIKRFIDEAQLKKAQECLQFLIDK-QGL 217

Query: 253 EQLIKSKDLTTLDNHLKLKNGAIYKNWKPLTDSESNTFLQYRLSLEDKSHNFKGFKNYKF 312
             +++S D+ T+   L+L+ GA+ K W+   DS S   L      ED  H FK  K+Y  
Sbjct: 218 HNILQSGDVETITQFLQLRCGALQKFWR--VDSNSTKVLG-----EDSKH-FKSPKSYNL 269

Query: 313 LDGWSLLKIIDMVLTDKTHCLN---ILNESILYSLGTLRQIEFMEHFIKQIWDVHPDDAV 369
           L     L+I++ +L DK+  L    I++ +I+YSL  L Q + ++ +I+  W +  D  V
Sbjct: 270 LKEQPFLEIVNFLLKDKSWRLRSSPIIDSAIVYSLSNLGQTKLIDQYIQLKWGISEDGHV 329

Query: 370 EERNHQLDKYNLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRLNDNKF 429
             +N  +      P    LI I+++YC       +   +LD+ ++KYP+    +L    F
Sbjct: 330 AVKNEAV------PGHEVLINIVSAYCLKNGDTGKGLRILDQFMKKYPQTELEKL----F 379

Query: 430 WIKMLQWGIKIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINL 489
           W ++LQ      DK  +         C  IM++W          E   +   Y S  + L
Sbjct: 380 WRRLLQLSFHNWDKQKDK-KALVCHGCWNIMKQWH---------EQKGVSITYDSGTLRL 429

Query: 490 LHNIMKERKNVDIGLKAIENFVQKLKLGSVNKYYE--RNLTHVLYGLQKCIFRKIAESGS 547
           L+ + K  +N   G  A E            + Y+  ++   +L   QK   + +A  G 
Sbjct: 430 LYQLFKFTRN---GRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQKLALKTMALKGR 486

Query: 548 YNKGLALIDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQDEFEKLQ 607
           YN+ L LI    +  +   +  L +Y++         R RR    +  +D+ + + ++ Q
Sbjct: 487 YNEPLQLIKE--WNVDKINQHYLLDYFM---------RHRRKYDLT--RDKARAKQQQQQ 533

Query: 608 QKYDEIEEEGMIIGKLW 624
            +YD +EEE M++G+LW
Sbjct: 534 AQYDNMEEEDMLLGRLW 550

>KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  141 bits (356), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 113/439 (25%), Positives = 204/439 (46%), Gaps = 57/439 (12%)

Query: 194 EVIFSLFNICKDEYCNNTNQLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGIE 253
           E++FSL+ +           L+PL ++D N+FI++F+R  QL+KAQ VLD I+       
Sbjct: 162 EMVFSLYQLYLKTV--TPGPLSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILK--SNNN 217

Query: 254 QLIKSKDLTTLDNHLKLKNGAIYKNWKPLTDSESNTFLQYRLSLEDKSHNFKGFKNYKFL 313
           QL    D  T  ++L+L+ GA+ +NWK L   + N     RL      +      +YK L
Sbjct: 218 QL--PCDSATATHYLQLRCGALPRNWKVL---DENLGRSTRLGARKNRYQLVS-HSYKAL 271

Query: 314 DGWSLLKIIDMVLTDKTHCLN----ILNESILYSLGTLRQIEFMEHFIKQIWDVHPDDAV 369
           D  S+L  + ++   K+   +     L  +++YSLG + Q++ +E  + + W +    ++
Sbjct: 272 DHKSVLTFMSLLSDPKSVWFHRKSAALESAVVYSLGFMGQLKLLEEHVWRNWGI----SL 327

Query: 370 EERNHQLDKYNLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRLNDNKF 429
           +E N   D     P +  L+A+LTSY    K++  A  L+D  + KYP    +   D+ F
Sbjct: 328 QEHNQVTDASFTSPSSEVLVAVLTSYASN-KNISSALHLIDGFMAKYP----TLELDHVF 382

Query: 430 WIKMLQWGIKIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINL 489
           W ++ QW  ++  +   +  G     C  +M EW     ++   +         ++L+N 
Sbjct: 383 WRRLFQWSTRVWSEK-TDPRGELSRGCWRVMREWHAARNRQLPAD---------AVLLNE 432

Query: 490 LHNIMKERKNVDIGLKAIE----NFVQKLKLGSVNKYYERNLTHVLYGLQKCIFRKIAES 545
              ++    N    ++ +E    +F QK  L        R+   +     K I + +A  
Sbjct: 433 RFVVLSRTNNYRDAIEVVEQCYSSFFQKANLS-------RHEAVLFQKFAKLILKNMAHL 485

Query: 546 GSYNKGLALIDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQDEFEK 605
           G Y+K L  I    ++ N  +E  LR Y+        +++ RR +A            +K
Sbjct: 486 GYYHKPLKFIKE--WSPNKLLEHTLRAYFEKHRNAYSARKQRRTEAA-----------QK 532

Query: 606 LQQKYDEIEEEGMIIGKLW 624
            Q+++D+ EE+ M++G+LW
Sbjct: 533 AQKRFDDEEEDSMLLGRLW 551

>Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..5995)
           [1701 nt, 567 aa]
          Length = 566

 Score =  136 bits (343), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 140/489 (28%), Positives = 224/489 (45%), Gaps = 60/489 (12%)

Query: 154 LSHEEMSIFICRVLKNFPTIISEKKYEILTNEGRYELYKPEVIFSLFNICKDEYCNNTN- 212
           L++ E+SIFI R+ K+    I      ++ N   + L   E+I+ +F +        +  
Sbjct: 120 LTYNELSIFINRIYKSNGHDIKR----VIQNH--HSLSYTELIYEIFELYTSTIPKESGI 173

Query: 213 -QLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGIEQLIKSKDLTTLDNHLKLK 271
            +LN L + DLN FI  F++E QL KAQ VL YIID  G IE++    D  T+ N L+L+
Sbjct: 174 IKLNALHLKDLNLFITIFIKEAQLSKAQNVLQYIIDAEGSIEKIT---DHDTMVNFLRLR 230

Query: 272 NGAIYKNWKPLTDSESNTFLQYRLS-LEDKSHNFKGFKNYK-FLDGWSLLKIIDMVLTD- 328
            G + K W     S + T    + S L   S N +   +YK  +    L ++I+M+L   
Sbjct: 231 CGGLPKFWLVPQASYAVTKQTKKNSRLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKK 290

Query: 329 --KTHCLNILNESILYSLGTLRQIEFMEHFIKQIWDVHPDDAVEERNHQLDKYNLPPDTN 386
             K+    IL+ +I+YSL    Q + M+ FIK+ W +       +   +  K    P   
Sbjct: 291 VWKSKHSGILDSTIVYSLAHTFQKQMMDGFIKEHWGISSHGDPLDLFIKKKKVASAPSNE 350

Query: 387 ELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRLNDNKFWIKMLQWGIKIADKNGN 446
            LIAI++SY    +++D A  +LDK I+ YP+       DN FW +++QW  ++ D   +
Sbjct: 351 ILIAIMSSYIYKDRNIDGAMKILDKFIRMYPDISL----DNMFWRRLIQWCNRLWDPKID 406

Query: 447 NVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINLLHNIMKERKNVDIGLKA 506
              GT    C  +M+ W   G  K  +        Y   +    + + K   N  I  + 
Sbjct: 407 R-QGTFGYGCWNMMKNWNGAGTGKDVVL------PYDFQIYEEFYRLFKRTNNGKIAAEI 459

Query: 507 IENF-----------VQKLKLGSVNKYYERNLTHVLYGLQKCIFRKIAESGSYNKGLALI 555
           + N            V+K +L  +NKY            Q      + E   + K    I
Sbjct: 460 VSNVLIPHLSEKNVAVKKAELNLLNKY------------QTLAMNWLIERRQFKKAAFFI 507

Query: 556 DNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQDEFEKLQQKYDEIEE 615
           +  +  +N+ ++  LRE +    + +  K S R+K +S  Q + QD       +YDE+EE
Sbjct: 508 EEWSIDRNNRIQ--LREAFKKRKQLMLRKLSTRDK-KSQSQKKRQD-------RYDEMEE 557

Query: 616 EGMIIGKLW 624
           E MIIG+LW
Sbjct: 558 EDMIIGRLW 566

>Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {ON}
           YMR282C (REAL)
          Length = 580

 Score =  131 bits (329), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 119/449 (26%), Positives = 211/449 (46%), Gaps = 54/449 (12%)

Query: 194 EVIFSLFNICKDEYCNNTNQLN-------PLMVYDLNQFIKYFLREGQLKKAQLVLDYII 246
           E  F LF++  ++     +Q+N          ++DLN  IK F+  GQL KAQ +L +I+
Sbjct: 168 EFWFKLFSLYAEKVDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKILSFIL 227

Query: 247 DRFGGIEQLIKSKDLTTLDNHLKLKNGAIYKNWK-PLTDSESNTFLQYRLSLEDKSHNFK 305
           DR   I    ++ D+ T+ + L+L+ GA+   WK P         L+  + L  K+ + +
Sbjct: 228 DRNPDILLSPRNADIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIR 287

Query: 306 GFKNYKFLDGWSLLKIIDMVLTDKTHCLNI--LNESILYSLGTLRQIEFMEHFIKQIWDV 363
               YK +D  +LLKI D+VL DK   LN   L  +++ S G L Q + +E  I+ IW +
Sbjct: 288 LSSTYKAMDHQTLLKIADLVLQDKRF-LNSEDLLSTLIQSFGHLGQTQILERCIEHIWQI 346

Query: 364 HPDD-----AVEERNHQLDKYNLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPE 418
              +     A++ R          P +  LI+IL S+    K + R   +LD  I+ YPE
Sbjct: 347 SSQEFPSHVAIKPR-------GCYPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYPE 399

Query: 419 PMKSRLNDNKFWIKMLQWGIKIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKI 478
                L    FW ++LQ     A    N+    +I  C  +M+ W+   +   ++     
Sbjct: 400 VKLDAL----FWRRLLQLS-HFAWTPVNDKRAASIVKCWHLMKHWYESKELSPSV----- 449

Query: 479 DDDYGSILINLLHNIMKERKNVDIGLKAIENF---VQKLKLGSVNKYYERNLTHVLYGLQ 535
             DY +  +  L+ +MK+  N  +G+  +++F   ++K++  +  K     L  +L   Q
Sbjct: 450 --DYET--LRQLYEVMKKTGNFSLGIDVLKSFKSGIEKMRTANPEK-----LEAILIKYQ 500

Query: 536 KCIFRKIAESGSYNKGLALIDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNI 595
           KCI +++   G  +     I +  + + +      ++  I     I    SR  K +++I
Sbjct: 501 KCIIKQLVNRGKISAARKFIGDFGFNRRAA-----KDLNIFCSNRI---FSRSKKIKNDI 552

Query: 596 QDREQDEFEKLQQKYDEIEEEGMIIGKLW 624
           +++++ +       YD+ E++GMIIG LW
Sbjct: 553 ENKKKRD-GLAPGNYDDDEDDGMIIGSLW 580

>YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON}
           AEP2Mitochondrial protein, likely involved in
           translation of the mitochondrial OLI1 mRNA; exhibits
           genetic interaction with the OLI1 mRNA 5'-untranslated
           leader
          Length = 580

 Score =  130 bits (326), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 118/447 (26%), Positives = 218/447 (48%), Gaps = 50/447 (11%)

Query: 194 EVIFSLFNICKDEYCNNTNQLN-------PLMVYDLNQFIKYFLREGQLKKAQLVLDYII 246
           E  F LF++  ++     NQ+N          ++D N  IK F+  GQL KAQ +L +I+
Sbjct: 168 EFWFKLFSLYAEKVDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKILSFIL 227

Query: 247 DRFGGIEQLIKSKDLTTLDNHLKLKNGAIYKNWK-PLTDSESNTFLQYRLSLEDKSHNFK 305
           DR   I    K+ D++T+ + L+L+ GA+   WK P    +   FL+  + L  K+ + +
Sbjct: 228 DRNPDILLSPKNADISTIVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRLGAKNTSIR 287

Query: 306 GFKNYKFLDGWSLLKIIDMVLTDKTHCLNI--LNESILYSLGTLRQIEFMEHFIKQIWDV 363
               YK +D  +LLKI D+ L +K   LN   L  +++ S G L Q + +E  I+ IW +
Sbjct: 288 LSSTYKAMDHQTLLKIADLALQEKK-LLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQI 346

Query: 364 HPDDAVEERNHQLDKY-NLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKS 422
            P    E  +H + K+    P +  L++IL S+      + R   +LD  I+ YP+    
Sbjct: 347 SPQ---EFPSHVVIKHRGCYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKL- 402

Query: 423 RLNDNKFWIKMLQWGIKIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDY 482
              D  FW ++ Q     A    N+   T++  C  +M++W+   + + ++       DY
Sbjct: 403 ---DALFWRRLFQLS-HFAWTPANDKKATSVVRCWHLMKQWYASKRLRPSV-------DY 451

Query: 483 GSILINLLHNIMKERKNVDIGLKAIENF---VQKLKLGSVNKYYERNLTHVLYGLQKCIF 539
            +  +  L++IMK+  N  +G+  + +F   +++ +  +  K     + +++   QKCI 
Sbjct: 452 ET--LRQLYDIMKKTGNFPLGIDVLRSFKPGIERTRAENAGK-----VNNIIIKYQKCII 504

Query: 540 RKIAESGSYNKGLALIDNGAYTQNSGVESMLREYYITTVKE--IRSKRSRRNKAQSNIQD 597
           +++   G ++     ID+  + +      M ++  I       +RSK     K ++ I++
Sbjct: 505 KELVNRGRFSAVREFIDSYGFDRK-----MTKDLNIFCANRMFLRSK-----KMKNKIEN 554

Query: 598 REQDEFEKLQQKYDEIEEEGMIIGKLW 624
           +++ E  +L    D+ E++GMIIG LW
Sbjct: 555 KKEREKVRLDSF-DDDEDDGMIIGSLW 580

>Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282C
           (AEP2) - basic, hydrophilic 67.5 kDa protein [contig 39]
           FULL
          Length = 546

 Score =  129 bits (323), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 119/429 (27%), Positives = 195/429 (45%), Gaps = 75/429 (17%)

Query: 214 LNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGIEQLIKSKDLTTLDNHLKLKNG 273
           LNPL ++DLN F++YF+   QL KAQ+VLD I+      +QL    D TT  ++L+L+ G
Sbjct: 175 LNPLQLHDLNSFVQYFIETAQLGKAQIVLDRILA--SNNDQL--PCDTTTGIHYLQLRCG 230

Query: 274 AIYKNWKPLTD--SESNTFLQYRLSLEDKSHNFKGFKNYKFLDGWSLLKIIDMVLTDKTH 331
           A+ +NWK        S     +R   +  SH       YK LD  S+L+ ++++  + + 
Sbjct: 231 ALPRNWKVFDSRVGHSCRLGSHRNKSQPVSH------TYKALDQSSVLEFVNVLNDENSE 284

Query: 332 CLN----ILNESILYSLGTLRQIEFMEHFIKQIWDVHPDDA--VEERNHQLDKYNLPPDT 385
             +     L  +++YSLG + Q+  ++  I   W +    A    E N       +PP  
Sbjct: 285 WFHKKSPTLEAAVIYSLGFMGQLTLLKEHIAVRWGITELGASLATEVNE------VPPSP 338

Query: 386 NELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRLN-DNKFWIKMLQWGIKIADKN 444
             LIAI TS+  +++ +     L+D  I KY E     +N D  FW ++ QW   + D  
Sbjct: 339 EVLIAIFTSFA-SHQEVTLGLRLMDAFITKYSE-----INLDIVFWRRLFQWTNLVWDVK 392

Query: 445 GNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINLLHNIMKERKNVDIGL 504
             +  G     C  +M EW  KG KK   +         + L+N  + ++ +  N    L
Sbjct: 393 -TDPRGDLSRGCWRVMTEWHEKGSKKLQPD---------TTLLNERYFVLAQTNNYKEAL 442

Query: 505 KAIENFVQKL---------KLGSVNKYYERNLTHVLYGLQKCIFRKIAESGSYNKGLALI 555
             I     +L         ++  V KY             K + + +AE G Y+K L  I
Sbjct: 443 TVISQSFPQLYEKPTLSSKEMAIVQKY------------SKLVLKSMAELGYYHKPLTFI 490

Query: 556 DNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQDEFEKLQQKYDEIEE 615
               ++ N  VE  LR Y+    K+ R   ++R       ++R ++E  + Q  YD+ EE
Sbjct: 491 TE--WSPNKAVEDSLRVYF----KKHRDGFTKR-------KERLREESRRKQNTYDDEEE 537

Query: 616 EGMIIGKLW 624
           + M++G+LW
Sbjct: 538 DNMLLGRLW 546

>Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {ON}
           YMR282C (REAL)
          Length = 576

 Score =  120 bits (301), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 122/449 (27%), Positives = 214/449 (47%), Gaps = 61/449 (13%)

Query: 196 IFSLFNICKDEYCNNTN----QLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGG 251
           IFSL+    D   N+ N     L+   ++D+N  I+ F+  GQL KAQ +L +IIDR   
Sbjct: 169 IFSLYAEKVDAKRNHINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPD 228

Query: 252 IEQLIKSKDLTTLDNHLKLKNGAIYKNWK-PLTDSESNTFLQYRLSLEDKSHNFKGFKNY 310
           I     + D+ T+ + LKL+ GA+   WK P    +    L+  + L  K+ + +    Y
Sbjct: 229 ILLSPNNADIGTMVHFLKLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTY 288

Query: 311 KFLDGWSLLKIIDMVLTDKTHCLNI--LNESILYSLGTLRQIEFMEHFIKQIWDVHPDD- 367
           K +D  +LLKI D+VL +K   LN   L  +++ S G L Q + +E  I+ IW +   + 
Sbjct: 289 KVMDHQTLLKIADLVLHEKRF-LNSEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEF 347

Query: 368 ----AVEERNHQLDKYNLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSR 423
               A++ R          P +  LI+IL S+      + R   +LD  I+ YPE     
Sbjct: 348 PSHVAIKPR-------GCYPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDA 400

Query: 424 LNDNKFWIKMLQWGIKIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYG 483
           L    FW ++ Q     A     +   T++  C  +M++W +      ++       DY 
Sbjct: 401 L----FWRRLFQLS-NFAWTPAKDKKATSVIRCWHLMKQWHVSKGLSLSV-------DYE 448

Query: 484 SILINLLHNIMKERKNVDIGLKAIENF---VQKLKLGSVNKYYERNLTHVLYGLQKCIFR 540
           +  +  L++IMK+  N  +G+  +++F   +++L+  + +K     L  VL   QK I +
Sbjct: 449 T--LRQLYDIMKKTGNFPLGIDVLKSFKSGIERLRETNSDK-----LNIVLIKYQKYIIK 501

Query: 541 KIAESGSYNKGLALIDNGAY----TQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQ 596
           ++ + G  +     I++  +    T+N  +       + T    +RSK     K +S I+
Sbjct: 502 QLVDRGRISAVREFINDFGFDRTITKNLNI-------FCTNRLLLRSK-----KNKSKIE 549

Query: 597 D-REQDEFEKLQQKYDEIEEEGMIIGKLW 624
           + +E+++ E     +D+ E++GMIIG LW
Sbjct: 550 NKKERNKLE--PSGFDDDEDDGMIIGSLW 576

>Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {ON}
           YMR282C (REAL)
          Length = 581

 Score =  115 bits (288), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 115/441 (26%), Positives = 207/441 (46%), Gaps = 38/441 (8%)

Query: 194 EVIFSLFNICKDEYCNNTNQLN-------PLMVYDLNQFIKYFLREGQLKKAQLVLDYII 246
           E  F LF++  ++     NQ+N          ++D+N  IK F+  GQL KAQ VL +I+
Sbjct: 169 EFWFKLFSLYAEKVDVKRNQINLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFIL 228

Query: 247 DRFGGIEQLIKSKDLTTLDNHLKLKNGAIYKNWKPLTDSESNTFLQYRLSLEDKSHNFKG 306
           DR   I    K+ D+ T+ + L+L+ GA+   WK + D+    + +  + L  K+ + + 
Sbjct: 229 DRNSDILLSPKNADIGTIIHFLQLRCGALAAYWK-MPDNSEQKYSRKMVRLGAKNTSIRI 287

Query: 307 FKNYKFLDGWSLLKIIDMVLTDKTHCLNI--LNESILYSLGTLRQIEFMEHFIKQIWDVH 364
             +YK +D  +LLKI D+VL  K   LN   L  +++ S G L Q + +E  I+ IW + 
Sbjct: 288 TSSYKAMDHQTLLKIADLVL-QKERLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQIS 346

Query: 365 PDDAVEERNHQLDKYNLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRL 424
             +       +       P +  LI+IL S+      + R   +LD  I+ YPE     L
Sbjct: 347 LQEFPSHATIKPKTRGCCPSSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDEL 406

Query: 425 NDNKFWIKMLQWGIKIADKNGNNVNGTTIDNCLEIMEEWF-LKGKKKTALEHWKIDDDYG 483
               FW ++ Q     A    ++   T+I  C  +M++W   KG        + +  DY 
Sbjct: 407 ----FWRRLFQLS-HFAWTPTHDKRATSIVRCWHLMKQWHESKG--------FSLSVDYE 453

Query: 484 SILINLLHNIMKERKNVDIGLKAIENFVQKLKLGSVNKYYERNLTHVLYGLQKCIFRKIA 543
           +  +  L+++ K+  N  +G+  ++NF   +   S  K     +  ++   QK I +++ 
Sbjct: 454 T--LRQLYDLTKKTGNYSLGIDVLQNFKPGITRTSAMK--TEKINGIVIKHQKYIIKQLV 509

Query: 544 ESGSYNKGLALIDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQDEF 603
             G  +     I++ ++   +  E      + T    +RSK+  +NK + N ++R +   
Sbjct: 510 NRGKTSAAREFINDFSFDIGAVKE---LNVFCTNRILLRSKK-LKNKTE-NRKERNRSG- 563

Query: 604 EKLQQKYDEIEEEGMIIGKLW 624
              Q  +D+ +++GM+IG LW
Sbjct: 564 ---QGNFDDDDDDGMVIGSLW 581

>TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}
           Anc_8.847 YMR282C
          Length = 569

 Score =  114 bits (284), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 139/547 (25%), Positives = 252/547 (46%), Gaps = 103/547 (18%)

Query: 114 LAQKDNGKVLTTILDHCL-YSPNEQATTRQLVKENNHLTTLLSHEEMSIFICR------- 165
           L QK N   L TIL+  L ++ N     R+L++        L+  E SIF+ R       
Sbjct: 90  LFQKSN---LKTILEQLLQHNDNSYMFLRELLESKQ-----LTFNEFSIFLNRLIDRKGF 141

Query: 166 -----VLKNFPTIISEKKYEILTNEGRYELYKPEVIFSLFNICKDEYCN--NTNQLNPLM 218
                VLK FP              G++     E++F LF +    Y N   +++L+ L 
Sbjct: 142 IYDSIVLKEFPN-------------GKH----SEMVFKLFQL----YGNAIGSDKLSLLS 180

Query: 219 VYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGIEQLIKSKDLTTLDNHLKLKNGAIYKN 278
           + D+N FI++F+ EG L +A++VL +++++   I  L    D+ T+ ++L+L+ GA+ + 
Sbjct: 181 LRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRSILDLY---DVDTVTHYLQLRCGALPRY 237

Query: 279 WK--------PLTDSESNTFLQYRLSLEDKSHNFKGFKNYKFLDGWSLLKIIDMVLTD-- 328
           W            D   N   +Y+  L  K+   K    YK LD   +LKI + ++TD  
Sbjct: 238 WMFQNKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLTNRYKILDPLGVLKIANKIITDDK 297

Query: 329 -KTHCLNILNESILYSLGTLRQIEFMEHFIKQIW--DVHPDDAVEERNHQLDKYNLPPDT 385
            K++    L+ +++YSL    Q+  +  +I   W  D+   D   +   Q+      P  
Sbjct: 298 WKSNHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGNSDVGTQISNEASKPLP 357

Query: 386 NELI-AILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRLNDNKFWIKMLQWGIKIADKN 444
           +E++ AIL+SY    KS++RA  ++DK++  YP      LN  +FW +++QW +   D  
Sbjct: 358 SEVMEAILSSYSYDDKSIERAINIIDKIMNSYPNL---ELN-QQFWRRLMQWSVLCWDHK 413

Query: 445 GNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINLLHNIMKERKNVDIGL 504
            +   G+ +  C + +       KK   +   +I+ D G  L+  L+ ++   KN  I  
Sbjct: 414 LDR-KGSLVYGCFKTL-------KKYHEMRSIRINFDEG--LLQELYTLVYYTKNSRIAA 463

Query: 505 KAIENFVQKLKLGSVNKYYERNLTHVLYGLQKCI--FRKIAESG-----SYNKGLALIDN 557
           + +  F+ +        +Y+R+   + +G +K +  F+K +  G      Y      I+ 
Sbjct: 464 EVVSEFMPQF-------FYKRS-DEITFGERKLLFYFQKRSIDGMLGKKDYFTASNFIEK 515

Query: 558 GAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQDEFEKLQQKYDEIEEEG 617
            +   N   E + + Y  +  K++  ++ RRN  Q  I+       EKL+   D  +E+ 
Sbjct: 516 WS-MDNQNKEELFKYYKDSIAKKL--QKVRRNSLQQKIK-------EKLE---DHSDEDD 562

Query: 618 MIIGKLW 624
            ++G+LW
Sbjct: 563 TLLGRLW 569

>CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282c AEP2 required for the expression of
           subunit-9 of atp synthase
          Length = 548

 Score = 92.4 bits (228), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 111/433 (25%), Positives = 189/433 (43%), Gaps = 58/433 (13%)

Query: 209 NNTNQLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFG--GIEQLIKSKDLTTLDN 266
           +N   ++ L   D+N+FIK F+   QLK+AQ  L +++D +   G + L    D  T+ +
Sbjct: 157 HNGGSVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAH 216

Query: 267 HLKLKNGAIYKNWKPLTDSESNTFLQYRLSLEDKSHNFKGFKNYKFLDGWSLLKIIDMVL 326
            L L++GA+   WK +  S  N   Q    +     N K    Y  LD   L +I+  +L
Sbjct: 217 FLMLRSGALQDLWK-IDVSNGNNKKQAFYKINGSHRNVKS--TYNVLDSVKLFEIVRYIL 273

Query: 327 --TDK-THCLNI-LNESIL----YSLGTLRQIEFMEHFIKQIWDVHPDDAVEERNHQLDK 378
              DK  H   +  +E IL      LG + Q   +E  I +IW++   D+V        K
Sbjct: 274 RYNDKDNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWEL---DSVSVP----PK 326

Query: 379 YNLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRLNDNKFWIKMLQWGI 438
           YN+   ++ L AI+++Y +  KS+    ++ DK   K P  +      + FWI + +W I
Sbjct: 327 YNITVTSDLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVK----DDFWINLQKWNI 382

Query: 439 KIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSIL---INLLHNIMK 495
            + +K       +TID          L  +    ++ W+   + G  +   +  L+ + K
Sbjct: 383 ILPNK-----WRSTID----------LSKRTWELMKSWRNSTNNGGFITANVEFLNLVYK 427

Query: 496 ERKNVDIGLKAIENFVQKLKLGSVNKYYERNLT----HVLYGLQKCIFRKIAESGSYNKG 551
              +  I LK +E      +   V  Y + +LT     +L   Q    +K+   G Y+K 
Sbjct: 428 VLSSDYIKLKDLEWIYDIFQHSLVTLYSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKC 487

Query: 552 LALIDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQDEFEKLQQKYD 611
           L  I   +Y  ++  +  L   ++        KR             ++ E  K+Q+KYD
Sbjct: 488 LQFIKEWSY--DAANKQQLTNLFVVLRNRYLQKRGY----------NQEKEMTKVQKKYD 535

Query: 612 EIEEEGMIIGKLW 624
           E E+E M++G LW
Sbjct: 536 EEEQEDMLLGGLW 548

>KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {ON}
           Anc_8.847 YMR282C
          Length = 474

 Score = 91.3 bits (225), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 104/436 (23%), Positives = 185/436 (42%), Gaps = 76/436 (17%)

Query: 192 KPEVIFSLFNICKDEYCNNTNQLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGG 251
           +PE+IF LF     +  ++  +L  L V D+N+FI YF+   QLKKAQLV+ Y+I +   
Sbjct: 112 RPEIIFQLFET-YVKLISSHEELTILQVEDMNKFINYFVEFKQLKKAQLVMKYLILK--- 167

Query: 252 IEQLIKSKDLTTLDNHLKLKNGAIYKNWKPLTDSESNTFLQYRLSLEDKSHNFKGFKNYK 311
             ++++  D++T  N+LKL  GA ++ W                           + NYK
Sbjct: 168 SPRVLEKYDVSTTRNYLKLNCGACHELW---------------------------YTNYK 200

Query: 312 FLD--GWSLLKIIDMVLTDKTHCLNILNESILYSLGTLRQIEFMEHFIKQIWDVHPDDAV 369
             D    +L K++   L +K    ++    I++SLG   +I  +E +I + W +   D  
Sbjct: 201 IFDFNNTTLDKLVKYSLDNKIGYWDV---EIIHSLGYSGRIRSLEDYILKKWGISLCDRA 257

Query: 370 EERNHQLDKYNLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRLN-DNK 428
                Q++  N  P++  L AI+  +    K M RA  +L++ +  YP+     LN    
Sbjct: 258 -----QVNTTNEAPESEVLEAIINGFFYRDKRMFRAIKILNEFVNVYPD-----LNLKIT 307

Query: 429 FWIKMLQWGIKIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILIN 488
           FW   +   IK  D+  +   G  I    E M+ W+    ++           +    + 
Sbjct: 308 FWKTFMNNCIKEWDEKVDQ-KGVVIVEYWETMKRWYTVHNRRIP---------FNINFLK 357

Query: 489 LLHNIMKERKNVDIGLKAIENFVQKLKLGSVNKYYERNLTHVLYGLQKCIFRKIAESGSY 548
           ++    K+  N+ +     +N        +       +  +V+   Q  I  ++ E   +
Sbjct: 358 VMRTCFKKNNNLVLATDIFQNCFHNFYFCATRM--NDSELNVIKEYQNFILSRLIEKKGF 415

Query: 549 NKGLALIDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQDEFEKLQQ 608
           +  L  I++  ++  +  + M    Y    KE + K+  RN              E L++
Sbjct: 416 SNALTFINDHCFSLENKRQLM---NYYHGRKEHKLKKMTRN--------------ENLEK 458

Query: 609 KYDEIEEEGMIIGKLW 624
            YD++ EE  IIGKLW
Sbjct: 459 TYDDMVEEDFIIGKLW 474

>KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.847
           YMR282C
          Length = 474

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 97/402 (24%), Positives = 183/402 (45%), Gaps = 60/402 (14%)

Query: 194 EVIFSLFNICKDEYCNNTNQLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGIE 253
           E  F++F   K      +N+L  + ++D N    YF+   QLKKAQL++D++      ++
Sbjct: 113 EKFFAIFMRYKGAIALQSNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFL------LQ 166

Query: 254 QLIKSKDLTTLDNHLKLKNGAIYKNWKPLTDSESNTFLQYRLSLEDKSHNFKGFKNYKFL 313
           Q +K  D+  + N+ KL+ G+ +                 + +L +K+        YK  
Sbjct: 167 QDVKF-DVFMIKNYTKLRCGSSFG----------------KQTLNNKA--------YKVF 201

Query: 314 DGWSLLKIIDMVLTDKTHCLNILNESILYSLGTLRQIEFMEHFIKQIWDVHPDDAVEER- 372
           D  ++ ++I  V  D+       N  I+ SLG    I  ME +I  +W +   D   E  
Sbjct: 202 DQNTVFQLIGKVEADRKFAF--WNNEIVSSLGYTNNITLMEIYIWDLWRISIHDHSTENI 259

Query: 373 --NHQLDKYNLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRLNDNKFW 430
             +H      + P +  L  I++SY +  ++M RA  ++++  + YP+ +   LN + FW
Sbjct: 260 KIDHLQQGDAMYPSSKVLATIVSSYARHDQTMKRAVDIVERFAKSYPKLL---LNVH-FW 315

Query: 431 IKMLQWGIKIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINLL 490
             +L   IK     G + + +    C  +M++W  +  K    +         ++L+ +L
Sbjct: 316 STLLNCAIKC----GGSKDPSQFLACWNLMKKWHTQRSKLMPFQ--------SALLVTIL 363

Query: 491 HNIMKERKNVDIGLKAIENFVQKLKLGSVN-KYYERNLTHVLYGLQKCIFRKIAESGSYN 549
              M++  N+   +  ++ ++  L L   N   +ER+   VL   QK I RK+ +   YN
Sbjct: 364 R-YMRQTSNLHGTVDILQYWLGPLYLKRGNIPEFERD---VLIKYQKQILRKLVDKRKYN 419

Query: 550 KGLALIDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKA 591
              A ID   ++ ++  +  L  +Y + V ++R  ++RR KA
Sbjct: 420 WCTAFIDQ--WSIDASNKEDLEAFYESRV-DVRESKTRREKA 458

>Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {ON}
           similar to Ashbya gossypii ABL119C
          Length = 527

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 135/570 (23%), Positives = 239/570 (41%), Gaps = 82/570 (14%)

Query: 36  RQVIRMFSRAKTLSSPSTLDELPNNRSSENALIDDQLSKTNTKKRYTFNPKKKQPLIRTS 95
           RQ +R+  R    SS S LD      +  N +  D L          ++P + +   R +
Sbjct: 5   RQFVRIIKRVN--SSTSNLDA-----NVANGISSDTLQARAMVFHKQYDPVRVE---RKA 54

Query: 96  LKPTIHNSKARKGLLHLLLAQKDNGKVLTTILDHCLYSPNEQATTRQLVKENNHLTTLLS 155
           LK T+  S          L + D  ++L + LD    S +         +E       +S
Sbjct: 55  LKNTLSKS---------YLYENDKYQMLRSFLDDTKLSGDVHPGGLPACQE-------MS 98

Query: 156 HEEMSIFICRVLKNFPTIISEKKYEILTNEGRYELYKPEVIFSLFNICKDEYC-----NN 210
            EE SIF  R+L    +  S K           E     ++  L N     Y        
Sbjct: 99  SEEFSIFFNRLLPTSGSSFSLK-----------EAIPENMVVPLANKLYQFYMAILEREK 147

Query: 211 TNQLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGIEQLIKSKDLTTLDNHLKL 270
             +  P+ ++DLN+F  +FL E +LK A+ VL  I+ R  G EQL   +D  TL  + +L
Sbjct: 148 KTRFTPMELHDLNKFSNWFLNENKLKLARKVLQQIL-RQTGSEQL--PRDHQTLVTYFQL 204

Query: 271 KNGAIYKNWKPLTDSESNTFLQ-YRLSLEDKSHNFKGFKNYKFLDGWSLLKIIDMVLT-- 327
             G++   W P    +S  + +  R S   K      +  Y  L    +  ++  +L   
Sbjct: 205 YLGSLASLW-PTPKVQSACYDKLVRGSRRPK------YVVYNSLPEGIMYDVLQKLLEND 257

Query: 328 DKTHCLNI-LNESILYSLGTLRQIEFMEHFIKQIWDV--HPDDAVEERNHQLDKYNLPPD 384
           D  H  +  L+  ILYSL    +++  E F+++ W +  HP    +E    +      P 
Sbjct: 258 DWKHLRSSELDAKILYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISSGTY-PG 316

Query: 385 TNELIAILTSYCQTYKS-MDRAFLLLDKLIQKYPEPMKSRLNDNKFWIKMLQWGIKIADK 443
           +  LIAI+TS+  +Y++ +++A  L+D  + KYP+ M  R    +FW K+  W   + D+
Sbjct: 317 SEVLIAIVTSF--SYRNDLEKAVRLVDAFLNKYPQ-MDLR---TEFWEKLFLWTRVMFDR 370

Query: 444 NGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINLLHNIMKERKNVDIG 503
             + + G+    C   M  W+ K + ++          Y S L +  + I+K+  N    
Sbjct: 371 KLDPL-GSLQKACWLRMLSWY-KSRGESV--------PYSSYLASCRYEILKQTSNYKDA 420

Query: 504 LKAIENFVQKLKLGSVNKYYERNLTHVLYGLQKCIFRKIAESGSYNKGLALIDNGAYTQN 563
           +    +++  +   S     + NLT V+   QK + R+++  G  +     I+   + + 
Sbjct: 421 MAMFPDYMSAVYAKSAAA--KHNLT-VVRKYQKFVIRELSARGKRDACTQFIEQWRFNEE 477

Query: 564 SGVE---SMLREYYITTVKEIRSKRSRRNK 590
           +  E   +  R +   T+++ + + S RNK
Sbjct: 478 NEKELQDTFQRHWNKYTIRQEKRRSSARNK 507

>TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {ON}
           Anc_8.847 YMR282C
          Length = 613

 Score = 76.3 bits (186), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 95/412 (23%), Positives = 188/412 (45%), Gaps = 43/412 (10%)

Query: 211 TNQLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGIEQLIKSKDLTTLDNHLKL 270
           +  LNP+ +YDLN+ I +F++ GQLKKA   L YI+ R+    ++ +  D  T+ N LKL
Sbjct: 218 STPLNPIQLYDLNKVITWFIKAGQLKKATTALMYILKRYNA--EIFQIPDSKTIINFLKL 275

Query: 271 KNGAIYKNWK--PLTDSESNTFLQYRLSLEDKSHNFKGFKNYKFLDGWSLLKII------ 322
             G +  NW+  P+         +    L + S  ++   +YK +     ++I+      
Sbjct: 276 YCGGLPTNWRIEPINHRFIKNQGKRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKN 335

Query: 323 --DMVLTDKT-HCLNI--LNESILYSLGTLRQIEFMEHFIKQIWDVHPDDAVEERNHQLD 377
             DM L+ K  H +     + +++YSL +L + +  E + K  W     D VE       
Sbjct: 336 TNDMKLSGKLFHFIRTGEFDSTLIYSLTSLGRFDLAEQYFKDNWLSDSCDDVE------- 388

Query: 378 KYNLPPDTNELIAILTSYC-QTYKSMDRAFLLLDKLIQKYPEPMKSRLNDNKFWIKMLQW 436
              L  D   +IAI +SY      ++++A  L+ ++I++YP+     LN +  W ++++W
Sbjct: 389 ---LTSDI--VIAIFSSYVYNNSNNIEKANKLIQEIIKRYPD---LHLNIST-WCRIIRW 439

Query: 437 GIKIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINLLHNIMKE 496
            I++ D   +       D+   ++  +     + +  +   I   Y  +L+  L+++   
Sbjct: 440 NIQMWDTTTDFNGEIPYDSFYTMLTYYSNYCSRNSTFKSCHI--PYNKMLLGDLYHLFNT 497

Query: 497 RKNVDIGLKAIENFVQKLKLGSVNKYYERNLTHVLYGLQKCIFRKIAESG--SYNKGLAL 554
           + +++  L  ++N  +K    + +K   ++   +L   QK I + +      + NK L  
Sbjct: 498 KISLNKCLFIMDNCFKKSLFKTPSKVTTKDY-QILLKYQKMILKYLINDRKLTSNKPLDF 556

Query: 555 IDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQDEFEKL 606
           I+   Y+ ++  +  L EY +    E    R  R +   N+   E++  EK+
Sbjct: 557 IE--KYSLDTNNKEQLLEYRL----ERLEYRKSRKEYYGNLNANEKNSIEKI 602

>KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 518

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 104/482 (21%), Positives = 206/482 (42%), Gaps = 80/482 (16%)

Query: 111 HLLLAQKDNGKVLTT-----ILDHCLYSPNEQA--TTRQLVKENNHLTTLLSHEEMSIFI 163
           +++   K N  +LT+      L H  +  N +   TTR L   N  LT     E+ S+F+
Sbjct: 51  NIVTPNKPNTNLLTSKQPIKALKHLQWKTNLRVKKTTRLLKYSNEKLTP----EDYSVFV 106

Query: 164 CRVLKNFPTIISEKKYEILTNEGRYELYKPEVIFSLFNICKDEYCNNTNQLNPLMVYDLN 223
            +++      +  K  E+L         K EV  SL++I +    N  +  N +++YDLN
Sbjct: 107 NQLMD-----VYSKDIELLN--------KTEVWKSLYHIYRVFVVNAVDDGNAMVLYDLN 153

Query: 224 QFIKYFLREGQLKKAQLVLDYII--DRFGGIEQLIKSKDLTTLDNHLKLKNGAIYKNWKP 281
           QF++ F+    L  A+ V   I+   + G I      KD+ T+  +L+L  GA+ + W  
Sbjct: 154 QFVRMFINLNDLPLARNVFQLILKNSKNGEI-----PKDVQTICMYLRLYCGALSELW-- 206

Query: 282 LTDSESNTFLQYRL---------SLEDKSH---NFKGFKNYKFLDGWSLLKIIDMVLTDK 329
            T   S  F Q  +         S+   SH      G   ++ L    L K+++     K
Sbjct: 207 -TTQTSRNFYQDLIGSLSGSNASSIRIPSHIAYPTIGVPQFQLL----LRKLVEDPEYSK 261

Query: 330 THCLNILNESILYSLGTLRQIEFMEHFIKQIWDVHPDDAVEERNHQLDKYNLPPDTNELI 389
                 ++  I+ +LG  +++ F++ +I   + +  +  + E +  + K  L PD+  L 
Sbjct: 262 LRNTE-MDSLIIQALGHYKEVPFLKQYISIFYGIDENVTITETHPGIKK--LTPDSQLLK 318

Query: 390 AILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRLN-DNKFWIKMLQWGIKIADKNGNNV 448
           +++++Y     ++     ++   ++KYPE     +N D  FW   + W ++  +K  ++ 
Sbjct: 319 SVISAYGHN-NNITSGMTVIGSFMEKYPE-----MNLDKSFWRTTIYWSLREWNKYKDS- 371

Query: 449 NGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINLLHNIMKERKNVDIGLKAIE 508
            G+       +M  W+    K    +          I++  L + +K RK+ +  ++ ++
Sbjct: 372 KGSQPKKAWNLMLNWYATIGKAVPFDQ--------KIMLYRL-SFLKSRKDHNAAIRDVQ 422

Query: 509 NFVQKLKLGS-VNKYYERNLTHVLYGLQKCIFRKIAESGSYNKGLALI-------DNGAY 560
              +++ + +  N +    L  VLY  Q+ I + +       K +  I       +NG Y
Sbjct: 423 QVFKRIFIKTEKNTFIVERL--VLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRY 480

Query: 561 TQ 562
            +
Sbjct: 481 LE 482

>NCAS0G04310 Chr7 (802074..802571) [498 bp, 165 aa] {ON} Anc_1.535
           YKL214C
          Length = 165

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 47/78 (60%), Gaps = 9/78 (11%)

Query: 402 MDRAFLLLDKLIQKYPEPMKSRLNDNK-FWIKMLQWG-IKIADK-----NGNNVNGTTID 454
           +D +  +++ +I+++P+P+ S+  D K   I ++++G   + DK     N   +NG+TI 
Sbjct: 29  LDVSDFVIEDMIKEFPQPIYSKFYDTKDSRIFIVEFGDPTVMDKVIEKYNATELNGSTI- 87

Query: 455 NCLEIMEEWFLKGKKKTA 472
             +E+ E+  LKG+K+ +
Sbjct: 88  -TVEMYEQLPLKGRKQRS 104

>KLTH0D01430g Chr4 complement(133354..136428) [3075 bp, 1024 aa]
           {ON} weakly similar to uniprot|P40987 Saccharomyces
           cerevisiae YOR349W CIN1 Tubulin folding factor D
           involved in beta-tubulin (Tub2p) folding isolated as
           mutant with increased chromosome loss and sensitivity to
           benomyl
          Length = 1024

 Score = 35.0 bits (79), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 69/162 (42%), Gaps = 32/162 (19%)

Query: 204 KDEYCNNTNQLNPLMVYDLNQFIKYFLREGQLKKAQLVLD---------YIIDRFGGIEQ 254
           +  + N T+ L     Y +N  +K  LR+GQ+ + Q VLD         + ID      +
Sbjct: 165 RSSFSNETSDL-----YTVNFTLKAVLRQGQVHERQAVLDSAALNNLTSFCIDNADSANE 219

Query: 255 LIKSKDLTTLDNHLKLKNGAIYKNWKP-------LTDSESNTFLQYRLSLEDKSHNF-KG 306
           +       TL    KL   A ++NW+        L DS +  F + R  L   +HNF K 
Sbjct: 220 IKLKLTFKTLPKLCKLH--AAHRNWEAIEEIASWLLDSFNVPFTELRFQL---AHNFAKI 274

Query: 307 FKNYKFLDGWSLLKIIDMVLTDKTHCL-----NILNESILYS 343
            +    LD  S   +I+ ++ D  H L     N ++E  L++
Sbjct: 275 MELLMALDPESASSLIESIVHDARHTLSSNPTNTIDEDTLHT 316

>Skud_6.65 Chr6 (125679..132110) [6432 bp, 2143 aa] {ON} YFL007W
           (REAL)
          Length = 2143

 Score = 34.7 bits (78), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 57/141 (40%), Gaps = 17/141 (12%)

Query: 46  KTLSSPSTLDELPNNRSSENALIDDQLSKTNTKKRYTFNPKKKQPLIRTSLKPTIHNSKA 105
           KTLS    +D  P   SS    I     K    + +T   +   PL   S  PT+ + K 
Sbjct: 18  KTLSQLKRVDRSPGRPSSSQGEI-----KRKRSRLFTSEARPDSPLRARSATPTVQDQKL 72

Query: 106 RKGL-LHLLLAQKDNGKVLTTILDHC-----LYSPNEQATTRQLVKENNHLTTLL----- 154
             G+   LLL ++     L  + D       +Y PN +  +R  V+    +   L     
Sbjct: 73  FNGMDSTLLLNERLQHYTLDYVSDRGQHIKNIYDPNSRWFSRS-VRPEFPIEEFLPYKTE 131

Query: 155 SHEEMSIFICRVLKNFPTIIS 175
           SHE+ + ++C VL N    IS
Sbjct: 132 SHEDQAKYLCHVLVNLYIAIS 152

>TPHA0H00300 Chr8 (53718..61814) [8097 bp, 2698 aa] {ON} Anc_8.155
            YGL195W
          Length = 2698

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 62/138 (44%), Gaps = 14/138 (10%)

Query: 404  RAFLLLDKLIQKYP--EPMKSRL-------NDNKFWIKMLQWGIKIADKNGNNVNGTTID 454
            RA   L  LI+  P  +P+   L       +D      ML+  +++ DK  + +N T+  
Sbjct: 2340 RAAKALGTLIEYQPRVDPLVIELVTGAKQTDDEGVKTAMLKALLEVVDKASSKLNETSKK 2399

Query: 455  NCLEIMEEWFLKGKKKTALEHWKIDDDYGSIL-INLLHNIMKERKNVDIGLKAIENFVQK 513
            N ++++EE  L   +K A+ + K+      IL  +   NI+KE+    +     EN   K
Sbjct: 2400 NIMDLIEEEVLSSNEKLAVTYAKLIGSLSEILSTDEARNILKEK----VLSSTFENETGK 2455

Query: 514  LKLGSVNKYYERNLTHVL 531
              + ++N + +    H+ 
Sbjct: 2456 FGILTLNSFLKDAPNHIF 2473

>NCAS0B05460 Chr2 (1024533..1032599) [8067 bp, 2688 aa] {ON} Anc_8.155
            YGL195W
          Length = 2688

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 61/153 (39%), Gaps = 34/153 (22%)

Query: 433  MLQWGIKIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKI-------------- 478
            ML+  +++  K G+ +N T+  N + ++EE  L    K A+ + K+              
Sbjct: 2370 MLKALLEVIVKAGSKLNETSKSNVVNLVEEEMLGSNDKLAIAYVKLIGSLSEILSADEAH 2429

Query: 479  ------------DDDYGSILINLLHNIMKERKNVDIGLKAIENFVQKLKLG--SVNKYYE 524
                        D D G   I  L++ +K+  N     + I  FV+ +  G  S + Y+ 
Sbjct: 2430 KILKEKVLEADLDGDSGKFSILTLNSFLKDAPNHIFNPELINEFVEYIVTGLRSADPYFG 2489

Query: 525  RNLT------HVLYGLQKCIFRKIAESGSYNKG 551
             N         +L G  K  F KI  S S++ G
Sbjct: 2490 ENSVIAAGKLLLLEGENKSPFSKIQSSTSFSVG 2522

>NCAS0F03160 Chr6 (633224..644422) [11199 bp, 3732 aa] {ON} Anc_5.402
            YHR099W
          Length = 3732

 Score = 32.0 bits (71), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 472  ALEHWKIDDDYGSILINLLHNIMKER--KNVDIGLKAIENFVQKLKLGSVNK-YYERNLT 528
            A +H   D++ G   +N+L  ++ E+   NV+I +   E F+  ++LGS N  YY  N  
Sbjct: 2093 ASDHRASDNELGIRSLNILSVLLSEKYWPNVNIKMAYFEKFLANIELGSENTIYYCINTL 2152

Query: 529  HVLY 532
             VLY
Sbjct: 2153 DVLY 2156

>NDAI0B02720 Chr2 complement(676766..684793) [8028 bp, 2675 aa] {ON}
            Anc_8.155 YGL195W
          Length = 2675

 Score = 31.6 bits (70), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 10/104 (9%)

Query: 404  RAFLLLDKLIQKYP--EPMKSRL-------NDNKFWIKMLQWGIKIADKNGNNVNGTTID 454
            RA   L  LI+  P  +P+   L        D      ML+  +++  K GN +N T+ +
Sbjct: 2316 RAAKALGTLIEYQPRVDPLVVELVTGAKQATDEGVKTAMLKALLEVIVKAGNKLNETSKN 2375

Query: 455  NCLEIMEEWFLKGKKKTALEHWKIDDDYGSIL-INLLHNIMKER 497
            N + ++EE  L    K A+ + K+      IL  +  H I++E+
Sbjct: 2376 NVVNLVEEEMLSSNDKLAIAYAKLIGSLSEILSPSEAHKILEEK 2419

>NDAI0G05680 Chr7 complement(1410181..1412061) [1881 bp, 626 aa]
           {ON} Anc_2.16 YDL239C
          Length = 626

 Score = 31.2 bits (69), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 45/89 (50%), Gaps = 10/89 (11%)

Query: 274 AIYKNWKPLTDSE----SNTFLQYRLSLEDKSHNFKGFKNYKFLDGWSLLKII-DMVLTD 328
           ++  + K L D++    SNTFL+ R  L + + N K   N K++D  + L I  DM+  +
Sbjct: 406 SLIDDLKKLKDTQADIISNTFLELRKQLNESTENVKTL-NGKYVDKINELNIANDMLGKE 464

Query: 329 KTHCLNILNESILYSLGTLRQIEFMEHFI 357
           +   +    E I YS     QIEF+E  I
Sbjct: 465 RKEKM----EKIEYSNLQASQIEFLEEKI 489

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 73,042,277
Number of extensions: 3590461
Number of successful extensions: 14705
Number of sequences better than 10.0: 87
Number of HSP's gapped: 15224
Number of HSP's successfully gapped: 89
Length of query: 624
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 508
Effective length of database: 40,180,143
Effective search space: 20411512644
Effective search space used: 20411512644
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)