Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0K003308.846ON31331315320.0
NCAS0C003808.846ON2763045511e-68
YMR281W (GPI12)8.846ON3043105201e-63
KNAG0J002408.846ON2863145172e-63
Suva_13.4708.846ON3033115103e-62
KAFR0B039608.846ON2783054997e-61
Smik_13.4948.846ON3043144973e-60
ZYRO0G14300g8.846ON2803004883e-59
Skud_13.4538.846ON3003124903e-59
TDEL0B005208.846ON2682974822e-58
ABL120W8.846ON2492944716e-57
SAKL0D01320g8.846ON2603024655e-56
Kwal_27.102278.846ON2542944655e-56
Kpol_1068.48.846ON2913094651e-55
TPHA0I002808.846ON3013144643e-55
CAGL0M03047g8.846ON3043084617e-55
TBLA0B033008.846ON3193364566e-54
Ecym_46178.846ON2492944412e-52
KLTH0C03740g8.846ON2542934263e-50
KLLA0D01430g8.846ON2632904187e-49
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0K00330
         (313 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846...   594   0.0  
NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON} ...   216   1e-68
YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER me...   204   1e-63
KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}...   203   2e-63
Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W...   201   3e-62
KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.84...   196   7e-61
Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W...   196   3e-60
ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} simil...   192   3e-59
Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W...   193   3e-59
TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON} ...   190   2e-58
ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic hom...   186   6e-57
SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON...   183   5e-56
Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {O...   183   5e-56
Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON} c...   183   1e-55
TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846 ...   183   3e-55
CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly...   182   7e-55
TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.84...   180   6e-54
Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar ...   174   2e-52
KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {O...   168   3e-50
KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {O...   165   7e-49

>NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846
           YMR281W
          Length = 313

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/313 (93%), Positives = 294/313 (93%)

Query: 1   MSLRFSKFTYKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPI 60
           MSLRFSKFTYKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPI
Sbjct: 1   MSLRFSKFTYKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPI 60

Query: 61  TQLSLVIAHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDXXX 120
           TQLSLVIAHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHD   
Sbjct: 61  TQLSLVIAHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDSIN 120

Query: 121 XXXXXXXXXXXXXXXXDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGI 180
                           DFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGI
Sbjct: 121 LLLSSSNNRKINISILDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGI 180

Query: 181 SNHPNHIACNKAVHDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVK 240
           SNHPNHIACNKAVHDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVK
Sbjct: 181 SNHPNHIACNKAVHDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVK 240

Query: 241 VYWNLATGTFNTIPNSASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVF 300
           VYWNLATGTFNTIPNSASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVF
Sbjct: 241 VYWNLATGTFNTIPNSASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVF 300

Query: 301 SNDLLVVSNINNV 313
           SNDLLVVSNINNV
Sbjct: 301 SNDLLVVSNINNV 313

>NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON}
           Anc_8.846 YMR281W
          Length = 276

 Score =  216 bits (551), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 138/304 (45%), Positives = 179/304 (58%), Gaps = 35/304 (11%)

Query: 5   FSKFTYKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLS 64
           FSK  +K  KLFL+LW+ Y++S+ +I  +N  ++  S LN           I    T L+
Sbjct: 8   FSKLIFKVTKLFLVLWLLYLLSSNRIEQFNTLNY--SQLN---------TKIFHEGTTLN 56

Query: 65  LVIAHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDXXXXXXX 124
           LVIAHPDDE+MFFAPTLLQL+  +P SIP N+ICFS+GDA+GLG  R+ EL         
Sbjct: 57  LVIAHPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQS--SIHAL 114

Query: 125 XXXXXXXXXXXXDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHP 184
                        F DG DQ+WD  Q+   L         P   +   LTFD++G+S H 
Sbjct: 115 IQNQRQTNVTVLHFQDGNDQIWDIDQMTQYL---------PQNDHQAFLTFDSHGVSGHK 165

Query: 185 NHIACNKAVHDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVKVYWN 244
           NHIAC+ AV +L      K+   N+  L L S      I  +LL+KYTFF+IDLVK+YWN
Sbjct: 166 NHIACHNAVWNL------KNTNNNVTILTLDS------IHHSLLAKYTFFIIDLVKLYWN 213

Query: 245 LATGTFNTIPNSASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVFSNDL 304
           L          S   +++F N YSQYIL+Y++MLN HKSQ+VWFRYGWW FSRFVFSN L
Sbjct: 214 LWKDQQQPQWESHD-KITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHL 272

Query: 305 LVVS 308
            + +
Sbjct: 273 KITT 276

>YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER
           membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly, the
           de-N-acetylation of the
           N-acetylglucosaminylphosphatidylinositol intermediate;
           functional homolog of human PIG-Lp
          Length = 304

 Score =  204 bits (520), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 123/310 (39%), Positives = 181/310 (58%), Gaps = 33/310 (10%)

Query: 5   FSKFTYKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLS 64
           FSK  YK  KL ++L + Y+  T KI S N     N+ L  I    H + D      +++
Sbjct: 11  FSKLLYKITKLAIVLTILYIYFTPKIVSRN-----NASLQHIF--PHKYGDY-----EIN 58

Query: 65  LVIAHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDXXXXXXX 124
           LVIAHPDDE+MFF+P + QLN + P ++PFNIIC S G+AEGLG  R +EL++       
Sbjct: 59  LVIAHPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNE--SAALL 116

Query: 125 XXXXXXXXXXXXDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHP 184
                       DF DGMD++WD   + SSL  +  +++     N I++TFD+ G+SNH 
Sbjct: 117 LHNERAVSVQVMDFQDGMDEIWDIDSITSSLSQK--IDIKNHNLNQIIVTFDSYGVSNHI 174

Query: 185 NHIACNKAVHDLI-SYDGGKDKE----MNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLV 239
           NH +C  AV  L+  Y   K K      ++  L L S  +      N++ KY  F+ +++
Sbjct: 175 NHKSCYAAVKKLVDDYAQPKTKRNEQPPHVTALYLRSYKN------NIVLKYNSFIWEIL 228

Query: 240 KVYWNLATGTFNTI----PNSASL--ELSFINTYSQYILSYASMLNTHKSQMVWFRYGWW 293
           K+ ++L +     I    PN+A+   +LS +NT++QY+L++A+MLN H+SQ+VWFRYGWW
Sbjct: 229 KILYDLISPFRRIIQALPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWW 288

Query: 294 WFSRFVFSND 303
            FSRFVF N+
Sbjct: 289 IFSRFVFVNE 298

>KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}
           Anc_8.846 YMR281W
          Length = 286

 Score =  203 bits (517), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 125/314 (39%), Positives = 186/314 (59%), Gaps = 42/314 (13%)

Query: 5   FSKFTYKSFKLFLLLWMFYM-ISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQL 63
           FS+F YK  KL LLL + Y+  ST KI S+N  + +          +H        I  +
Sbjct: 6   FSRFIYKVTKLSLLLGILYIYASTSKIGSFNYTNLET-------LGEHD-------INSV 51

Query: 64  SLVIAHPDDELMFFAPTLLQLNRFL--PTSIPFNIICFSDGDAEGLGYLRRKELHDXXXX 121
           +LVIAHPDDE+MFFAP+L+ LN  +  P+++ FNIICFS+G A+GLG +R +EL D    
Sbjct: 52  NLVIAHPDDEVMFFAPSLINLNEQIRDPSTV-FNIICFSNGGADGLGNVREQELSDSIAM 110

Query: 122 XXXXXXXXXXXXXXXDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGIS 181
                          DF DGM + WD K++++ L+N     + P + +N+LLTFD  G+S
Sbjct: 111 LLPTRNTSIVVL---DFKDGMKEKWDVKEMIAKLRN-----IVPKLGHNVLLTFDGKGVS 162

Query: 182 NHPNHIACNKAVHDLISYDGGKDKE-MNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVK 240
            H NHIAC +A   L  Y+  K K+ + ++ L   SK        N++ KY+ ++ +L+K
Sbjct: 163 GHLNHIACYRAA--LGYYNEFKSKQKLTVLSLQSYSK--------NIVKKYSSYIWELIK 212

Query: 241 VYWN--LATGTFNTIPNSAS---LELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWF 295
           + ++  + +   N +P   S    +++  +TY QY+LS A+MLN HK+Q+VWFRYGWW+F
Sbjct: 213 LLYSSWVPSRLGNVLPKRGSNVARKITIFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFF 272

Query: 296 SRFVFSNDLLVVSN 309
           SR VF NDL V+S+
Sbjct: 273 SRLVFVNDLDVISS 286

>Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W
           (REAL)
          Length = 303

 Score =  201 bits (510), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 177/311 (56%), Gaps = 34/311 (10%)

Query: 5   FSKFTYKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLS 64
           FSK  +K  KL ++L + Y+  T KI S N  S         L+    H D +   +Q++
Sbjct: 9   FSKLLFKITKLAIVLTVLYIYFTPKILSRNTDS---------LQHVFPHRDRN---SQIN 56

Query: 65  LVIAHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDXXXXXXX 124
           LVIAHPDDE+MFF+P + QL+ + P ++PFNI+C S GDAEGLG  R KEL+D       
Sbjct: 57  LVIAHPDDEVMFFSPVISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELND--SAVLL 114

Query: 125 XXXXXXXXXXXXDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHP 184
                       DF DGMD+VWD   + S+L   + VN      + I++TFD+ G+SNH 
Sbjct: 115 LRNERPVSVQVMDFEDGMDEVWDIDSITSTLSQTIDVNNEKV--SQIIVTFDSYGVSNHI 172

Query: 185 NHIACNKAVHDLI-SYDGGKDKE----MNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLV 239
           NH +C+ AV   I  Y G K KE     +I  L L S  +      N+  KY  F+ +++
Sbjct: 173 NHKSCHIAVEKFIDDYVGSKTKEKAENAHITALYLRSYKN------NIFLKYNSFIWEIL 226

Query: 240 KVYWNLATGTFNTI-----PNSASLE--LSFINTYSQYILSYASMLNTHKSQMVWFRYGW 292
           K+ +   +    +I     P++ + +  L  +NT+SQYIL++A+MLN HKSQ+VWFRYGW
Sbjct: 227 KMLYRTVSPFGRSIQPLAAPSTTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGW 286

Query: 293 WWFSRFVFSND 303
           W  SRFVF N+
Sbjct: 287 WILSRFVFVNE 297

>KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.846
           YMR281W
          Length = 278

 Score =  196 bits (499), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 131/305 (42%), Positives = 168/305 (55%), Gaps = 36/305 (11%)

Query: 3   LRFSKFTYKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQ 62
           +  SK  +K  KL L+ W  Y++ + KI   N +  +  + + I  +D S    ++P   
Sbjct: 2   IHISKLIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLI--KDRS----NDP--S 53

Query: 63  LSLVIAHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDXXXXX 122
           L+LV+AHPDDE+MFF+PTLLQL+  LP +  FNII +SDGDAEGLG LR  EL       
Sbjct: 54  LTLVVAHPDDEVMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNEL---AHSI 110

Query: 123 XXXXXXXXXXXXXXDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISN 182
                         +  DGM++VWD K +L  L++ L        + NILLTFD  G+SN
Sbjct: 111 DMLIPRRNKEIFIFNHTDGMNEVWDNKLMLHQLESIL-----SDSQTNILLTFDQFGVSN 165

Query: 183 HPNHIACNKAVHDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLV--- 239
           H NH AC++ V   I     +    N   L+L S S       NLL KYT F   LV   
Sbjct: 166 HINHKACHQVVTSYI-----QSHAKNNFALLLDSYSS------NLLKKYTGFAWQLVFLA 214

Query: 240 KVYWNLATGTFNTIPNSASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFV 299
           K YW        T+PN   L L   N YS YI +YA+ML  HKSQMVWFRYGWW+FSRFV
Sbjct: 215 KNYWIHG----KTLPNLDHLAL--FNPYSDYITAYATMLKAHKSQMVWFRYGWWFFSRFV 268

Query: 300 FSNDL 304
           + NDL
Sbjct: 269 YVNDL 273

>Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W
           (REAL)
          Length = 304

 Score =  196 bits (497), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 119/314 (37%), Positives = 179/314 (57%), Gaps = 33/314 (10%)

Query: 1   MSLRFSKFTYKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPI 60
           + + FSK  YK  KL ++L + Y+  T KI S N +S  +   N+       ++D     
Sbjct: 7   VRVNFSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNK-------YSDY---- 55

Query: 61  TQLSLVIAHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDXXX 120
            Q++L+IAHPDDE+MFF+P + QL+ + P ++PFNIIC S G+AEGLG  R +EL+D   
Sbjct: 56  -QINLIIAHPDDEVMFFSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELND--S 112

Query: 121 XXXXXXXXXXXXXXXXDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGI 180
                           DF DGM++VWD   + S+L   + +N   +  N I++TFD+ G+
Sbjct: 113 AALLLHNERAVSVQVMDFQDGMNEVWDIDSITSTLSQTIGIN--NNELNQIIVTFDSYGV 170

Query: 181 SNHPNHIACNKAVHDLIS--YDGGKDKEMN---IIGLMLSSKSDEYNIVMNLLSKYTFFV 235
           S H NH +C+ AV  LI+        KE+    I  L L S  +      N++ KY  F+
Sbjct: 171 SGHINHKSCHTAVRKLIADYTRSNVRKEVKTPLITALYLRSYKN------NIVLKYNSFI 224

Query: 236 IDLVKVYWNLAT---GTFNTIPNSASLE---LSFINTYSQYILSYASMLNTHKSQMVWFR 289
            +++++ + L +    T   +P+    E   L  +NT++QYIL++A+MLN HKSQ+VWFR
Sbjct: 225 WEILRMLYGLISPFRKTTQALPSDVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFR 284

Query: 290 YGWWWFSRFVFSND 303
           YGWW  SRFVF N+
Sbjct: 285 YGWWILSRFVFVNE 298

>ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} similar
           to uniprot|P23797 Saccharomyces cerevisiae YMR281W GPI12
           ER membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 280

 Score =  192 bits (488), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 115/300 (38%), Positives = 174/300 (58%), Gaps = 36/300 (12%)

Query: 14  KLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLSLVIAHPDDE 73
           K++ LLW+ ++  + +I S N      SV N  L+         + I  LSLV+AHPDDE
Sbjct: 9   KVYFLLWVLFIAFSVRIKSRN-----GSVFNDNLK-------FLDEIDSLSLVVAHPDDE 56

Query: 74  LMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDXXXXXXXXXXXXXXXX 133
           +MFFAPT+L+L+  LP ++ FN++C S G A+ LG  R +EL +                
Sbjct: 57  VMFFAPTILELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQ 116

Query: 134 XXXDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHPNHIACNKAV 193
              D+ DG ++ WD + + S++++ +L       ++++LLTFD  G+S H NHIAC++AV
Sbjct: 117 QH-DYPDGHEETWDQESVQSTIKDSVL----QGRRSSVLLTFDDKGVSKHVNHIACHEAV 171

Query: 194 HDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVKVYWN------LAT 247
            +L+     +D+      L L S  D      N++ KY+ F  ++ K+  +      L T
Sbjct: 172 SNLV-----QDESNVKAALYLDSYGD------NIVLKYSAFFWEIWKLTRDWFLHRVLPT 220

Query: 248 GTFNTIPNSASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVFSNDLLVV 307
            ++N   N  + E++ ++ YS YILS+ASML++HKSQMVWFRYGWW FSRFVF NDL VV
Sbjct: 221 SSYNE--NKPATEITLMSDYSSYILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKVV 278

>Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W
           (REAL)
          Length = 300

 Score =  193 bits (490), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 117/312 (37%), Positives = 176/312 (56%), Gaps = 31/312 (9%)

Query: 1   MSLRFSKFTYKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPI 60
           + + FSK  YK  KL ++L + Y+  T KI S N         +++L+    H +     
Sbjct: 5   VKVNFSKLVYKITKLAIVLTILYIFFTPKIISRN---------DELLQHVFPHKNRD--- 52

Query: 61  TQLSLVIAHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDXXX 120
           +Q++LVIAHPDDE+MFF+P + QL+ + P ++PFNIIC S G+A+GLG  R KEL+    
Sbjct: 53  SQINLVIAHPDDEVMFFSPVISQLHSYFPITVPFNIICLSKGNADGLGESRVKELNG--S 110

Query: 121 XXXXXXXXXXXXXXXXDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGI 180
                           DF DGMD+VWD   ++S++     +++     N I++TFD+ G+
Sbjct: 111 AALLLQNERPVSVQVMDFEDGMDEVWDINSIVSTISQT--IDLSNEQLNQIIVTFDSYGV 168

Query: 181 SNHPNHIACNKAVHDLISYDGGKDKEMN-----IIGLMLSSKSDEYNIVMNLLSKYTFFV 235
           S+H NH +C+ AV  LI        E N     I  L L  KS + NIV+    KY  F+
Sbjct: 169 SDHINHKSCHTAVKRLIDRYAESKAETNEETPHITALYL--KSYKNNIVL----KYNSFI 222

Query: 236 IDLVKVYWNL----ATGTFNTIPNSASLELSFINTYSQYILSYASMLNTHKSQMVWFRYG 291
            +++K+ +++              +   +L  +NT++QY+L+YA+MLN HKSQ+VWFRYG
Sbjct: 223 WEILKILYSVIVPFPKTIQPPTTTTQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYG 282

Query: 292 WWWFSRFVFSND 303
           WW  SRFVF N+
Sbjct: 283 WWILSRFVFVNE 294

>TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON}
           Anc_8.846 YMR281W
          Length = 268

 Score =  190 bits (482), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 116/297 (39%), Positives = 165/297 (55%), Gaps = 38/297 (12%)

Query: 11  KSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLSLVIAHP 70
           K FKL   L + Y+  T +I+  N          ++  Q H+ A I  P   L+L+IAHP
Sbjct: 9   KVFKLLFFLSILYVALTARINGRN----------EVQWQQHA-AAIGTP-ESLTLLIAHP 56

Query: 71  DDELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDXXXXXXXXXXXXX 130
           DDE+MFF+P+LLQL+R LP S+ FN +C S GDA+ LG  R  EL               
Sbjct: 57  DDEVMFFSPSLLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQ-RSLNLLTSNSQRK 115

Query: 131 XXXXXXDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHPNHIACN 190
                 D+ DG D+ W+ + ++S +++++ +        N+LLTFDA+G+SNHPNH+AC+
Sbjct: 116 TQLYQFDYPDGFDEKWEIESVVSIVESKVFIGS----GFNLLLTFDAHGVSNHPNHVACH 171

Query: 191 KAVHDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVKVYWNLATGTF 250
            AV  LI   G K        L L+S S       NL  KY+ F+       W L     
Sbjct: 172 NAVARLIE-KGHK-------ALYLNSHSR------NLPLKYSGFI-------WELIRMLS 210

Query: 251 NTIPNSASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVFSNDLLVV 307
           +++       L+F+N++ QYIL++A+M N H+SQ+VWFRYGWW  SRFVF NDL +V
Sbjct: 211 DSVMKLERTGLTFMNSFPQYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEIV 267

>ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR281W (GPI12)
          Length = 249

 Score =  186 bits (471), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 157/294 (53%), Gaps = 51/294 (17%)

Query: 10  YKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLSLVIAH 69
           +   KL+LLL   Y  S +++  +N + F+     +++  D  H       T L+LVIAH
Sbjct: 6   FAVVKLYLLLLAVYCWSRRRLERHNTQVFE-----RLVGGDSQH-------TSLTLVIAH 53

Query: 70  PDDELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDXXXXXXXXXXXX 129
           PDDE+MFFAPTLLQL+  LP  +PF ++C +DG AEGLG LRR EL              
Sbjct: 54  PDDEVMFFAPTLLQLDARLPAWMPFRVVCLTDGGAEGLGQLRRAELQK---ALRLLVLEH 110

Query: 130 XXXXXXXDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHPNHIAC 189
                  DF DGM + WD  ++ + L  EL+ +  P     ++LTFD  G+S H NHI C
Sbjct: 111 DVTLEVADFTDGMKEDWDLAEVRTRL-GELVTDAKP-----LVLTFDERGVSGHRNHIGC 164

Query: 190 NKAVHDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVKVYWNLATGT 249
             A   L    G K        L L S+        NLL KY+FFV+D+ +V        
Sbjct: 165 ALAAARL----GHKT-------LFLRSER-------NLLRKYSFFVLDVFRV-------V 199

Query: 250 FNTIPNSASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVFSND 303
           F T P +      F++T +QY+ +  +M+  H+SQMVWFR+GWW  SR+V++N+
Sbjct: 200 FGTPPPTV-----FVSTLAQYLHALVAMVVAHRSQMVWFRWGWWMASRYVYANE 248

>SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON}
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281W GPI12 ER membrane protein involved in the second
           step of glycosylphosphatidylinositol (GPI) anchor
           assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 260

 Score =  183 bits (465), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 105/302 (34%), Positives = 159/302 (52%), Gaps = 44/302 (14%)

Query: 3   LRFSKFTYKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQ 62
           +R  +   K  K + LL + Y+  +Q+I+++N++ F N                S   T 
Sbjct: 1   MRVVEVVAKLLKAYALLSVLYICVSQRIAAHNRQVFRNVF-------------PSRTPTS 47

Query: 63  LSLVIAHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDXXXXX 122
           ++L++AHPDDE MFF+PTLLQL+   P S+P  +IC ++GDA+GLG +R +EL       
Sbjct: 48  VNLIVAHPDDETMFFSPTLLQLHVNYPPSVPLRVICLTNGDADGLGAVREQELR---LSM 104

Query: 123 XXXXXXXXXXXXXXDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISN 182
                          F DGM   WD +Q+++++   +      S  + +LLTFD +G+S 
Sbjct: 105 QLLLPARNTSVIVEGFEDGMGVEWDTRQVVATINRHV------SDASPLLLTFDEHGVSG 158

Query: 183 HPNHIACNKAVHDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVKVY 242
           H NH++CN AV  L+  +  + +E     L L+SK            KY  F +DL ++ 
Sbjct: 159 HVNHVSCNTAVSALV--EQREQREQRFTALYLNSKR-------YFPPKYGSFAVDLARII 209

Query: 243 WNLATGTFNTIPNSASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVFSN 302
               TG    +         F++T+ QY+LS A+M N H SQMVWFR+GWW  SRFVF N
Sbjct: 210 ----TGRQPPV---------FMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVN 256

Query: 303 DL 304
           +L
Sbjct: 257 EL 258

>Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {ON}
           YMR281W (GPI12) -
           N-acetylglucosaminylphosphatidylinositol de-N-acetylase
           [contig 39] FULL
          Length = 254

 Score =  183 bits (465), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 160/294 (54%), Gaps = 52/294 (17%)

Query: 13  FKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLSLVIAHPDD 72
           FK+  +LW+ Y++ + +I   N+++     L  + R        S P T ++LVIAHPDD
Sbjct: 8   FKVSGILWLVYILGSVQIERSNRRA-----LGSLFRG-------SAP-TSINLVIAHPDD 54

Query: 73  ELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDXXXXXXXXXXXXXXX 132
           E+MFFAPTLLQ++ +LP SI  N+I  +DG A+GLG LR KEL D               
Sbjct: 55  EVMFFAPTLLQIDEWLPGSIEVNVISLTDGGADGLGDLRTKELQD---CVRLLLRKRKAS 111

Query: 133 XXXXDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHPNHIACNKA 192
               DF+DGMD  WD ++ + +LQ  +L   P      + LTFD NGIS H NHI+C KA
Sbjct: 112 VEVLDFLDGMDVEWDLERAVKALQERILDESP------LFLTFDENGISGHVNHISCYKA 165

Query: 193 VHDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMN--LLSKYTFFVIDLVKVYWNLATGTF 250
           V  +  +                SKS  + +V    L  KY+ F+  L   +        
Sbjct: 166 VQKVRKH---------------YSKSSCFKLVSKRYLFEKYSGFIPALFHSF-------- 202

Query: 251 NTIPNSASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVFSNDL 304
             I +S S   + IN++ QY+L+ +SM+N H SQMVWFRYGWW FS +V++N+L
Sbjct: 203 --ISSSPS---TLINSFRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANEL 251

>Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON}
           complement(6124..6999) [876 nt, 292 aa]
          Length = 291

 Score =  183 bits (465), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 113/309 (36%), Positives = 165/309 (53%), Gaps = 44/309 (14%)

Query: 8   FTYKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLSLVI 67
           F +K+ KL+ LLW  Y+             F  ++  +  RQ       S   + ++LVI
Sbjct: 6   FVFKAIKLYFLLWCGYVW------------FAGAIRGENARQVRGPGYFSGS-SSVNLVI 52

Query: 68  AHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDG---DAEGLGYLRRKELHDXXXXXXX 124
           AHPDDE+MFF+PTL+QL+ +LP  +  N+ICFS G   D    G  R +EL         
Sbjct: 53  AHPDDEVMFFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRAREL--KKSVSML 110

Query: 125 XXXXXXXXXXXXDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKN-NILLTFDANGISNH 183
                       D+ DG DQ+WD   ++  L+   L+N     K  ++L+TFD +G+S+H
Sbjct: 111 IEHDRPVTVHQLDYKDGKDQIWDLDSMVWDLKT--LINPSKDYKRKDLLITFDEHGVSDH 168

Query: 184 PNHIACNKAVHDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVKVYW 243
           PNHIAC+ AVH LI      ++E   +   L S S       N++ KY+FF  ++VK ++
Sbjct: 169 PNHIACHNAVHRLI------EEEPLFMAYQLESHS------TNVILKYSFFAREIVKYFY 216

Query: 244 NLATGTFNTIPNSASL--------ELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWF 295
           N        I    SL        E    NT+S+YI++YA+MLN H+SQ+VWFRYGWW+F
Sbjct: 217 NYC---HQRIKGQTSLNKNMDVPYEYVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFF 273

Query: 296 SRFVFSNDL 304
           SR  ++N+L
Sbjct: 274 SRLTYANEL 282

>TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846
           YMR281W
          Length = 301

 Score =  183 bits (464), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 117/314 (37%), Positives = 169/314 (53%), Gaps = 35/314 (11%)

Query: 10  YKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLSLVIAH 69
           +K FK + +L + Y+  T  I   N KSF ++V   I +Q          +  ++L+IAH
Sbjct: 5   FKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQS---------LKSVNLIIAH 55

Query: 70  PDDELMFFAPTLLQLNRFLPTSIPFNIICFSDG---DAEGLGYLRRKELHDXXXXXXXXX 126
           PDDE+MFF PTLLQL+  LPT +PFN+IC S G   D   +G LR  E+ D         
Sbjct: 56  PDDEVMFFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHR 115

Query: 127 XX---XXXXXXXXDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNH 183
                        ++ DGMD+ WD  ++++ +QN + +        + LLTFDA G+S H
Sbjct: 116 RAGLNREVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEH 175

Query: 184 PNHIACNKAVHDLISYDGGKDKEMNIIG-LMLSSKSDEYNIVMNLLSKYTFFVIDLVKVY 242
           PNHIAC  A+  L      K K  N    L+++  S   NI++    KY+ F+  + K+ 
Sbjct: 176 PNHIACYDAMMTL------KQKSSNPGDYLLMTLNSYGSNIIL----KYSSFLPVVFKLL 225

Query: 243 WNLATGTFN-----TIP----NSASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWW 293
            N+    F       +P    +    ++ FINT+  YI++ +SMLN+H SQMVWFRYGWW
Sbjct: 226 INIINDKFRIFELKQVPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWW 285

Query: 294 WFSRFVFSNDLLVV 307
            FSRFVF NDL ++
Sbjct: 286 SFSRFVFVNDLHII 299

>CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281w GPI12 N-acetylglucosaminyl phosphatidylinositol
           deacetylase
          Length = 304

 Score =  182 bits (461), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 118/308 (38%), Positives = 167/308 (54%), Gaps = 34/308 (11%)

Query: 5   FSKFTYKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLS 64
           FSK  +K  KL ++  + Y+  T K+   NK++         L   H +  +      L+
Sbjct: 18  FSKLLFKLTKLTIIFQVLYIYFTPKVEDLNKENLTK------LLPTHDNFGV------LN 65

Query: 65  LVIAHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDXXXXXXX 124
           LVIAHPDDE+MFF+PT+LQL   +      N++C S+GDA+GLG LR KEL D       
Sbjct: 66  LVIAHPDDEIMFFSPTILQL---IDHVQELNVVCLSNGDADGLGELRAKELKDAIGYLTV 122

Query: 125 XXXXXXXXXXXXDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHP 184
                       D+ DG ++VW G  + + L+  +L + P   + +I+LTFD  GIS H 
Sbjct: 123 NRNLRNVSLNILDYTDGQNEVWSG--VATDLKKYILTSEPGVKQKDIILTFDREGISGHR 180

Query: 185 NHIACNKAVHDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVKVYWN 244
           NHIACN+ V   ISY     K  + + L L S S        ++SKY+  V  L+++ +N
Sbjct: 181 NHIACNEGV---ISY-LKTIKSNSFVFLELKSLS-----TWQIISKYSGVVPKLLEIIYN 231

Query: 245 LATGTFNT----IPNSASLE----LSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFS 296
               +  T    +PN  S+     + FI+T+ QY LS+A+M   HKSQMVWFRY WW FS
Sbjct: 232 KIRASNKTFVSYLPNRDSIATDSNVCFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFS 291

Query: 297 RFVFSNDL 304
           R+VF NDL
Sbjct: 292 RYVFVNDL 299

>TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.846
           YMR281W
          Length = 319

 Score =  180 bits (456), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 121/336 (36%), Positives = 180/336 (53%), Gaps = 47/336 (13%)

Query: 3   LRFSKFTYKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQ 62
           + FS    ++ KL L+ W+ Y+ ++  I   N +SF+    +  L  +  H  I+     
Sbjct: 1   MNFSTNEIRTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINS---- 56

Query: 63  LSLVIAHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDG-DAEG--LGYLRRKELHDXX 119
           LSL+IAHPDDE+MFF+PTLLQLN +L   I FN++C S G D+ G      R  EL+D  
Sbjct: 57  LSLIIAHPDDEIMFFSPTLLQLNNYLEKDIMFNVVCLSQGLDSTGSFKDPQRVHELNDSL 116

Query: 120 XXX----XXXXXXXXXXXXXXDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKN-NILLT 174
                                D+ DGM ++W+    +  + ++LL N+  +    N+LLT
Sbjct: 117 NLLFNRGSNNEHNRNFKLIQLDYTDGMKEIWN----MDLIVDDLLQNLNFTDNGINLLLT 172

Query: 175 FDANGISNHPNHIACNKAVHDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFF 234
           FD +G+SNH NH+ACN+AV  L+ Y    + + N+IG+ L+S S       N   KY+FF
Sbjct: 173 FDKSGVSNHKNHLACNEAVTKLLKY---SNPDSNLIGIFLNSHSK------NFFLKYSFF 223

Query: 235 VIDL-----VKVYWNLATGTFNTIPNS-----------------ASLELSFINTYSQYIL 272
           V  L     +K + +++       PNS                  +L  +F N +++Y+L
Sbjct: 224 VSKLFTIIKLKFFRSISLFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYML 283

Query: 273 SYASMLNTHKSQMVWFRYGWWWFSRFVFSNDLLVVS 308
           SY++MLN H+SQMVWFRY WW FSRF F NDL +V+
Sbjct: 284 SYSTMLNAHESQMVWFRYLWWIFSRFAFINDLTIVN 319

>Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar to
           Ashbya gossypii ABL120W
          Length = 249

 Score =  174 bits (441), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 152/294 (51%), Gaps = 59/294 (20%)

Query: 14  KLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLSLVIAHPDDE 73
           KL+L+L   Y  S + + ++N K ++  V         SH +     T ++L+IAHPDDE
Sbjct: 10  KLYLVLLAVYCGSYKHLETHNSKVYEYLV--------GSHGNY----TSVTLIIAHPDDE 57

Query: 74  LMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDXXXXXXXXXXXXXXXX 133
           +MFFAPTLLQL+  +  S+PF ++C +DGDA+GLG +RR+ELH                 
Sbjct: 58  VMFFAPTLLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELHK---ALRLLVLERDVEI 114

Query: 134 XXXDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHPNHIACNKAV 193
               F DGMD+ W     +  ++ EL   V  + +  ++LTFD  G+S H NHIAC  A 
Sbjct: 115 QMGGFKDGMDEEWK----MEVVREELAQVV--TDRRPLVLTFDERGVSGHRNHIACAHAA 168

Query: 194 ----HDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVKVYWNLATGT 249
               H  +  D G                       NL+ KY+FF +DL ++ +     T
Sbjct: 169 AKLGHHTLHLDSGH----------------------NLIRKYSFFFVDLFRLLFGYPMPT 206

Query: 250 FNTIPNSASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVFSND 303
                        F++T+SQY+ S  +ML  HKSQMVWFR+GWW  SR+V++N+
Sbjct: 207 V------------FLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRYVYANE 248

>KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {ON}
           weakly similar to uniprot|P23797 Saccharomyces
           cerevisiae YMR281W GPI12 ER membrane protein involved in
           the second step of glycosylphosphatidylinositol (GPI)
           anchor assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 254

 Score =  168 bits (426), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 154/293 (52%), Gaps = 52/293 (17%)

Query: 14  KLFLLLWMFYMISTQKISSYNKKSFDN--SVLNQILRQDHSHADISEPITQLSLVIAHPD 71
           KL  +L + Y  S+ +I + N+++F    SVLN                T ++LVIAHPD
Sbjct: 9   KLLAVLCILYFASSARIKASNEQAFTTLFSVLNP---------------TSINLVIAHPD 53

Query: 72  DELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDXXXXXXXXXXXXXX 131
           DE+MFFAPTLLQL+ +  T IP ++   +DG A+GLG LR +EL D              
Sbjct: 54  DEVMFFAPTLLQLDHYFDTDIPVSVFSLTDGGADGLGKLREEELRD---SVHLLFRRRKA 110

Query: 132 XXXXXDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHPNHIACNK 191
                +F DGM   WD ++   +L+ +++ + P      + LTFD +G+S+H NHI+C +
Sbjct: 111 EVTVLNFEDGMKVEWDLQKTSEALRKQVVGDQP------LFLTFDDHGVSSHINHISCYE 164

Query: 192 AVHDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVKVYWNLATGTFN 251
            V +L      +          L+SK        ++  KYT FV  L+ V          
Sbjct: 165 TVRNL------RAAHPESRSFSLTSKR-------SIFQKYTAFVPSLITVL--------- 202

Query: 252 TIPNSASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVFSNDL 304
                 S +  F++T+ QY+L+ + M+N H SQMVWFRYGWW+FS +VF+N++
Sbjct: 203 ----RGSRQAVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCYVFANEV 251

>KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {ON}
           similar to uniprot|Q75DZ3 Ashbya gossypii ABL120W
           ABL120Wp and weakly similar to YMR281W uniprot|P23797
           Saccharomyces cerevisiae YMR281W GPI12 ER membrane
           protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de- N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 263

 Score =  165 bits (418), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 104/290 (35%), Positives = 153/290 (52%), Gaps = 43/290 (14%)

Query: 16  FLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLSLVIAHPDDELM 75
           +L+  + Y   T+ I  +N+  F   V   ++ +          +T ++LV+AHPDDE+M
Sbjct: 14  YLVFLVIYGCLTKTIKEHNRWYFHELVSESMVSK----------LTSVTLVVAHPDDEVM 63

Query: 76  FFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDXXXXXXXXXXXXXXXXXX 135
           FF+PTL Q N  LP SIP N++C + GDA+GLG++R++EL D                  
Sbjct: 64  FFSPTLTQFNELLPISIPINVVCMTAGDADGLGHIRKQELVD---SLRIMFHGRQFGCDV 120

Query: 136 XDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHPNHIACNKAVHD 195
            DF DGMD VWD  Q+L  L+ +L  ++P S  N ++LTFD  G+S H NHI+C + V  
Sbjct: 121 LDFEDGMDAVWD--QVL--LEKQLRSSIPDS--NPLVLTFDQFGVSGHINHISCGRLVEK 174

Query: 196 LISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVKVYWNLATGTFNTIPN 255
           L  Y              L  +SD+      +  KY+ F+  + ++      G     P+
Sbjct: 175 L-PYSHK-----------LHLRSDQ-----PIYVKYSAFIAGIFQL------GISTVYPD 211

Query: 256 SASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVFSNDLL 305
                  FI+T  QY+L+ ++M   H SQMVWFR GWW FSRF F N+L+
Sbjct: 212 YGKPR-CFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFINELI 260

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,945,592
Number of extensions: 1393760
Number of successful extensions: 3998
Number of sequences better than 10.0: 30
Number of HSP's gapped: 4039
Number of HSP's successfully gapped: 30
Length of query: 313
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 204
Effective length of database: 40,982,805
Effective search space: 8360492220
Effective search space used: 8360492220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)