Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0J014208.254ON61961930030.0
NCAS0B038908.254ON66361921970.0
Suva_2.2678.254ON67262719310.0
YDR107C (TMN2)8.254ON67262719280.0
NDAI0B023708.254ON72262619230.0
Smik_4.3538.254ON69062719090.0
YLR083C (EMP70)8.254ON66761918920.0
Smik_12.1428.254ON66362218860.0
Skud_4.3688.254ON67262718820.0
Skud_12.1518.254ON66461918620.0
Suva_10.1678.254ON68463918600.0
Kpol_543.358.254ON65861918440.0
NCAS0B049708.254ON66662718390.0
KAFR0B026808.254ON66462218300.0
CAGL0B01683g8.254ON69164717980.0
ZYRO0C01848g8.254ON64761917550.0
SAKL0H17248g8.254ON66062617540.0
KLLA0F18931g8.254ON66562317490.0
KNAG0G019908.254ON66762117460.0
TBLA0E043708.254ON67663017070.0
TBLA0H014508.254ON67362717050.0
TPHA0A018408.254ON68564516850.0
Kwal_56.235778.254ON68363816720.0
KLTH0G13882g8.254ON68764316690.0
TDEL0F038108.254ON65662015320.0
AGR097W8.254ON65361414880.0
Ecym_43178.254ON60559912061e-158
SAKL0F12914g7.411ON7077013515e-34
ZYRO0B03784g7.411ON6586313152e-29
NDAI0A015107.411ON6796653097e-29
Suva_5.2347.411ON7066562982e-27
NCAS0A145207.411ON6706642963e-27
Smik_5.2587.411ON7066632964e-27
TDEL0C027107.411ON6786412841e-25
YER113C (TMN3)7.411ON7066592813e-25
KLLA0E20835g7.411ON6766332786e-25
Skud_5.2667.411ON7076802672e-23
KLTH0C06226g7.411ON6942532182e-17
Kwal_27.107467.411ON6902312055e-16
KNAG0C034307.411ON6802371984e-15
CAGL0G03487g7.411ON7042341895e-14
Ecym_71437.411ON6766721788e-13
KAFR0K019507.411ON6642241734e-12
TBLA0I003307.411ON7133331432e-08
AGL295C7.411ON6571161351e-07
Kpol_1045.287.411ON6815211297e-07
TPHA0K007307.411ON7332331172e-05
Kpol_538.397.22ON72680699.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0J01420
         (619 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8....  1161   0.0  
NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254    850   0.0  
Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...   748   0.0  
YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}  ...   747   0.0  
NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {O...   745   0.0  
Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON...   739   0.0  
YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON} ...   733   0.0  
Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {...   731   0.0  
Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON...   729   0.0  
Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {...   721   0.0  
Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {...   721   0.0  
Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}...   714   0.0  
NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {O...   712   0.0  
KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...   709   0.0  
CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {...   697   0.0  
ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} simila...   680   0.0  
SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} simi...   680   0.0  
KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]...   678   0.0  
KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {O...   677   0.0  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...   662   0.0  
TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {O...   661   0.0  
TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...   653   0.0  
Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {...   648   0.0  
KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} simi...   647   0.0  
TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {O...   594   0.0  
AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic ho...   577   0.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...   469   e-158
SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]...   139   5e-34
ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {...   125   2e-29
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...   123   7e-29
Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON...   119   2e-27
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...   118   3e-27
Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON...   118   4e-27
TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {O...   114   1e-25
YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}  ...   112   3e-25
KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]...   111   6e-25
Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C ...   107   2e-23
KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} simila...    89   2e-17
Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113...    84   5e-16
KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.4...    81   4e-15
CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {...    77   5e-14
Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar t...    73   8e-13
KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {...    71   4e-12
TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411...    60   2e-08
AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON} S...    57   1e-07
Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON} (64237....    54   7e-07
TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7....    50   2e-05
Kpol_538.39 s538 complement(83542..85722) [2181 bp, 726 aa] {ON}...    31   9.6  

>NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8.254
          Length = 619

 Score = 1161 bits (3003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/619 (91%), Positives = 568/619 (91%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60
           MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF
Sbjct: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120
           QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG
Sbjct: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120

Query: 121 NGFELGLVEIRQTTGEKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEY 180
           NGFELGLVEIRQTTGEKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEY
Sbjct: 121 NGFELGLVEIRQTTGEKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEY 180

Query: 181 HDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSETAW 240
           HDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSETAW
Sbjct: 181 HDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSETAW 240

Query: 241 VTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGELNLDETIKE 300
           VTRWDKYLHVYDPTIQW              CAVARSLLQALKSDFSRYGELNLDETIKE
Sbjct: 241 VTRWDKYLHVYDPTIQWVSIVNFSIVVIILSCAVARSLLQALKSDFSRYGELNLDETIKE 300

Query: 301 DASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPTVMF 360
           DASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPTVMF
Sbjct: 301 DASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPTVMF 360

Query: 361 LLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXXXFVHSSGV 420
           LLYLGFSFISSFVSMGVYKFFNGQKWHINC                       FVHSSGV
Sbjct: 361 LLYLGFSFISSFVSMGVYKFFNGQKWHINCILTPFLVPGLLLLVIIGLNIFLIFVHSSGV 420

Query: 421 IPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQTIPA 480
           IPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQTIPA
Sbjct: 421 IPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQTIPA 480

Query: 481 SLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIXXXXXXXXXXXXXXYYSLSA 540
           SLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAI              YYSLSA
Sbjct: 481 SLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAILFTLTVSLVTVLFTYYSLSA 540

Query: 541 ENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVTGAL 600
           ENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVTGAL
Sbjct: 541 ENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVTGAL 600

Query: 601 GFLSSMLFVRTIYSAVKVD 619
           GFLSSMLFVRTIYSAVKVD
Sbjct: 601 GFLSSMLFVRTIYSAVKVD 619

>NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254
          Length = 663

 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/619 (64%), Positives = 473/619 (76%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60
           MH+HHKN+EG+DIST  K  ++SYDYYYEK HFC+P H+EKAG SIGS+LFGDR+YNSPF
Sbjct: 45  MHFHHKNEEGKDISTAKKYVVHSYDYYYEKFHFCQPVHIEKAGSSIGSILFGDRIYNSPF 104

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120
           QLNML+NKTC  LC S I G+DA+FINKLIKNGYYQNW IDGLPAAREVYD RTKS+FYG
Sbjct: 105 QLNMLENKTCVPLCESIIPGKDAEFINKLIKNGYYQNWFIDGLPAAREVYDKRTKSSFYG 164

Query: 121 NGFELGLVEIRQTTGEKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEY 180
           NGFELGLVEIRQTTG+KLLP+S     DL KRDAKN+VQNL++++EVPYFVNHFDI IEY
Sbjct: 165 NGFELGLVEIRQTTGDKLLPDSVHDISDLAKRDAKNLVQNLIKEVEVPYFVNHFDIVIEY 224

Query: 181 HDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSETAW 240
           H+RGN NYRVVG TVNPVSI R   G C PTGK+L+L+E E N +H TYSV F+PS+T+W
Sbjct: 225 HERGNGNYRVVGATVNPVSIARKSAGDCTPTGKSLTLNEEEDNNVHSTYSVTFVPSKTSW 284

Query: 241 VTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGELNLDETIKE 300
           VTRWDKYLHVYDP IQW                +  SLL+ALKSDF+RY  +NLD+ +KE
Sbjct: 285 VTRWDKYLHVYDPKIQWFSLINFSLIVILLSVILINSLLKALKSDFARYNNINLDDDVKE 344

Query: 301 DASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPTVMF 360
           ++ WKL HG VFR P +PM+LSILVGSG QLFL+I+CT+FL A+ +++P  RG LPT M 
Sbjct: 345 ESGWKLVHGYVFRIPKNPMILSILVGSGFQLFLVIVCTVFLAAIDILSPIYRGALPTAMI 404

Query: 361 LLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXXXFVHSSGV 420
           +LY+ F FISS+VSMGVYKFF G  W +N                        F  SS V
Sbjct: 405 ILYILFGFISSYVSMGVYKFFKGPYWKVNMLLTPILVPGLIIITFLALNLFLMFSESSSV 464

Query: 421 IPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQTIPA 480
           +P  T  +LILLWF + +PLS+ GSLMA+K CHWD HPT TN ++KVIPPQKWYL+TIPA
Sbjct: 465 VPAKTIMTLILLWFAVSIPLSVAGSLMAQKKCHWDEHPTVTNQIAKVIPPQKWYLKTIPA 524

Query: 481 SLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIXXXXXXXXXXXXXXYYSLSA 540
           SLIGGLFSFGS+SV+LYF+YTSLWFN IFYMYGFL  S                Y+SL  
Sbjct: 525 SLIGGLFSFGSISVQLYFIYTSLWFNNIFYMYGFLLFSICLFTMTITLVTILFTYHSLCQ 584

Query: 541 ENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVTGAL 600
           ENW+WQWR F I GLGCS YV LHSL F E+KLGGFTN LLYMGYS V+T+L F+VTG++
Sbjct: 585 ENWKWQWRGFFIGGLGCSIYVLLHSLFFIELKLGGFTNILLYMGYSSVVTALIFLVTGSV 644

Query: 601 GFLSSMLFVRTIYSAVKVD 619
           GFLSSM F++ I+S+VKVD
Sbjct: 645 GFLSSMFFIKRIFSSVKVD 663

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/627 (56%), Positives = 451/627 (71%), Gaps = 8/627 (1%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60
           +++ HK++ G+D+S+D +  +YSYDYY +K HFCKPEHVEK   S+GSV+FGDR+YNSPF
Sbjct: 46  IYFQHKDENGKDVSSDKEHFLYSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPF 105

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120
           QL ML++K C  LC STI G+DAKFIN LIKNG++QNWL+DGLPAAR VYD+RTK+N+YG
Sbjct: 106 QLKMLEDKECVALCKSTIPGKDAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYG 165

Query: 121 NGFELGLVEIRQTTGEKLLPNSAD--------TFRDLHKRDAKNIVQNLMQDIEVPYFVN 172
            GFELG  +++QT G K +P++ +        T   L  RD KNI  NL+Q IE+ +FVN
Sbjct: 166 TGFELGFTDVKQTVGGKTIPSTMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVN 225

Query: 173 HFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVE 232
           HF+I++EYHDRGN NYRVVGVTVNP+SI+RS  G C  TG+ L+L E + N ++FTYSV+
Sbjct: 226 HFNIQVEYHDRGNGNYRVVGVTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVK 285

Query: 233 FIPSETAWVTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGEL 292
           FI S+T W TRWDKYLHVYDP IQW                V  S+L+A++SDF+RY EL
Sbjct: 286 FIASDTVWATRWDKYLHVYDPQIQWFSLINFSIIVILLSSVVIHSILRAVRSDFARYNEL 345

Query: 293 NLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSR 352
           NLD    EDA WKLGHGDVFR P   M+LS+LVGSG+QLFLMIIC+IF  A+GL++P SR
Sbjct: 346 NLDNEFHEDAGWKLGHGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASR 405

Query: 353 GTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXX 412
           G+LPTVMF+LY  F F+ S+ SMGVYKFF+G  W  N                       
Sbjct: 406 GSLPTVMFVLYALFGFVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFL 465

Query: 413 XFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQK 472
            F HSSGVIP  T   +I LWF + +PLS  GS +A K C WD HPTKTN +++  P Q 
Sbjct: 466 LFAHSSGVIPARTLFFIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQP 525

Query: 473 WYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIXXXXXXXXXXXX 532
           WYL+TI A+LI G+FSFGS++VELYF+Y+SLWFNKIFYM+GFL  S +            
Sbjct: 526 WYLRTIQATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLATSLVTVF 585

Query: 533 XXYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSL 592
             Y+SL  ENW WQWRSF+I GLGCS Y+F+H++LFT+ KLGGF   +LY+GYSF+I++L
Sbjct: 586 ITYHSLCLENWSWQWRSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISAL 645

Query: 593 AFVVTGALGFLSSMLFVRTIYSAVKVD 619
             VVTGA+GF SSM+F+R IYS +KV+
Sbjct: 646 CCVVTGAIGFFSSMIFIRKIYSRIKVE 672

>YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}
           TMN2Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn3p; member
           of the evolutionarily conserved Transmembrane Nine
           family of proteins with nine membrane-spanning segments
          Length = 672

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/627 (56%), Positives = 444/627 (70%), Gaps = 8/627 (1%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60
           +++ H+++EG D+S D +  +YSYDYY ++ HFC+PEHVEK   S+GSV+FGDR+YNSPF
Sbjct: 46  IYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPF 105

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120
           QLNML+ K C  LC STI G+DAKFIN LIK+G++QNWL+DGLPAAR+ YD+RTK+N+YG
Sbjct: 106 QLNMLEEKECVALCKSTIPGKDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYG 165

Query: 121 NGFELGLVEIRQTTGEKLLPNSADTFRD--------LHKRDAKNIVQNLMQDIEVPYFVN 172
            GFELG  +++QT   K +P++ +            L  R  KN+  NL++ +E+PYFVN
Sbjct: 166 TGFELGFTDVKQTVDGKAVPSTMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVN 225

Query: 173 HFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVE 232
           HFDI +E+HDRGNDNYRVVGV VNPVSI+RS  G C  TGK L L E + N ++FTYSV+
Sbjct: 226 HFDIEVEFHDRGNDNYRVVGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVK 285

Query: 233 FIPSETAWVTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGEL 292
           F+ S+T W TRWDKYLH+YDP IQW                V  SLL+ALKSD +RY EL
Sbjct: 286 FVASDTVWATRWDKYLHIYDPQIQWFSLINFSVIVILLSSVVMHSLLRALKSDLARYNEL 345

Query: 293 NLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSR 352
           NLD    ED+ WKLGHGDVFR P   MLLSILVGSG+QLFLM++C+IF  AVGL++P SR
Sbjct: 346 NLDNEFHEDSGWKLGHGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSR 405

Query: 353 GTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXX 412
           G+LPTVMF+LY  F F+ S+ SMGVYKFF G  W  N                       
Sbjct: 406 GSLPTVMFVLYALFGFVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFL 465

Query: 413 XFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQK 472
            F HSSGVIP  +   +ILLWF + VPLS  GS++A K C+WD HPTKTN +++ IP Q 
Sbjct: 466 LFAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQP 525

Query: 473 WYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIXXXXXXXXXXXX 532
           WYL+T  A+LI G+FSFGS++VELYF+Y+SLWFNKIFYM+GFL  S +            
Sbjct: 526 WYLRTAQATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTIL 585

Query: 533 XXYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSL 592
             YYSL  ENW WQWRSF+I GLGCS Y F+HS+LFT+ KLGG    +LY+GYS +I++L
Sbjct: 586 ITYYSLCLENWLWQWRSFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISAL 645

Query: 593 AFVVTGALGFLSSMLFVRTIYSAVKVD 619
             VVTGA+GF SSM F+R IYSA+KV+
Sbjct: 646 CCVVTGAIGFFSSMFFIRKIYSAIKVE 672

>NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {ON}
           Anc_8.254
          Length = 722

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/626 (56%), Positives = 455/626 (72%), Gaps = 10/626 (1%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60
           M++ HKN++G+ + +D +R +YSYDYYY++ HFC+PEH+EK   S+GS++FGDR+YNSPF
Sbjct: 100 MYFQHKNEDGKTMKSDKERFLYSYDYYYDRFHFCQPEHIEKQPESLGSIIFGDRIYNSPF 159

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120
           Q+NML++KTC  LC +TI G+DAKFINKLIKNG++QNWLIDGLPAAR+VYD+RTK+ FYG
Sbjct: 160 QINMLQDKTCVSLCKTTIPGKDAKFINKLIKNGFFQNWLIDGLPAARQVYDSRTKTEFYG 219

Query: 121 NGFELGLVEIRQ--TTGEKL-----LPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNH 173
            GFELG V++ Q  TTG+        P + +   +L  RDAKN+   ++++ E+PYF NH
Sbjct: 220 TGFELGFVDVVQGTTTGDNANTVAKKPTTNEGL-ELDTRDAKNV--QMLKNFELPYFANH 276

Query: 174 FDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEF 233
           FDI++EYHDRG +NYRVVGV VNPVSI RS  G C+ +G  L LSE + N ++FTYSV+F
Sbjct: 277 FDIQVEYHDRGENNYRVVGVIVNPVSIKRSTPGTCETSGAPLMLSEDQDNDVYFTYSVKF 336

Query: 234 IPSETAWVTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGELN 293
           IPSET W TRWDKYLH+YDP IQW                V  SLL+ALKSDF+RY ELN
Sbjct: 337 IPSETIWATRWDKYLHIYDPAIQWFSLINFSVVVLLLSSVVIHSLLKALKSDFARYNELN 396

Query: 294 LDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRG 353
           LD+  +E+A WKLGHGDVFR P   +LLS+LVGSGVQLFLMIIC+IF  A+G ++P SRG
Sbjct: 397 LDDDFQEEAGWKLGHGDVFRIPHRSLLLSVLVGSGVQLFLMIICSIFFAALGFLSPSSRG 456

Query: 354 TLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXXX 413
           +L TVMF+LY  F F+ S+ SMGVYKFF G  W +N                        
Sbjct: 457 SLATVMFILYALFGFVGSYTSMGVYKFFGGPYWKVNMLLTPILVPGLIFCGIVALNIFLL 516

Query: 414 FVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKW 473
           FVHSSGVIP  T   +ILLWF   +PL++ GSL+A K C+WD HPTKTN +++ IP Q W
Sbjct: 517 FVHSSGVIPAVTLFFMILLWFVFSIPLALAGSLIAHKKCNWDEHPTKTNQIARQIPFQPW 576

Query: 474 YLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIXXXXXXXXXXXXX 533
           YL+T PA+LI G+F FGS++VELYF+Y+SLWFNKIFYM+GFL  S               
Sbjct: 577 YLKTWPATLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFFLLTLTTSLVTILI 636

Query: 534 XYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLA 593
            Y+SL  ENW WQWR F+I G+GC+ YVF+HS+LFT+ KLGGFT  +LY+GYS +I+ L 
Sbjct: 637 TYHSLCLENWMWQWRGFIIGGVGCAIYVFIHSILFTKFKLGGFTTIVLYVGYSTIISLLF 696

Query: 594 FVVTGALGFLSSMLFVRTIYSAVKVD 619
            +VTGA+GFLSSM F+R IYS++KV+
Sbjct: 697 CIVTGAIGFLSSMFFIRKIYSSIKVE 722

>Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON}
           YDR107C (REAL)
          Length = 690

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/627 (55%), Positives = 449/627 (71%), Gaps = 8/627 (1%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60
           +++ H+++ G+DIS+D +  +YSYDYY E+ HFC+PEHVE+   S+GS++FGDR+YNSPF
Sbjct: 64  IYFQHQDENGKDISSDKEHYLYSYDYYNERFHFCRPEHVERQPESLGSIIFGDRIYNSPF 123

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120
           QL ML+ K C  LC +TI G+DAKFINKLIK+G++QNWL+DGLPAAR+V+D+RTK+N+YG
Sbjct: 124 QLRMLETKECVALCENTIPGKDAKFINKLIKSGFFQNWLVDGLPAARKVWDSRTKTNYYG 183

Query: 121 NGFELGLVEIRQTTGEKLLPNS--------ADTFRDLHKRDAKNIVQNLMQDIEVPYFVN 172
            GFELG+  ++ T   K++P++        ++T   L  R+ KNI  NL++ +E+PYFVN
Sbjct: 184 TGFELGITAVKNTIDGKVIPSTMEELDSETSNTGAALDAREPKNIKPNLVKTVELPYFVN 243

Query: 173 HFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVE 232
           HFDI +E+HDRG+DNYRVVGVTVNP+SI+RS    C    K L L E   N I+FTYSV+
Sbjct: 244 HFDIEVEFHDRGDDNYRVVGVTVNPMSIERSSPDSCSKATKPLILDEEGDNEIYFTYSVK 303

Query: 233 FIPSETAWVTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGEL 292
           F+ S+T W TRWDKYLH+YDP IQW                V  SLL+AL SD SRY EL
Sbjct: 304 FVASDTVWATRWDKYLHIYDPQIQWFSLINFSVIIVLLSSVVMHSLLRALNSDLSRYNEL 363

Query: 293 NLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSR 352
           NLD    ED+ WKLGHGDVFR P   MLLS+LVGSGVQLFLMIIC+IFL A+GL++P SR
Sbjct: 364 NLDNEFHEDSGWKLGHGDVFRTPTKSMLLSVLVGSGVQLFLMIICSIFLAALGLVSPVSR 423

Query: 353 GTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXX 412
           G+LPTVMF+ Y  F F+ S+ SMGVYKFF+G  W  N                       
Sbjct: 424 GSLPTVMFVFYALFGFVGSYTSMGVYKFFHGPYWKANLILTPILLPGGIFVLIVAMNFFL 483

Query: 413 XFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQK 472
            F HSSGVIP +T   +I LWF + +PLS  GS++A K C+WD HPTKTN +++ +P Q 
Sbjct: 484 LFAHSSGVIPASTLFFIIFLWFAVSIPLSFAGSMIAHKWCNWDEHPTKTNQIARQVPYQP 543

Query: 473 WYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIXXXXXXXXXXXX 532
           WYL+TI A+LI G+F FGS++VELYF+Y+SLWFNKIFYM+GFL  S +            
Sbjct: 544 WYLRTIQATLIAGIFCFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTVL 603

Query: 533 XXYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSL 592
             Y+SL  ENWQWQWRSF+I GLGCS Y+F+HS+LFT+ KLGGF   +LY GYSF+I++L
Sbjct: 604 ITYHSLCLENWQWQWRSFIIGGLGCSVYMFIHSILFTKFKLGGFITIVLYFGYSFIISAL 663

Query: 593 AFVVTGALGFLSSMLFVRTIYSAVKVD 619
             VVTGA+GF S MLF+R IYSAVK++
Sbjct: 664 CCVVTGAIGFFSCMLFIRKIYSAVKIE 690

>YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON}
           EMP70Protein with a role in cellular adhesion,
           filamentous growth, and endosome-to-vacuole sorting;
           similar to Tmn2p and Tmn3p; member of Transmembrane Nine
           family of proteins with 9 transmembrane segments
          Length = 667

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/619 (57%), Positives = 440/619 (71%), Gaps = 1/619 (0%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60
           M+Y HK+++G ++S D +  +YSYDYYY + HFC+PE VEK   S+GSV+FGDR+YNSPF
Sbjct: 50  MNYQHKDEDGNNVSGDKENFLYSYDYYYNRFHFCQPEKVEKQPESLGSVIFGDRIYNSPF 109

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120
           QLNML+ K CE LC + I G DAKFINKLIKNG++QNWLIDGLPAAREVYD RTK++FYG
Sbjct: 110 QLNMLQEKECESLCKTVIPGDDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTSFYG 169

Query: 121 NGFELGLVEIRQTTGEKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEY 180
            GF LG V++ Q T  +  P  A+T     + + +N  +N+++  E+PYF NHFDI IEY
Sbjct: 170 AGFNLGFVQVTQGTDIEATPKGAETTDKDVELETRN-DRNMVKTYELPYFANHFDIMIEY 228

Query: 181 HDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSETAW 240
           HDRG  NYRVVGV V PVSI RS  G C+ TG  L L E   N ++FTYSV+F  S T+W
Sbjct: 229 HDRGEGNYRVVGVIVEPVSIKRSSPGTCETTGSPLMLDEGNDNEVYFTYSVKFNESATSW 288

Query: 241 VTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGELNLDETIKE 300
            TRWDKYLHVYDP+IQW                V  SLL+ALKSDF+RY ELNLD+  +E
Sbjct: 289 ATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQE 348

Query: 301 DASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPTVMF 360
           D+ WKL HGDVFR+P   + LSILVGSGVQLFLM+ C+IF  A+G ++P SRG+L TVMF
Sbjct: 349 DSGWKLNHGDVFRSPSQSLTLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMF 408

Query: 361 LLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXXXFVHSSGV 420
           +LY  F F+ S+ SMG+YKFFNG  W  N                        FVHSSGV
Sbjct: 409 ILYALFGFVGSYTSMGIYKFFNGPYWKANLILTPLLVPGAILLIIIALNFFLMFVHSSGV 468

Query: 421 IPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQTIPA 480
           IP +T   ++ LWF   +PLS  GSL+ARK CHWD HPTKTN +++ IP Q WYL+TIPA
Sbjct: 469 IPASTLFFMVFLWFLFSIPLSFAGSLIARKRCHWDEHPTKTNQIARQIPFQPWYLKTIPA 528

Query: 481 SLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIXXXXXXXXXXXXXXYYSLSA 540
           +LI G+F FGS++VELYF+YTSLWFNKIFYM+GFLF S +              Y+SL  
Sbjct: 529 TLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTSSLVTILITYHSLCL 588

Query: 541 ENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVTGAL 600
           ENW+WQWR F+I G GC+ YVF+HS+LFT+ KLGGFT  +LY+GYS VI+ L  +VTG++
Sbjct: 589 ENWKWQWRGFIIGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSI 648

Query: 601 GFLSSMLFVRTIYSAVKVD 619
           GF+SSMLFVR IYS++KVD
Sbjct: 649 GFISSMLFVRKIYSSIKVD 667

>Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {ON}
           YLR083C (REAL)
          Length = 663

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/622 (56%), Positives = 436/622 (70%), Gaps = 7/622 (1%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60
           M+Y HK++EG ++S D +  +YSYDYY  + HFCKPE VEK   S+GS++FGDR+YNSPF
Sbjct: 46  MYYQHKDEEGNNVSGDKENFLYSYDYYNSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPF 105

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120
           QL ML+ K C  LC  TI G DAKFINKLIKNG++QNWLIDGLPAAR V D RTK++FYG
Sbjct: 106 QLKMLEEKECVSLCKKTIPGNDAKFINKLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYG 165

Query: 121 NGFELGLVEIRQTTGEKLLPNSADTFR---DLHKRDAKNIVQNLMQDIEVPYFVNHFDIR 177
            GFELG VE+ Q T  +  PN+A+T     +L  RD  N+VQ      E PYF NH+DIR
Sbjct: 166 AGFELGFVEVTQGTASEATPNTAETTNQGVELDTRDGHNMVQTY----EHPYFTNHYDIR 221

Query: 178 IEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSE 237
           IEYHDRG  NYRVVGV VNPVSI RS    C+  G  L L E   N ++FTYSV+F+ SE
Sbjct: 222 IEYHDRGEGNYRVVGVIVNPVSIKRSDPETCETDGSPLMLDEENDNEVYFTYSVKFVESE 281

Query: 238 TAWVTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGELNLDET 297
           T+W TRWDKYLHVYDP+IQW                V  SLL+ALKSDF+RY ELNLD+ 
Sbjct: 282 TSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDD 341

Query: 298 IKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPT 357
            +ED+ WKL HGDVFRAP   + LSILVGSGVQLF M+ C+IF  A+G ++P SRG+L T
Sbjct: 342 FQEDSGWKLSHGDVFRAPSRSLTLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLAT 401

Query: 358 VMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXXXFVHS 417
           VMF+LY  F F+ S+ SMG+YKFF+G  W  N                        FVHS
Sbjct: 402 VMFMLYALFGFVGSYTSMGIYKFFDGPYWKANLILTPLLVPGTILIIIIALNFFLMFVHS 461

Query: 418 SGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQT 477
           SGVIP +T   ++ LWF   +PLS  GSL+ARK CHWD HPTKTN +++ IP Q WYL+T
Sbjct: 462 SGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKT 521

Query: 478 IPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIXXXXXXXXXXXXXXYYS 537
           +PA+LI G+F FGS++VELYF+YTSLWFNKIFYM+GFLF S +              Y+S
Sbjct: 522 VPATLIAGVFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHS 581

Query: 538 LSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVT 597
           L  ENW+WQWR F++ G GC+ YVF+HS+LFT+ KLGGFT  +LY+GYS VI+ L  +VT
Sbjct: 582 LCLENWKWQWRGFIVGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVT 641

Query: 598 GALGFLSSMLFVRTIYSAVKVD 619
           G++GF+SSM F+R IYS++KVD
Sbjct: 642 GSIGFISSMFFIRKIYSSIKVD 663

>Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/627 (55%), Positives = 442/627 (70%), Gaps = 8/627 (1%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60
           +++ H+++ G DIS+D +  +YSYDYY E+ HFC+PEHVEK   S+GSV+FGDR+YNSPF
Sbjct: 46  IYFQHQDENGNDISSDKEHFLYSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPF 105

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120
           QL ML+ K C  LC  TI GRDA+FIN+LI +G++QNWL+DGLPAAR VYD+RTK+N+YG
Sbjct: 106 QLRMLEEKECVALCKGTIPGRDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYG 165

Query: 121 NGFELGLVEIRQTTGEKLLPN--------SADTFRDLHKRDAKNIVQNLMQDIEVPYFVN 172
            GFELG  ++ QT G++ +PN        +++    LH R  KNI  N ++ +E+PYFVN
Sbjct: 166 TGFELGFTDVIQTVGDETVPNTMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVN 225

Query: 173 HFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVE 232
           HF+I +E+H+RGND+YR+VGVTVNPVSI+RS  G C  T K L+L E   N ++FTYSV+
Sbjct: 226 HFEIVVEFHERGNDSYRIVGVTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVK 285

Query: 233 FIPSETAWVTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGEL 292
           F+ S T W TRWDKYLH+YDP IQW               AV  SLL+ALKSD +RY EL
Sbjct: 286 FVASATVWATRWDKYLHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNEL 345

Query: 293 NLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSR 352
           NL+    EDA WKL HGDVFR P   MLLS+LVGSG+QLFLMIIC+IF  A GL++P SR
Sbjct: 346 NLNNEFHEDAGWKLSHGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISR 405

Query: 353 GTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXX 412
           G+L TVMFLLY  F F+ S+ SMGVYKFF+G  W  N                       
Sbjct: 406 GSLQTVMFLLYALFGFVGSYTSMGVYKFFHGPYWKANLIITPILLPGAILLLIVAMNIFL 465

Query: 413 XFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQK 472
            F HSSGVIP  +   +I LWF + +PLS  GS++A K C W+ HPTKTN +++ IP Q 
Sbjct: 466 LFAHSSGVIPAKSLFFIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQP 525

Query: 473 WYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIXXXXXXXXXXXX 532
           WYL+T  A+++ G+FSFGS++VELYF+Y+SLWFNKIFYM+GFL  S +            
Sbjct: 526 WYLRTTQATMVAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLITVL 585

Query: 533 XXYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSL 592
             Y+SL  ENW WQWRSF+I GLGCS Y+F+HS+LFT+ KLGGF   +LY+GYSF+++ L
Sbjct: 586 ITYHSLCLENWLWQWRSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVL 645

Query: 593 AFVVTGALGFLSSMLFVRTIYSAVKVD 619
             VVTGA+GF SSM+F+R IY AVKV+
Sbjct: 646 CCVVTGAIGFFSSMIFIRKIYYAVKVE 672

>Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {ON}
           YLR083C (REAL)
          Length = 664

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/619 (56%), Positives = 436/619 (70%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60
           M+Y H++++G  +S D +  +YSYDYYY++ HFC+P+HVEK   S+GSV+FGDR+YNSPF
Sbjct: 46  MYYQHEDEQGNSVSGDKENFLYSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPF 105

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120
           +LNML+ K C  LCN+TI G DAKFINKLIKNG++QNWLIDGLPAAREVYD RTK+NFYG
Sbjct: 106 ELNMLQEKECVPLCNTTIPGNDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYG 165

Query: 121 NGFELGLVEIRQTTGEKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEY 180
            GFELG VE+ Q T  K  P  A+T  +  +   +    ++++  E PYF NHFDI IEY
Sbjct: 166 AGFELGDVEVSQGTRSKTAPKQAETTNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEY 225

Query: 181 HDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSETAW 240
           HDRG  +YRVVGV VNP+SI RS  G C+     L L E   N + FTYSV+F  S T+W
Sbjct: 226 HDRGGGDYRVVGVIVNPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSW 285

Query: 241 VTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGELNLDETIKE 300
            TRWDKYLHVYDP+IQW                V  SLL+ALKSDF+RY ELNL++  +E
Sbjct: 286 ATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLEDDFQE 345

Query: 301 DASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPTVMF 360
           D+ WKL HGDVFR P H +LLSILVGSGVQLFLM+ C+IF  A+G ++P SRG+L TVMF
Sbjct: 346 DSGWKLNHGDVFRPPSHSLLLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMF 405

Query: 361 LLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXXXFVHSSGV 420
           +LY  F F+ S+ SMG+YKFFNG  W  N                         VHSSGV
Sbjct: 406 ILYALFGFVGSYTSMGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGV 465

Query: 421 IPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQTIPA 480
           IP  T   ++ LWF   +PLS  GSL+ARK C WD HPTKTN +++ IP Q WYL+TIPA
Sbjct: 466 IPARTLFFMVFLWFLFSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPA 525

Query: 481 SLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIXXXXXXXXXXXXXXYYSLSA 540
           +LI G+F FGS++VELYF+YTSLWFNKIFYM+GFLF S +              Y+SL  
Sbjct: 526 TLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCL 585

Query: 541 ENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVTGAL 600
           ENW+WQWR F++ G+GC+ YVF+HS+LFT+ KLGGF   +LY+GYS+VI+ L  +VTG++
Sbjct: 586 ENWKWQWRGFIVGGVGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSI 645

Query: 601 GFLSSMLFVRTIYSAVKVD 619
           GF+SSM F+R IYS++KVD
Sbjct: 646 GFISSMFFLRRIYSSIKVD 664

>Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {ON}
           YLR083C (REAL)
          Length = 684

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/639 (54%), Positives = 443/639 (69%), Gaps = 20/639 (3%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60
           M+Y H++++G ++S D +  +YSYDYYY+K HFCKPEHVEK   S+GS++FGDR+YNSPF
Sbjct: 46  MYYQHQDEDGNNVSGDKEHFLYSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPF 105

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120
           +LNML+ K C  LC + I G DAKFINKLIKNG++QNWLIDGLPAAREV+D RTK++FYG
Sbjct: 106 ELNMLQEKECVSLCKTVIPGDDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYG 165

Query: 121 NGFELGLVEIRQ-----------TTGE---------KLLPNSADTFRDLHKRDAKNIVQN 160
            GF LG VE+ Q            +GE         K  P    +  +  + DA++  +N
Sbjct: 166 AGFGLGFVEVAQVVDSETEQVQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKN 225

Query: 161 LMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSES 220
           +++  E PYF NHFDI+IEYHDRG  NYRVVGV VNP+SI RS  G C+  G  L L E+
Sbjct: 226 MVKTREFPYFANHFDIKIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEA 285

Query: 221 EVNYIHFTYSVEFIPSETAWVTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQ 280
             N ++FTYSV+F  S T+W TRWDKYLHVYDP+IQW                V  SLL+
Sbjct: 286 NDNEVYFTYSVKFEESPTSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLR 345

Query: 281 ALKSDFSRYGELNLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIF 340
           ALKSDF+RY ELNLD+  +ED+ WKL HGDVFR P   ++LSILVGSGVQ+FLM+ C+IF
Sbjct: 346 ALKSDFARYNELNLDDDFQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIF 405

Query: 341 LPAVGLITPGSRGTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXX 400
             A+G ++P SRG+L TVMF+LY  F F+ S+ SMG+YKFF+G  W  N           
Sbjct: 406 FAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGA 465

Query: 401 XXXXXXXXXXXXXFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTK 460
                        FVHSSGVIP +T   ++ LWF   +PLS  GSL+ARK CHWD HPTK
Sbjct: 466 ILLVIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTK 525

Query: 461 TNTVSKVIPPQKWYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAI 520
           TN +++ IP Q WYL+T+PA+LI G+F FGS++VELYF+YTSLWFNKIFYM+GFLF S +
Sbjct: 526 TNQIARQIPFQPWYLKTLPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFL 585

Query: 521 XXXXXXXXXXXXXXYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNAL 580
                         Y+SL  ENW+WQWR F + G+GC+ YVF+HS+LFT+ KLGGFT  +
Sbjct: 586 LLTLTTSLVTVMITYHSLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIV 645

Query: 581 LYMGYSFVITSLAFVVTGALGFLSSMLFVRTIYSAVKVD 619
           LY+GYS VI+ L  +VTG++GF+SSM F+R IYS++KVD
Sbjct: 646 LYLGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 684

>Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}
           complement(78246..80222) [1977 nt, 659 aa]
          Length = 658

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/619 (55%), Positives = 436/619 (70%), Gaps = 7/619 (1%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60
           +++ HK+ +G DI  + +  +YS+DYY+ KLHFCKPEHVEK   S+GS+LFGDR+YNSPF
Sbjct: 47  LNFQHKDDQGNDIKGNKEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPF 106

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120
            + ML+N+ C  LC  TI   DAKFINKLIKNG++QNWLIDGLPAAR+++D +TKS+FYG
Sbjct: 107 SIKMLENQECTSLCKVTIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYG 166

Query: 121 NGFELGLVEIRQTTGEKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEY 180
            GF LG V +RQ  G   L +S     +   R+AKN V N++ ++E+P+  NH+DI +EY
Sbjct: 167 TGFPLGNVHVRQAVGG--LASSKLNLEN-PAREAKN-VNNMVHNVEIPFLFNHYDINVEY 222

Query: 181 HDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSETAW 240
           HDRG  NYRVVGVTV+P S   S    C      L L E+E N + F+YSV FIPSET W
Sbjct: 223 HDRGEGNYRVVGVTVDPKS---STGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVW 279

Query: 241 VTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGELNLDETIKE 300
            TRWDKYLHVYDPTIQW                V  SL++ALKSDF+RY E NLD+T ++
Sbjct: 280 ATRWDKYLHVYDPTIQWFSLINFSVVVILLSMVVIHSLMRALKSDFARYEEFNLDDTFQQ 339

Query: 301 DASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPTVMF 360
           D+ WKLGHGDVFR PD  MLLSILVGSG QLFLM+  +IF  A+G+++P SRG+LP+ MF
Sbjct: 340 DSGWKLGHGDVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMF 399

Query: 361 LLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXXXFVHSSGV 420
           +LY  F F  S+VSMGVYKFFNG  W  N                        F  SSG 
Sbjct: 400 ILYALFGFCGSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGT 459

Query: 421 IPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQTIPA 480
           IP      +I+LWF I +PLS+ GSL+A K C+W  HPTKTN +++ IP Q WYL+T+PA
Sbjct: 460 IPPTALIFVIVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPA 519

Query: 481 SLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIXXXXXXXXXXXXXXYYSLSA 540
           +LI GLF FGS++VELYF+Y+SLWFNKIFYM+GFLF S +              YYSL+ 
Sbjct: 520 TLIAGLFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTTLVTILITYYSLNL 579

Query: 541 ENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVTGAL 600
           ENW+WQWRSF++ G+GC+FY+F+HS++FT+ KLGGFT  +LY+GYS +I++L  VVTGA+
Sbjct: 580 ENWRWQWRSFIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAI 639

Query: 601 GFLSSMLFVRTIYSAVKVD 619
           GF+SSMLFV+ IYS+VKVD
Sbjct: 640 GFISSMLFVKKIYSSVKVD 658

>NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {ON} 
          Length = 666

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/627 (55%), Positives = 436/627 (69%), Gaps = 15/627 (2%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60
           +++   +  G+  S + +  +YS+DYY+++LHFCKPEH+EK   S+GS++FGDR+YNSPF
Sbjct: 47  VYFQRTDANGK--SKNKEHFLYSFDYYFDRLHFCKPEHIEKQPESLGSIIFGDRIYNSPF 104

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120
           +L ML+ KTC  LC STI G+DAKFINKLIKNG++QNWLIDGLPAA +VYD +TKS FYG
Sbjct: 105 ELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNGFFQNWLIDGLPAATQVYDRKTKSEFYG 164

Query: 121 NGFELGLVEIRQ--------TTGEKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVN 172
            GFELG VE  Q        TT  K   N      +L  R+AKN+   ++++IE+ YFVN
Sbjct: 165 TGFELGFVESFQAIDGQAPATTKPKQTTNEG---LELETREAKNV--QMVKNIEIAYFVN 219

Query: 173 HFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVE 232
           H+DI++EYHDRG   YRVVGV VNPVSI RS  G C+ TG  L LSE   N ++FTYSV+
Sbjct: 220 HYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVK 279

Query: 233 FIPSETAWVTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGEL 292
           F+PSET W TRWDKYLH YDPTIQW                V  SL++ALKSDF+RY E 
Sbjct: 280 FVPSETVWATRWDKYLHTYDPTIQWFSLVNFSIIVLLLSSVVIHSLMKALKSDFARYNEF 339

Query: 293 NLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSR 352
           NL++  +EDA WKLGHGDVFR P   MLLS+LVGSGVQLFLMI C+IF  A+G ++P SR
Sbjct: 340 NLEDDFQEDAGWKLGHGDVFRIPHKSMLLSVLVGSGVQLFLMISCSIFFAALGFLSPSSR 399

Query: 353 GTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXX 412
           G+L TVMF+LY  F F+ S+ SM VYKFF G  W +N                       
Sbjct: 400 GSLATVMFILYALFGFVGSYTSMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFL 459

Query: 413 XFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQK 472
            F HSSGV+P  T   +ILLWF   +PL+  GSL+A K C WD HPTKTN +++ IP Q 
Sbjct: 460 MFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQP 519

Query: 473 WYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIXXXXXXXXXXXX 532
           WYL+T PA++I G+F FGS++VELYF+YTSLWFNKIFYM+GFL  S +            
Sbjct: 520 WYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLLFSFLLLTLTTSLVTIL 579

Query: 533 XXYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSL 592
             Y+SL  ENWQWQWR F++ G+GC+ YVF+HS+LFT+ KLGGF   +LY+GYS +I+ L
Sbjct: 580 ITYHSLCLENWQWQWRGFIVGGVGCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLL 639

Query: 593 AFVVTGALGFLSSMLFVRTIYSAVKVD 619
             VVTGA+GFLSS++FVR IYSA+KVD
Sbjct: 640 FCVVTGAIGFLSSLIFVRKIYSAIKVD 666

>KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {ON}
           Anc_8.254 YLR083C
          Length = 664

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/622 (56%), Positives = 445/622 (71%), Gaps = 5/622 (0%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60
           M++ HKN EG+D+S+D  + +YSYDYYY++ HFC+PE +EK   S+GS++FGDR+YNSPF
Sbjct: 45  MYWQHKNDEGKDVSSDKNKYLYSYDYYYDRFHFCQPEKIEKQPESLGSIMFGDRIYNSPF 104

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120
           QLNML+ K C  LC STI G DAKFINKLIKNG++QNWLIDGLPAA E +DTRT ++FYG
Sbjct: 105 QLNMLEEKQCASLCKSTIPGNDAKFINKLIKNGFFQNWLIDGLPAAHEAHDTRTGTDFYG 164

Query: 121 NGFELGLVEIRQTTGE---KLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIR 177
           +GFELGLV++ Q   E   +    +A+   +L  RDAKN+    ++++E+ YFVNH+DIR
Sbjct: 165 SGFELGLVDVVQAVDETEARTKVAAANQGAELDARDAKNV--KTIKNVELVYFVNHYDIR 222

Query: 178 IEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSE 237
           IEYHDRGN +YRVVGV VNPVSI RS  G C+ TG+ L+L E E N ++FTYSV F+PSE
Sbjct: 223 IEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSE 282

Query: 238 TAWVTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGELNLDET 297
           T+W TRWDKYLHVYDPTIQW                V  SLL+ALK+DF+RY E NLD+ 
Sbjct: 283 TSWATRWDKYLHVYDPTIQWFSLVNFSLIVLLLSTVVLHSLLKALKNDFARYNEFNLDDE 342

Query: 298 IKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPT 357
            +EDA WKL HGDVFR P   MLLS+LVGSGVQLF+MI  TIF  A+G ++P SRG L T
Sbjct: 343 FQEDAGWKLCHGDVFRIPHKSMLLSVLVGSGVQLFIMISTTIFFAALGFLSPSSRGLLGT 402

Query: 358 VMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXXXFVHS 417
           VMF+LY  F F+ S+ SMGVYKFF G  W  N                        +VHS
Sbjct: 403 VMFMLYALFGFVGSYTSMGVYKFFRGPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHS 462

Query: 418 SGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQT 477
           SGVIP  T   ++LLWF   +P +  GSL+A K C+W+ HPTKT  +++ IP Q WYL+T
Sbjct: 463 SGVIPAKTLFFMVLLWFVFSIPSAFAGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKT 522

Query: 478 IPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIXXXXXXXXXXXXXXYYS 537
           IPA+ I G+F FGS++VE+YF+YTSLW+NKIFYM+GFLF S +              Y+S
Sbjct: 523 IPATFIAGIFPFGSIAVEIYFIYTSLWYNKIFYMFGFLFVSLLLLALTTSLVTVLITYHS 582

Query: 538 LSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVT 597
           L  ENW WQWRSF++ G+GC+ YVF+HS+LFT+ KLGGFT  +LY+GYS +I+ L  +VT
Sbjct: 583 LCLENWNWQWRSFIVGGVGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSSIISLLCCIVT 642

Query: 598 GALGFLSSMLFVRTIYSAVKVD 619
           G++GFLSSM FVR I+S++KVD
Sbjct: 643 GSIGFLSSMFFVRKIFSSIKVD 664

>CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {ON}
           highly similar to uniprot|Q04562 Saccharomyces
           cerevisiae YDR107c or uniprot|P32802 Saccharomyces
           cerevisiae YLR083c EMP70
          Length = 691

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/647 (50%), Positives = 430/647 (66%), Gaps = 28/647 (4%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60
           +++ H + +G +I  D  R +Y YDYY EKLHFC+PE +EK   S+GSV+FG+++YNSPF
Sbjct: 45  LNFQHVDDDGNEIKGDKARMLYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPF 104

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120
            + ML++  C +LC++TI G+DAKFINKLIKNG+ QNWLIDGLPAAR+++D+RT + FYG
Sbjct: 105 NVKMLEDNECVQLCSTTIPGKDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYG 164

Query: 121 NGFELGLVEIRQTTGEKLLPNSADTFR---------------------------DLHKRD 153
            GFELG VE+RQ  G K++  S    +                           +L  R+
Sbjct: 165 QGFELGFVEVRQAVGGKIVSESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVRE 224

Query: 154 AKNIVQNLMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGK 213
           AKN+V N++ ++EVP F NHFDI +EYHDRGN ++RVVGV VNPVS+D      C    +
Sbjct: 225 AKNVVDNIVTNVEVPVFANHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQ 284

Query: 214 -ALSLSESEVNYIHFTYSVEFIPSETAWVTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXC 272
             L L E++ N + FTYSV+F PS+T W TRWDKYLH+YDP IQW               
Sbjct: 285 HKLHLDENKDNEVMFTYSVKFTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSS 344

Query: 273 AVARSLLQALKSDFSRYGELNLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLF 332
               SLL+ALKSD SRY E NL +  +ED+ WKL HGDVFR P + MLLS+LVGSG+QLF
Sbjct: 345 VAIHSLLRALKSDISRYNEFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGIQLF 404

Query: 333 LMIICTIFLPAVGLITPGSRGTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCXX 392
           LMI  +I L A+G+++P SRG+LPT MF+ Y  F F+ S+ SMG+YKFF G  W  N   
Sbjct: 405 LMIFLSIILSALGILSPSSRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMIL 464

Query: 393 XXXXXXXXXXXXXXXXXXXXXFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTC 452
                                FV SS VIPLAT   ++ LW    +PL+  GSL++ K C
Sbjct: 465 TPVLLPGIIFLTVIFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKC 524

Query: 453 HWDIHPTKTNTVSKVIPPQKWYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMY 512
           +WD HPTKTN + + IP Q W+L+T+PA+LIGGL SFGS++VELYF+Y+SLWFNKIFYM+
Sbjct: 525 NWDEHPTKTNEIPRQIPFQPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMF 584

Query: 513 GFLFGSAIXXXXXXXXXXXXXXYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVK 572
           GFL  S +              Y +L +ENW WQWRSF I GLGCS Y+F+HS+LFT+ K
Sbjct: 585 GFLLFSIVLFSFTTGLINVIITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFK 644

Query: 573 LGGFTNALLYMGYSFVITSLAFVVTGALGFLSSMLFVRTIYSAVKVD 619
           LGGF   +LY+GYSF+I+ L  +VTGA+GF+ SM FVR I++++KVD
Sbjct: 645 LGGFATIVLYVGYSFLISFLTCIVTGAIGFICSMFFVRRIFASIKVD 691

>ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 647

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/619 (54%), Positives = 424/619 (68%), Gaps = 17/619 (2%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60
           M++ H++++G  +  D +  +YSYDYYY K HFCKPE+V +   S+GSV+FGDR++NSPF
Sbjct: 46  MNFQHEDEDGNMVKGDKEHYLYSYDYYYSKFHFCKPENVVRQPASLGSVIFGDRIFNSPF 105

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120
           +LNML+ K C  LC+S I G DAKF+NKLIKNG+ QNWLIDGLPA RE++D+RT SNFYG
Sbjct: 106 KLNMLEEKECVPLCSSRIPGEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYG 165

Query: 121 NGFELGLVEIRQTTGEKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEY 180
            GF+LG V++             + F D +  + K     +M+ +EVPY  NH+DI IEY
Sbjct: 166 TGFQLGFVDV------------TEGFSDSNDEEKK-----IMKTLEVPYLANHYDINIEY 208

Query: 181 HDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSETAW 240
           HDRGNDNYRVVGVTV+PVSI RS    C+    +L+LSE+E N +HFTYSV+FI S+T W
Sbjct: 209 HDRGNDNYRVVGVTVDPVSIKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVW 268

Query: 241 VTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGELNLDETIKE 300
            TRWDKYLHVYDPTIQW                V   LL+ALK+D SRY E NLD    E
Sbjct: 269 ATRWDKYLHVYDPTIQWFSLINCSVIVVALSSVVLHMLLRALKNDLSRYNEFNLDNEFHE 328

Query: 301 DASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPTVMF 360
           D+ WKL HGDVFR P   +LLSILVGSGVQLFLMI C+I   A+G ++P SRG+LPTVMF
Sbjct: 329 DSGWKLSHGDVFRIPPRSLLLSILVGSGVQLFLMIACSIIFAALGFLSPSSRGSLPTVMF 388

Query: 361 LLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXXXFVHSSGV 420
           LLY  F F+ S+ SM +YKFF G  W +N                        FV SSG 
Sbjct: 389 LLYALFGFVGSYTSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGA 448

Query: 421 IPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQTIPA 480
           IP  T  ++ILLWF   +PLS  GSL+A K C  D HPTKTN +++ IP Q WYL+TIP 
Sbjct: 449 IPAGTLFTIILLWFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPV 508

Query: 481 SLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIXXXXXXXXXXXXXXYYSLSA 540
           SLI G+F F S++VELYF+YTSLWFNKIFYM+GFL  S +              Y+SL  
Sbjct: 509 SLIAGVFPFASIAVELYFIYTSLWFNKIFYMFGFLLFSFLLLTFTTALVTILTTYHSLCL 568

Query: 541 ENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVTGAL 600
           ENW+WQWRSF+I G GC+ YVF+HS+LFT+ KLGGFT  +LY+GYS +I+ L  +VTG++
Sbjct: 569 ENWKWQWRSFIIGGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSI 628

Query: 601 GFLSSMLFVRTIYSAVKVD 619
           GF+SSM F+R IYS+VKVD
Sbjct: 629 GFISSMFFIRKIYSSVKVD 647

>SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 660

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/626 (53%), Positives = 421/626 (67%), Gaps = 17/626 (2%)

Query: 2   HYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPFQ 61
           ++ H +QEG  +S D +R +YSYDYYY+K HFC+PE++ K   S+GS++FGDR+YNSPF+
Sbjct: 44  YFQHADQEGHTMSGDKERFLYSYDYYYDKFHFCRPENLIKQPESLGSIIFGDRIYNSPFE 103

Query: 62  LNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYGN 121
           LNML+NKTC  LC S I   DAKFINKLI+NG++ NWL+DGLPAARE++D RT S FYGN
Sbjct: 104 LNMLENKTCVPLCKSEIPKDDAKFINKLIRNGFFHNWLVDGLPAAREMHDGRTNSYFYGN 163

Query: 122 GFELGLVEIRQTTGE---KLLPNS-----ADTFRDLHKRDAKNIVQNLMQDIEVPYFVNH 173
           GFELG V++  T  +   K +  S     AD  ++L +R AK          E+ YF+NH
Sbjct: 164 GFELGFVDVVDTIEDPDTKKVSESDYIEIADADKELKERSAKLT--------ELSYFINH 215

Query: 174 FDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEF 233
           FDI+IEYHDRG DNYRVVGV+V P SI R     C   G+ L LSE   N +HFTYSV F
Sbjct: 216 FDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCDTEGEPLVLSEDADNTVHFTYSVSF 275

Query: 234 IPSETAWVTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGELN 293
           +PS+T W TRWDKYLHVYDP IQW                +  SL +ALK+D SRY ELN
Sbjct: 276 VPSQTLWATRWDKYLHVYDPQIQWFSLISFSLIVILLSSVMVHSLFRALKNDLSRYNELN 335

Query: 294 LDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRG 353
           LD+  +E+  WKL HGDVFR P+  MLLS+LVGSG QLFLM   TI    +GL++P SRG
Sbjct: 336 LDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSGAQLFLMAGFTILFALLGLLSPSSRG 395

Query: 354 TLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXXX 413
           +L TVMF+LY  F    S+ SM VYKFFNGQ W +N                        
Sbjct: 396 SLTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKLNMILTPILIPSMIFISMLGLNTFLV 455

Query: 414 FVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKW 473
           FVHSSG IP  T  ++++LWF   +PLS+ GS+++RK   WD  PT TN +++ IP Q W
Sbjct: 456 FVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISRKKSQWD-RPTNTNQIARQIPFQPW 514

Query: 474 YLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIXXXXXXXXXXXXX 533
           YL+T+PASLI G F FGS+ VELYF+Y+SLWFNKIFYM+GFLF S +             
Sbjct: 515 YLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIFYMFGFLFFSFLLLTLTTTLVTVLL 574

Query: 534 XYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLA 593
            YYSL  ENW+WQWR F I G GC+FYVF+H++LFT+ KLGG T  +LY+GYS VI+ L 
Sbjct: 575 TYYSLCMENWKWQWRGFWIGGAGCAFYVFVHAILFTKFKLGGLTTVVLYLGYSVVISGLC 634

Query: 594 FVVTGALGFLSSMLFVRTIYSAVKVD 619
            ++TGA+GFLSS+ FVR IY ++KVD
Sbjct: 635 CLITGAVGFLSSLWFVRKIYGSIKVD 660

>KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]
           {ON} similar to uniprot|P32802 Saccharomyces cerevisiae
           YLR083C EMP70 Protein whose 24kDa cleavage product is
           found in endosome-enriched membrane fractions predicted
           to be a transmembrane protein
          Length = 665

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/623 (52%), Positives = 420/623 (67%), Gaps = 15/623 (2%)

Query: 3   YHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPFQL 62
           Y H + +  D + D +  +YSYDYYY+K HFC+P  ++K   S+GS++FGDR+YNSPF+L
Sbjct: 52  YKHYDTDQHD-TGDKEGFLYSYDYYYKKFHFCQPAELKKQPESLGSIIFGDRIYNSPFKL 110

Query: 63  NMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYGNG 122
            +LKN  C+ LC S I G+DAKFINKLI NG++QNW+IDGLPAAR++ DT+T   FYGNG
Sbjct: 111 QLLKNVECQSLCKSVIPGKDAKFINKLILNGFFQNWIIDGLPAARKMEDTKTNKIFYGNG 170

Query: 123 FELGLVEIRQTTGEKLLPNSADTFRDLHKR------DAKNIVQNLMQDIEVPYFVNHFDI 176
           FELGLV++        L +     R LH          KN++    +  E+PYFVNH+DI
Sbjct: 171 FELGLVDV--------LSDYEPDTRSLHDELELQLNAKKNVLSPGDKVTEIPYFVNHYDI 222

Query: 177 RIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPS 236
           +IEYHDRG +NYR+VGVTVNP SI R     C+ TGK+L LSE+E N ++FTYSV+FI S
Sbjct: 223 QIEYHDRGENNYRIVGVTVNPASIKRDSPDSCESTGKSLVLSETEDNEVYFTYSVKFIKS 282

Query: 237 ETAWVTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGELNLDE 296
           +T W TRWDKYLHVYDP IQW                +  SL  ALK+D +RY ELNLD 
Sbjct: 283 DTVWATRWDKYLHVYDPKIQWFSLINFSTIVVLLSSVMLHSLYSALKNDLARYNELNLDT 342

Query: 297 TIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLP 356
             +E+  WKL HGDVFR+P+  +LLS+LVGSG QL LM+  TI    +G ++P SRG+L 
Sbjct: 343 DFEEETGWKLIHGDVFRSPNKALLLSVLVGSGGQLALMLTTTILFACLGFLSPSSRGSLS 402

Query: 357 TVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXXXFVH 416
           TVMFLLY  F    SF SM  YKFFNG+ W +N                        FVH
Sbjct: 403 TVMFLLYAIFGSFGSFTSMATYKFFNGKAWRLNLVLTPLLVPGSILTVVLGLNFFLIFVH 462

Query: 417 SSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQ 476
           SSG IP  T   L+LLWF I +PLS  GS++A K C+W+ HPTKTN +++ IP Q WYL+
Sbjct: 463 SSGAIPFQTMLVLVLLWFVISIPLSAIGSVIAWKKCNWNEHPTKTNQIARQIPFQPWYLK 522

Query: 477 TIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIXXXXXXXXXXXXXXYY 536
           TIP +L+ G+F FGS++VELYF+Y+SLWFNKI+YM+GFLF S I              Y+
Sbjct: 523 TIPVALLAGIFPFGSIAVELYFIYSSLWFNKIYYMFGFLFFSFILLALTTSLITVLLTYH 582

Query: 537 SLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVV 596
           SL  ENW+WQWRSF+I G GC+FYVF HS+LFT+ +LGG T  +LY+GYS +I+ L  +V
Sbjct: 583 SLCMENWKWQWRSFVIGGCGCAFYVFCHSILFTKFRLGGLTTIVLYLGYSILISGLCCLV 642

Query: 597 TGALGFLSSMLFVRTIYSAVKVD 619
           TGA+GFLSS++ VR IYS VKVD
Sbjct: 643 TGAIGFLSSLILVRKIYSCVKVD 665

>KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {ON}
           Anc_8.254 YLR083C
          Length = 667

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/621 (53%), Positives = 432/621 (69%), Gaps = 4/621 (0%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60
           M++ H+ ++G+++  D  R +YSYDYYY++ HFC+PE + K   S+GS++FGDR+YNSP+
Sbjct: 49  MYWQHETEDGENMKGDKSRYLYSYDYYYDRFHFCQPEKIVKEPESLGSIIFGDRIYNSPY 108

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120
           Q+ ML+ KTC  LCN+ I G+DA+FINKLIKNG++QNWLIDGLPAAR V+D  T S+FYG
Sbjct: 109 QIKMLEEKTCVPLCNTIIPGKDAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYG 168

Query: 121 NGFELGLVEIRQTTGE-KLLPNSADT-FRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRI 178
           NGFELG VE+ Q   + K  P   D+    L  RDAKN+   +++++E+PYF NH DI +
Sbjct: 169 NGFELGSVEVVQAVAQAKTHPKEDDSGSAKLSTRDAKNV--QMLKNVELPYFANHHDITV 226

Query: 179 EYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSET 238
           EYHDRG  N RVVGVTV+P+SI RS  G C+ +G  L L E   N ++FTYSV F+ S+T
Sbjct: 227 EYHDRGEGNLRVVGVTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDT 286

Query: 239 AWVTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGELNLDETI 298
            W TRWDKYLH YDPTIQW                V   LL+AL+SDF+RY ELNLD   
Sbjct: 287 VWATRWDKYLHTYDPTIQWFSLVNFSIVVVLLSSVVIHMLLKALRSDFARYNELNLDNEF 346

Query: 299 KEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPTV 358
           +ED+ WKL HGDVFR P   MLLSILVGSG+QLFLMI  +IF  A+G ++P SRG+L TV
Sbjct: 347 QEDSGWKLTHGDVFRIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTV 406

Query: 359 MFLLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXXXFVHSS 418
           MF+LY  F F+ S+ SMGVYKFF G  W  N                          HSS
Sbjct: 407 MFMLYALFGFVGSYTSMGVYKFFRGPYWKANMILTPLLVPGCLLLSIVGLNMFLLGAHSS 466

Query: 419 GVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQTI 478
           G IP  T   ++LLWF I VP ++ GSL+A K C WD HPTKTN V++ +P Q WYL+T+
Sbjct: 467 GTIPAKTLFFIVLLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTV 526

Query: 479 PASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIXXXXXXXXXXXXXXYYSL 538
            A+ I G+F FGS++VELYF+YTSLW+NKIFYM+GFLF S +              Y+SL
Sbjct: 527 AATFIAGIFPFGSIAVELYFIYTSLWYNKIFYMFGFLFVSFLLLTLTTVLVTILITYHSL 586

Query: 539 SAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVTG 598
           S ENWQWQWRSF++ G+GC+ Y+F+HS+LFT++KLGGF   +LY+GYS VI+ L  +VTG
Sbjct: 587 SLENWQWQWRSFIVGGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTG 646

Query: 599 ALGFLSSMLFVRTIYSAVKVD 619
           ++GFLSSM FVR IYS++KV+
Sbjct: 647 SIGFLSSMFFVRRIYSSIKVE 667

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/630 (51%), Positives = 417/630 (66%), Gaps = 12/630 (1%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKP--EHVEKAGVSIGSVLFGDRLYNS 58
           M + HK+ +G ++S+D +  +YSYDYYY KLHFCKP    ++K   S+GS+LFGDR+YNS
Sbjct: 48  MFFKHKDSDGNELSSDKENFLYSYDYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNS 107

Query: 59  PFQLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNF 118
           PF+L ML ++ C+ LC++ I G DAKFIN LIK+G+ QNWLIDGLPAAR++YD  TKS+F
Sbjct: 108 PFELKMLVDENCKELCSTNIPGDDAKFINDLIKSGFLQNWLIDGLPAARQLYDQTTKSSF 167

Query: 119 YGNGFELGLVEIRQTTGEK---------LLPNSADTFRDLHKRDAKNIVQNLMQDIEVPY 169
           YG+GFELG VE+ Q   E          ++ +      D  +   K   Q L+  +E  Y
Sbjct: 168 YGSGFELGSVEMIQVVDEAPSHTTPKQPIVEDVLSQELDEEQATEKRANQMLVSSVERTY 227

Query: 170 FVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTY 229
           F NHFDI IEYHDRGN+ YR+VGVTVNP+S+ R     C      L+LSE     + FTY
Sbjct: 228 FANHFDIHIEYHDRGNNEYRIVGVTVNPISMKRD-SAICDTNLGKLALSEVSDTDVIFTY 286

Query: 230 SVEFIPSETAWVTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRY 289
           SV F  S+T W TRWDKYLH+YDPTIQW                V   L +ALK+DF RY
Sbjct: 287 SVTFEKSDTVWATRWDKYLHIYDPTIQWFSLINFTVIVVVLSIIVVHFLTKALKNDFVRY 346

Query: 290 GELNLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITP 349
            E NL+++  ED+ WKL HGDVFR P   MLLSI VGSG QLF MI   + L A+G ++P
Sbjct: 347 NEFNLNDSFDEDSGWKLAHGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSP 406

Query: 350 GSRGTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXX 409
            +RG+LPT+MF+LY  F F+ S+ SMGVY+FFNG  W  N                    
Sbjct: 407 SARGSLPTIMFILYAVFGFVGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMN 466

Query: 410 XXXXFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIP 469
               FVHSS V+P+ T + ++LLW  + +PLS  GSL++ K C W  HPTKTN V + IP
Sbjct: 467 LFLVFVHSSDVVPIGTLSLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIP 526

Query: 470 PQKWYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIXXXXXXXXX 529
            Q WYL+T+PA+LIGG+F FGS++VELYF+Y+SLWFNKIFYM+GFL  S +         
Sbjct: 527 FQPWYLKTVPATLIGGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLV 586

Query: 530 XXXXXYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVI 589
                Y+SL  ENW+WQWRSF+I G+GCS Y+F+HS+LFTE KLGGF   +LY+GYS +I
Sbjct: 587 TIIVTYHSLCLENWRWQWRSFIIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALI 646

Query: 590 TSLAFVVTGALGFLSSMLFVRTIYSAVKVD 619
             L  +VTGA+GF+S+M FV+ IYS++KV+
Sbjct: 647 AILCAMVTGAIGFISNMFFVKKIYSSIKVE 676

>TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {ON}
           Anc_8.254 YLR083C
          Length = 673

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/627 (50%), Positives = 416/627 (66%), Gaps = 12/627 (1%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60
           M++ H ++ GQ ++ D +  +YSYDYYY+K HFC+PE VE+   S+GSVLFGDR+YNSPF
Sbjct: 49  MYFEHTDENGQSVANDKEHFLYSYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPF 108

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120
           +L ML+ K C  LC +TI   DAKFINKLIKNG++ NWLIDGLP+AR++YD++T+S FY 
Sbjct: 109 ELYMLEPKECVPLCKTTIPADDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYS 168

Query: 121 NGFELGLVEIRQTTG---------EKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFV 171
           +GF LG V +   +G          KL+  +   ++   KR+AKN+   L+   EV YF 
Sbjct: 169 SGFPLGSVSVEHMSGGSKVTIPGVSKLVNEAVKAYK---KREAKNVPAGLITAEEVEYFA 225

Query: 172 NHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSV 231
           NHF+I IEYHDRGN+NYRVVGVTV+P+SI R     C PTG  L L+E+  N + FTYSV
Sbjct: 226 NHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSV 285

Query: 232 EFIPSETAWVTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGE 291
           +FI SETAW TRWDKYLH YDP+IQW                V  +LL+ALK D SRY +
Sbjct: 286 DFIKSETAWATRWDKYLHTYDPSIQWFSLINFTIVVVLLSTIVIHALLRALKKDISRYTD 345

Query: 292 LNLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGS 351
           LNLD +  ED+ WKL HGDVFR P   M+LSI VGSGVQLFLMI+C + + A+G ++P  
Sbjct: 346 LNLDNSFTEDSGWKLTHGDVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSY 405

Query: 352 RGTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXX 411
           RG LPT MF+LY  F F+ S+ SMGVYKFF+G  W  N                      
Sbjct: 406 RGALPTCMFVLYAIFGFVGSYTSMGVYKFFHGPYWKANMILTPLLVPGSMLLLIIFLNFF 465

Query: 412 XXFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQ 471
              VHSSG IP +T   +I LW  + VPLS  GS +A K C+W+ +PT  N + + IP Q
Sbjct: 466 LLGVHSSGTIPASTIILMICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQ 525

Query: 472 KWYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIXXXXXXXXXXX 531
            WY+++IP  L+ G+  FG+++VELYF+Y+SLW+NKIFYM+GFL  S I           
Sbjct: 526 PWYMRSIPVVLLSGIVPFGAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSI 585

Query: 532 XXXYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITS 591
              Y+SL  ENW+WQWRSF+  GLGC+FY+FL+S+ FT  K  GF + LLYMGYS +I  
Sbjct: 586 IVVYHSLCLENWRWQWRSFVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICV 645

Query: 592 LAFVVTGALGFLSSMLFVRTIYSAVKV 618
           ++ ++TGA+ F+ +M FV+ I++++KV
Sbjct: 646 VSCLITGAVSFMCNMFFVKRIFTSIKV 672

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/645 (50%), Positives = 416/645 (64%), Gaps = 30/645 (4%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60
           ++Y  K+  G+ + + +K  +YS+DYY+ KLHFCKPE + K   S+GS+LFGDR+YNSPF
Sbjct: 45  LNYQKKDDLGKKVESREK-MLYSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPF 103

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120
            + MLK +   +LC+ TI G DAKFINKLIKNG++QNWLIDGLPAAR++YD+ T + FY 
Sbjct: 104 SIKMLKPENNVKLCSITIPGSDAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYD 163

Query: 121 NGFELGLVEIRQTTGEKLLPNSADT------------------------FRDLHKRDAKN 156
            GF LG VEI++  G   +P  A T                          D +K++ + 
Sbjct: 164 VGFPLGFVEIKKNVGGLGIPMDAKTKDSGKKNSNSDKKKDSKKKDDSQKKEDSNKKEKRE 223

Query: 157 I--VQNLMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKA 214
              +  L+ ++E PY  NH+ I +E HDRG  NYRVVGVTV+P S   + D      G  
Sbjct: 224 PKRISKLVHNVEFPYLANHYVINVEVHDRGEGNYRVVGVTVDPYS---TTDSANPEKGNK 280

Query: 215 LSLSESEVNYIHFTYSVEFIPSETAWVTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAV 274
           L L E + N + F+YSV FI SET W TRWDKYLH Y+PTIQW                V
Sbjct: 281 LFLDEKKDNEVTFSYSVNFIESETVWATRWDKYLHTYNPTIQWFSLVNFSIIVLLLSALV 340

Query: 275 ARSLLQALKSDFSRYGELNLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLM 334
             SLL+ALKSDF+RY E NLD +  ED+ WKLGHGDVFR P   MLLSILVGSG QLFLM
Sbjct: 341 TYSLLKALKSDFARYEEFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLM 400

Query: 335 IICTIFLPAVGLITPGSRGTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXX 394
           II +IFL A+G+I+P SRG+LP+ MF  Y  F F  S++SM VYKFF G  W  N     
Sbjct: 401 IISSIFLAAIGIISPSSRGSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTP 460

Query: 395 XXXXXXXXXXXXXXXXXXXFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHW 454
                              FVHSSG IP+     ++++WF I +PLS  GSL+A K  +W
Sbjct: 461 LLVPGFILVSILGLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNW 520

Query: 455 DIHPTKTNTVSKVIPPQKWYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGF 514
             HPTKTN +++ IP Q WYL+TIPA LI G+F FG+++VELYF+YTSLWFNKIFYM+GF
Sbjct: 521 GEHPTKTNQIARQIPFQSWYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGF 580

Query: 515 LFGSAIXXXXXXXXXXXXXXYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLG 574
           LF S +              Y SL  ENW WQWRSF I G+GCS Y+F+HS+LFT+ KLG
Sbjct: 581 LFVSFLLLTLTTSLVTVLITYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLG 640

Query: 575 GFTNALLYMGYSFVITSLAFVVTGALGFLSSMLFVRTIYSAVKVD 619
           GFT  +LY+GY+ +++ L+ +VTGA+GF+SSM+FVR IYS V+VD
Sbjct: 641 GFTTMILYIGYTLLLSILSCIVTGAVGFISSMIFVRKIYSNVRVD 685

>Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {ON}
           YLR083C (EMP70) - endosomal membrane protein [contig
           176] FULL
          Length = 683

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/638 (50%), Positives = 416/638 (65%), Gaps = 20/638 (3%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60
           M++ H + +G+D + D +  +YSYDYYY+K HFCKPE +EK   S+GS++FGDR+YNSPF
Sbjct: 47  MYFKHVDDDGKD-TGDRESFLYSYDYYYDKFHFCKPEKLEKQRESLGSIIFGDRIYNSPF 105

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120
           +L MLK+K CE LC+S I   DAKFINKLI NG++QNWL+DGLPAAR+  D RTKS FY 
Sbjct: 106 KLEMLKDKECEALCSSKIPANDAKFINKLIANGFFQNWLVDGLPAARKTTDERTKSEFYT 165

Query: 121 NGFELGLVEI------RQTTGEK-------LLPNSADTFRDLHKRDA----KNIV--QNL 161
            GFELG +++          GE+         P + D + D   +      K IV  + L
Sbjct: 166 PGFELGFIDVGGAKLRMDGQGEEDAHPKGATKPVAQDDYLDRPSKSKNEKRKKIVDPKEL 225

Query: 162 MQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESE 221
           ++ +E  YF NHF+I ++YHDRGN +YRVVGV VNP SI R     C  TG+ L LSE E
Sbjct: 226 VKQLETAYFANHFNIEVQYHDRGNGDYRVVGVIVNPQSIKRDSSNSCAATGELLKLSEEE 285

Query: 222 VNYIHFTYSVEFIPSETAWVTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQA 281
              +HF+YSV+F PS+T W TRWDKYLHVYDP IQW                V  SL + 
Sbjct: 286 ETTVHFSYSVKFTPSDTVWATRWDKYLHVYDPKIQWYSLINFSIVVIVLSSVVIHSLYRT 345

Query: 282 LKSDFSRYGELNLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFL 341
           L+ D SRY +LNLD+  +E+  WKL HGDVFR P   +LLS+LVGSG QLF+M  CTI  
Sbjct: 346 LRDDLSRYNQLNLDDDFQEETGWKLVHGDVFRTPTKSLLLSVLVGSGTQLFVMAACTIAF 405

Query: 342 PAVGLITPGSRGTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXX 401
             +GL++P SRG+L TVMF+LY  F  + S+ SM  YKFF G+ W +N            
Sbjct: 406 ALLGLLSPSSRGSLTTVMFILYALFGSLGSYTSMATYKFFGGEYWKVNMILTPILVPGLL 465

Query: 402 XXXXXXXXXXXXFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKT 461
                        V S+G IP  T  +++LLWF   +PLS+ GSL+A+K C W+ HPTKT
Sbjct: 466 FCVVLGLNFFLIMVESAGAIPFGTMCAIVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKT 525

Query: 462 NTVSKVIPPQKWYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIX 521
             + + IP Q WYL+T PA+LI G+F FGS++VELYFVY+SLWFNKIFYM+GFLF S + 
Sbjct: 526 RQIPRQIPFQPWYLKTAPAALIAGIFPFGSIAVELYFVYSSLWFNKIFYMFGFLFVSFLL 585

Query: 522 XXXXXXXXXXXXXYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALL 581
                        YYSL  ENW+WQWR F I G GC+ YVFLH++LFT+ KLGGF   +L
Sbjct: 586 LTLTTALVTVLLTYYSLCLENWKWQWRGFWIGGAGCALYVFLHAILFTKFKLGGFVTIVL 645

Query: 582 YMGYSFVITSLAFVVTGALGFLSSMLFVRTIYSAVKVD 619
           Y+GYS VI+ L  ++TGA+GF+SS+ FVR IYS++KVD
Sbjct: 646 YVGYSLVISLLTCLITGAVGFMSSLWFVRRIYSSIKVD 683

>KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 687

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/643 (50%), Positives = 411/643 (63%), Gaps = 25/643 (3%)

Query: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60
           M+Y H +++G D+  D +  +YSYDYYY K HFC+PE +EK   S+GS++FGDR+YNSPF
Sbjct: 46  MYYQHADEDGNDLG-DKESLLYSYDYYYPKFHFCRPEKLEKQRESLGSIIFGDRIYNSPF 104

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120
           Q+ MLKNK C  LC+ +I   DAKFINKLI NG++QNWL+DGLPAAR+  D RTKS FY 
Sbjct: 105 QIEMLKNKECASLCSESIPADDAKFINKLITNGFFQNWLVDGLPAARKTTDVRTKSEFYT 164

Query: 121 NGFELGLV-----EIR-------------------QTTGEKLLPNSADTFRDLHKRDAKN 156
            GFELG V     E+R                   +   E    ++    R L KR   +
Sbjct: 165 PGFELGYVGIGGSELRMNGQGGSQDGDDSGSHGSTKEVSESDYLDAPPAKRSLAKRKQVS 224

Query: 157 IVQNLMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALS 216
             + L++ +E PYF NHF+I ++YHDRGN NYRVVGV VNP SI R     C  TG+ L 
Sbjct: 225 NTKELVKQLETPYFANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLK 284

Query: 217 LSESEVNYIHFTYSVEFIPSETAWVTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVAR 276
           LSE+E   +HF+YSV+F PSET W TRWDKYLHVYDP IQW                +  
Sbjct: 285 LSETEATEVHFSYSVKFTPSETVWATRWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIH 344

Query: 277 SLLQALKSDFSRYGELNLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMII 336
            L   L  D SRY ++NLD+  +E+  WKL HGDVFR P+  ++LS+LVGSG QLFLM  
Sbjct: 345 RLYVTLTDDLSRYNQINLDDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAA 404

Query: 337 CTIFLPAVGLITPGSRGTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXX 396
           CTI    +GL++P SRG+L TVMF+LY  F    S+ SM  YKFF G  W +N       
Sbjct: 405 CTIGFALLGLLSPSSRGSLTTVMFILYALFGSFGSYTSMATYKFFGGPYWKVNMLLTPIL 464

Query: 397 XXXXXXXXXXXXXXXXXFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDI 456
                             V S+G IP  T   ++LLWF   +PLS+ GSL+ARK C WD 
Sbjct: 465 VPGLLFCVMLALNFFLVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDE 524

Query: 457 HPTKTNTVSKVIPPQKWYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLF 516
           HPTKT  + + IP Q WYL+T+PASLI G+F FGS++VELYF+Y+SLWFNKIFYM+GFLF
Sbjct: 525 HPTKTKQIPRQIPFQPWYLKTVPASLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLF 584

Query: 517 GSAIXXXXXXXXXXXXXXYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGF 576
            S +              YYSL  ENW+WQWR F I G GC+ Y+F+H++LFT+ +LGGF
Sbjct: 585 VSFLLLTLTTSLITVLLTYYSLCLENWKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGF 644

Query: 577 TNALLYMGYSFVITSLAFVVTGALGFLSSMLFVRTIYSAVKVD 619
           T  +LY+GYS V++ L+ ++TG +GFLSS+ FVR IYS+VKVD
Sbjct: 645 TTIVLYVGYSLVMSLLSCLITGTVGFLSSLWFVRRIYSSVKVD 687

>TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {ON}
           Anc_8.254 YLR083C
          Length = 656

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/620 (47%), Positives = 388/620 (62%), Gaps = 11/620 (1%)

Query: 2   HYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPFQ 61
           H+ HK+++G +I +D +  +YSYDYY  KLHFCKPE+V +   S+GSVLFGDRLYNSPF+
Sbjct: 46  HFQHKDKDGNNIKSDKEHYLYSYDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPFK 105

Query: 62  LNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYGN 121
           LNML++K+C  LC S I G DA FINKLIKNG+  NWL+DGLPA   + + R  S    N
Sbjct: 106 LNMLEDKSCVSLCKSVIPGEDAAFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITN 165

Query: 122 GFELGLVEIRQTT--GEKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIE 179
           GF LG VEI Q    G    P   +T    H     N+V NL    E+P+  NH+DI I+
Sbjct: 166 GFPLGSVEIMQGVHNGAMATPRE-ETGISAH---GSNVVVNL----ELPHLNNHYDITIQ 217

Query: 180 YHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSETA 239
           YH+     YR+VGV V P SI ++ +  C+ TG+ +SLSE + N + +TYSV ++     
Sbjct: 218 YHEPEAGKYRIVGVEVEPKSIKQTSN-SCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHT 276

Query: 240 WVTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGELNLDETIK 299
           W TRWD Y   YD T+QW                V   LL+ALKSDF+RY ELNLD+   
Sbjct: 277 WATRWDNYRFSYDTTVQWFSLISCVIVVIGLSSVVLHMLLRALKSDFARYNELNLDDEFH 336

Query: 300 EDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPTVM 359
           E++ WKL HGDVFR P+  +LLS+LVGSGVQL L+ +  I + A+     GSR  LPT+ 
Sbjct: 337 EESGWKLSHGDVFRMPNKSLLLSVLVGSGVQLLLLAVGGIVIAAIAFNNAGSREVLPTIF 396

Query: 360 FLLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXXXFVHSSG 419
           F+LY  F F+ S+ SMGVY+FF G    +N                          HSS 
Sbjct: 397 FVLYALFGFVGSYASMGVYRFFKGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSD 456

Query: 420 VIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQTIP 479
            IP +   +++LLW  I VPLS+ GSL A KTC WD HPTKTN +++ IP Q WYL+T+P
Sbjct: 457 AIPFSALFAVVLLWLIISVPLSLAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLP 516

Query: 480 ASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIXXXXXXXXXXXXXXYYSLS 539
           A+L+ G+F F S++VELYF+Y SLWF++ FYM+GF   S                Y+SL 
Sbjct: 517 AALVAGIFPFASIAVELYFIYNSLWFHQFFYMFGFSMVSLFLLVLTTALVTVMITYHSLC 576

Query: 540 AENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVTGA 599
            ENWQWQWRSF++ GLG + Y+F+HS+ FTE KL GFT  +LY+GYS +I+ L  + TGA
Sbjct: 577 LENWQWQWRSFIVGGLGSAVYIFIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGA 636

Query: 600 LGFLSSMLFVRTIYSAVKVD 619
           +GF SSM  VR I+S+VKVD
Sbjct: 637 VGFFSSMFLVRKIFSSVKVD 656

>AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR083C (EMP70) and
           YDR107C
          Length = 653

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/614 (47%), Positives = 393/614 (64%), Gaps = 9/614 (1%)

Query: 7   NQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPFQLNMLK 66
           ++ G D   D +R +Y+YDYYY +LH C+P+ +EK   S+GS++FGDRL+NSPF+L ML+
Sbjct: 48  DRAGTDGQRDKERYLYAYDYYYPRLHMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLE 107

Query: 67  NKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYGNGFELG 126
            K+C  LC  T+   DAKFIN+LI++G++ NWL+DGLPA RE++D RT + FYG GFELG
Sbjct: 108 EKSCVALCEKTVPAEDAKFINQLIRSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG 167

Query: 127 LVEIRQTTGE-KLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEYHDRGN 185
            V IR T    +  P   +          + ++Q     + VPYF+NHF+I ++YH R  
Sbjct: 168 RV-IRGTEDRNQEEPGEIEL-------QTRRVLQPGESVVAVPYFINHFEITVDYHKRAE 219

Query: 186 DNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSETAWVTRWD 245
           D  RVVGV+V P S+       C  +G  L LSE+    + FTYSV F  S+ +W TRW 
Sbjct: 220 DELRVVGVSVLPRSLQNPVGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWG 279

Query: 246 KYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGELNLDETIKEDASWK 305
           KYLHVYDP +QW                +  SL +ALK+D  RY + NLD   +ED  WK
Sbjct: 280 KYLHVYDPKVQWYSLINFSLVVLLLSSIMVHSLFRALKTDLDRYNDFNLDNEFQEDYGWK 339

Query: 306 LGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPTVMFLLYLG 365
           L H DVFR+P   +LLS+ VGSG QLFLM  CT+F+  +G ++P SRG+L T+MF+LY  
Sbjct: 340 LLHSDVFRSPSKTLLLSVFVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAI 399

Query: 366 FSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXXXFVHSSGVIPLAT 425
           F    S++SM  YK F G+KW +N                         V SSG +P  T
Sbjct: 400 FGGFGSYLSMSTYKMFGGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGT 459

Query: 426 FTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQTIPASLIGG 485
             ++++LWF + +P+SI GSL ARK   WD HPTKT+ ++K IPPQ WYL+T PA+ I G
Sbjct: 460 MLAIVVLWFVLSIPISIMGSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAG 519

Query: 486 LFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAIXXXXXXXXXXXXXXYYSLSAENWQW 545
           LF FG+++VELYF+YTS+WFN +FYM+GFLF + +              YYSL  ENW W
Sbjct: 520 LFPFGAIAVELYFIYTSIWFNTMFYMFGFLFFTFLLLTLTTALVTILLTYYSLCMENWSW 579

Query: 546 QWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVTGALGFLSS 605
           QWRSF+I G+GCS YVF++S+LFT+ +LGGF   +LY+GYS +I+ L  +VTG +GF+SS
Sbjct: 580 QWRSFIIGGIGCSTYVFINSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSS 639

Query: 606 MLFVRTIYSAVKVD 619
           + FVR IYS++KVD
Sbjct: 640 LWFVRKIYSSIKVD 653

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score =  469 bits (1206), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 244/599 (40%), Positives = 340/599 (56%), Gaps = 38/599 (6%)

Query: 21  IYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPFQLNMLKNKTCERLCNSTIIG 80
           +++ DYY + +  CKP  +++   S+GSV+FGDRLYNSPF+++MLKN  C +LC++TI  
Sbjct: 45  LWNIDYYSDSIGLCKPNTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDTTI-- 102

Query: 81  RDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYGNGFELGLVEIRQTTGEKLLP 140
            D    N      Y  NWL+DGLP      D  + +N Y N  EL             + 
Sbjct: 103 -DTALWNTFFGYRYSYNWLVDGLPVLG--IDGTSDANGYHNNSEL------------FMG 147

Query: 141 NSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSI 200
             AD                     E  Y  NHFDI I Y+DRG   YRVV     P+S+
Sbjct: 148 YQAD---------------------EQKYIYNHFDIYIHYNDRGKGEYRVVFAEAKPISL 186

Query: 201 DRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSETAWVTRWDKYLHVYDPTIQWXXX 260
            R+    C    K + +       I FTYSV F  S+ +W TRWD+YLHVYD  IQ    
Sbjct: 187 PRTGSELCSKDAKPVPIGSGNHENITFTYSVIFKKSDISWSTRWDQYLHVYDFDIQLAEL 246

Query: 261 XXXXXXXXXXXCAVARSLLQALKSDFSRYGELNLDETIKEDASWKLGHGDVFRAPDHPML 320
                        +  SL + LK D + Y E NLD+  ++D  WK+ HG+VFR+P   +L
Sbjct: 247 ISFSLVVLLLSSVLVHSLFRVLKRDIAAYSEFNLDDEFQQDYCWKIIHGEVFRSPSKALL 306

Query: 321 LSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPTVMFLLYLGFSFISSFVSMGVYKF 380
           LS+ VGSG QLF M +CT+ L + G ++P +RG+L TVMF+LY  F  + S+ SM +YKF
Sbjct: 307 LSVFVGSGSQLFFMALCTVLLGSCGFLSPSARGSLGTVMFVLYALFGGVGSYTSMSIYKF 366

Query: 381 FNGQKWHINCXXXXXXXXXXXXXXXXXXXXXXXFVHSSGVIPLATFTSLILLWFFIGVPL 440
           F GQ W +N                        +  SSG +P  T  ++I+LWF + VP+
Sbjct: 367 FGGQNWKLNLILTPLLIPVFLFVTTVLLNFFLIYAKSSGAMPFGTMVTIIILWFILSVPV 426

Query: 441 SITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQTIPASLIGGLFSFGSLSVELYFVY 500
           SI GSL++ K   WD HP KTN +++ +P Q WY++T  A+ + G+F FG+++VELY++Y
Sbjct: 427 SIIGSLLSWKLNRWDEHPAKTNQIARQVPSQPWYIKTWVATFLAGMFPFGAMAVELYYIY 486

Query: 501 TSLWFNKIFYMYGFLFGSAIXXXXXXXXXXXXXXYYSLSAENWQWQWRSFLIAGLGCSFY 560
            S+W   IF+MYGFLF + I              YYSL  ENW+WQWRSF+I G+GCS Y
Sbjct: 487 ASIWGEIIFFMYGFLFVAFILLTLTTSLVTILLTYYSLCMENWKWQWRSFIIGGVGCSVY 546

Query: 561 VFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVTGALGFLSSMLFVRTIYSAVKVD 619
           VFLHSL F + K  GF + +LY+GYS +++ +  +VTG++GFL+++ FVR IYS +KVD
Sbjct: 547 VFLHSLFFIKFKFPGFVSMVLYLGYSAMVSIVCCLVTGSIGFLANLWFVRKIYSNIKVD 605

>SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 707

 Score =  139 bits (351), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 166/701 (23%), Positives = 272/701 (38%), Gaps = 143/701 (20%)

Query: 4   HHKNQEGQDISTDDKRTIYSYDYYYEKLHF-CKPEHVEKA-GVSIGSVLFGDRLYNSPFQ 61
           + +N   + I    +  +  + Y Y +L F C P +V+K   +S+  ++ GDR + S + 
Sbjct: 61  YEENDPVEIIVNKIESDLTQFPYAYYELPFTCPPTNVKKPLHLSLNEIIRGDRKWQSDYL 120

Query: 62  LNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDG-LPAAREVYDTRTKSNFYG 120
           L+  K++ C RLC+        +  ++LIK GY   WLID  LPAA     T+    +Y 
Sbjct: 121 LHFKKDEHCLRLCDRKTSPDALRKAHELIKQGYVVQWLIDDELPAATTFISTKDHKKYYA 180

Query: 121 NGFELGLVEIRQTTGEKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEY 180
           +GF LG ++                                 +D    Y  NH  + I Y
Sbjct: 181 SGFPLGFMD---------------------------------KDTGKTYLNNHVMLVIRY 207

Query: 181 HDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVN-------YIHFTYSV-- 231
           H    + + +VG+ V P S+    D  C   G + +    EVN       YI FTYS+  
Sbjct: 208 HTVDINKFTIVGLEVYPKSVS---DYHCP--GASKNFDHYEVNTEETETTYIPFTYSIYW 262

Query: 232 --EFIPSETAWVTRWDKYLHVYDPT------IQWXXXXXXXXXXXXXXCAVARSLLQALK 283
             EF      W  RW+ +++  + +        W                VA  L +++ 
Sbjct: 263 REEF---NVDWTNRWNFFINSGEISQEKSSQFHWISLANSVVIVTLMTLVVALILAKSVS 319

Query: 284 SDFSRYGELNLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPA 343
           +D     E     T +  + W + H  +    +H   L++    GVQ    I+ ++ +  
Sbjct: 320 TD-----ETVSTSTSQVASQWVVQHSYLL---NH---LNVFTAMGVQFLFTILGSLIISC 368

Query: 344 VGLITPGSRGTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQ-KWHINCXXXXXXXXXXXX 402
                   R ++ T+  + ++  ++ SSFV   +    N   K  I C            
Sbjct: 369 SMNKLHNIRNSVLTMALMCFISGAYTSSFVGALLSANHNTTIKISIACGSALPGFTLCVV 428

Query: 403 XXXXXXXXXXXFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMA---RKTC------- 452
                        H+   +P  T   LI ++F + +PLSI G + A   R+ C       
Sbjct: 429 LILNCIIWAKDSTHA---LPFGTIVLLITVYFIVCIPLSILGGVSATYTRRKCLSLDPRS 485

Query: 453 ----------HWDIHPTKTNTV--SKVIPPQKWYL---QTIPASLIGGLFSFGSLSVELY 497
                     H+D  P   N V   ++    K  L   Q +  ++I G+  F  + VEL 
Sbjct: 486 IINRFFLLNIHYDDQPVVENKVHLPRISGNSKLPLMLRQPVLLTVISGIVPFIVIYVELL 545

Query: 498 FVYTSLWFNK--IFYMYGFLFGSAIXXXXXXXXXXXXXXYYSL----------------- 538
           FVY SLW  K   +Y+YGFL  + +              Y +L                 
Sbjct: 546 FVYKSLWLEKTTFYYLYGFLLANIVLLCVVVCEISIIGCYLTLIHVSPDEFIPIATPEQA 605

Query: 539 -----------SAENW---------QWQWRSFLIAGLGCSFYVFLHSLLF--TEVKLGGF 576
                       A N+         QW+W+SF I G   ++Y+  +SL +  T +K+  F
Sbjct: 606 MHSPMLKQVRVQAMNFVCAIGLAMTQWRWKSFQIGG-SVAWYLEAYSLYYFLTVLKIRDF 664

Query: 577 TNALLYMGYSFVITSLAFVVTGALGFLSSMLFVRTIYSAVK 617
           ++ LL+  YS +   L +   GALG+LS   FV  I++  K
Sbjct: 665 SSILLFFCYSALFNFLCWCSFGALGYLSCCWFVNRIHTNSK 705

>ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 658

 Score =  125 bits (315), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 143/631 (22%), Positives = 250/631 (39%), Gaps = 93/631 (14%)

Query: 27  YYEKLHFCKPEHVEKA-GVSIGSVLFGDRLYNSPFQLNMLKNKTCERLCNSTIIGRDAKF 85
           YY+    C P   +K   +S+  ++ GDR + S ++L + ++  CE LC         + 
Sbjct: 70  YYDLPFTCPPTPEKKPLHLSLNEIIKGDRKWESDYKLVVGQDNPCEILCARKTTREGLQT 129

Query: 86  INKLIKNGYYQNWLIDG-LPAAREVYDTRTKSNFYGNGFELGLVEIRQTTGEKLLPNSAD 144
              LIK+GY   W+ID  LPAA     T     +Y  GF LG V+          P S+ 
Sbjct: 130 AKDLIKSGYMVQWMIDDDLPAATTYISTTDNLKYYAPGFPLGSVD----------PRSSR 179

Query: 145 TFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSP 204
            F                       F NH  + I Y+   +D   +VG    P S+    
Sbjct: 180 VF-----------------------FNNHVMLVIRYNLVDSDKVTIVGFEAYPKSVSDYH 216

Query: 205 DGGCKPTGKALSLSE---SEVNYIHFTYSVEFIP-SETAWVTRWDKYLHVYD------PT 254
             G     K   +++    E+ YI  TYSV +   +E  W  RW  Y++          T
Sbjct: 217 CPGASKDFKPFEITDPPLEEIVYIPVTYSVYWREDAEIDWSDRWSLYINRAQLADSSSST 276

Query: 255 IQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGELNLDETIKEDASWKLGHGDVFRA 314
             W                V  +L+   ++   +     L+    ED+S      D+F  
Sbjct: 277 FHWMALANSVGIVLFVTFIVIVNLIMIFRNPNEQ-----LESKENEDSS------DIFNV 325

Query: 315 PDHPML---------LSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPTVMFLLYLG 365
            ++ +          L + V  G+Q+  MI+  + +          + ++ T+  L ++ 
Sbjct: 326 ANNWLRARQGFQLNRLIVCVSMGIQVMFMILGPLAISLSLTRLHNIKNSVLTIAALCFVA 385

Query: 366 FSFISSFV--------SMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXXXFVHS 417
            +F++SFV        ++  Y F+N   + + C                          S
Sbjct: 386 GAFMASFVGTWLKMDQNISAYTFYN-PVFAVLCGSALPGSIMVLTLSLNCIIWIW---DS 441

Query: 418 SGVIPLATFTSLILLWFFIGVPLSITGSLMA---RKTCHWDIHPTKTNTVSKVIPPQKWY 474
           +  +P  T    +  +F + + +S+ G  +A    ++   D  P  T +  KV+   +  
Sbjct: 442 TKALPFGTMVVFVSWYFVVCIVVSLLGGAVAAQMHRSVRHDAPPATTASDRKVLRRSRAI 501

Query: 475 ---LQTIPASLIGGLFSFGSLSVELYFVYTSLWFNK--IFYMYGFLFGSAIXXXXXXXXX 529
              L    A LI G   F  + VEL ++Y S+W  K  ++Y+Y FLF + +         
Sbjct: 502 SGKLVVFLAGLISGFLPFVIIYVELEYLYKSVWLEKTTLYYLYSFLFANVLLLCIVVCEI 561

Query: 530 XXXXXYYSLS-----AENWQWQWRSFLIAGLGCSFYVFLHSL--LFTEVKLGGFTNALLY 582
                   +        +  W+WR F+I+  GCS+Y+ ++SL  +F  + + G +   + 
Sbjct: 562 SLLGCLVLMKLNHKFINDQNWRWRCFVIST-GCSWYMEIYSLYYIFFIIHMTGDSAVFIS 620

Query: 583 MGYSFVITSLAFVVTGALGFLSSMLFVRTIY 613
           + YSF+   L  + TG+LG+L+S  FV+ I+
Sbjct: 621 VCYSFIFNVLCGLATGSLGYLTSSWFVKKIH 651

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score =  123 bits (309), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 150/665 (22%), Positives = 267/665 (40%), Gaps = 91/665 (13%)

Query: 2   HYHHKNQEGQDISTDDKRTIYSYDYYYEKLHF-CKPE-HVEKAGVSIGSVLFGDRLYNSP 59
           +++ +  E + I    +  +    Y Y  L F C P  H +   +S+  ++ GDR + S 
Sbjct: 44  NFYFQGDEVELIVNKVESDLTQLPYAYYDLPFTCPPTMHKKPLHLSLNEIIRGDRKWQSD 103

Query: 60  FQLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLID-GLPAAREVYDTRTKSNF 118
           + L   ++ TC  LC         K   KL+++GY   WLID  LPAA     T  +  +
Sbjct: 104 YILKFGQDDTCHILCTRKTTKEGLKNAKKLVEDGYVVQWLIDEELPAATTFISTIDQKKY 163

Query: 119 YGNGFELGLVEIRQTTGEKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRI 178
           Y +GF LG V+          P++                          Y   H  + I
Sbjct: 164 YASGFPLGFVD----------PDTGKV-----------------------YLNTHVMLVI 190

Query: 179 EYHDRGNDNYRVVGVTVNPVSI-DRSPDGGCK---PTGKALSLSESEVNYIHFTYSV--- 231
            Y+    + + +VG  V P S+ D    G  K   P    +  ++ ++ +I FTYSV   
Sbjct: 191 RYNTVDVNKHTIVGFEVYPKSVSDFHCPGASKNYEPYEIVIPENDDDLTFIPFTYSVYWR 250

Query: 232 -EFIPSETAWVTRWDKYLH----VYDPTIQ--WXXXXXXXXXXXXXXCAVARSLLQALKS 284
            E++     W  RWD YL+      + T Q  W                V+  LL++ KS
Sbjct: 251 EEYL---VDWDHRWDLYLNSGELSENKTTQFHWISLANSAGIVFLMSFVVSVILLRSFKS 307

Query: 285 DFSRYGELNLDETIKEDASWKLGHGDVF--RAPDHPMLLSILVGSGVQLFLMIICTIFLP 342
                 ++N  E  +    +++    +   R P   +L+ + V  GVQ    ++ ++ + 
Sbjct: 308 SRDISTDINKSEEHRNGLVYEVARNWIINERTPLANLLI-LFVSMGVQFLFTVLGSLTIS 366

Query: 343 AVGLITPGSRGTLPTVMFLLYLGFSFISSFVSMGVYKFFN---------GQKWHINCXXX 393
                      ++ T+  L ++  +F+SS++   + +  N          + +H+     
Sbjct: 367 CSLNKLHDIGDSVLTMAVLCFVLGAFMSSYIGSVLLRLKNKATMKKQPIKKGFHLFFAIL 426

Query: 394 XXXXXXXXXXXXXXXXXXXXFVH-SSGVIPLATFTSLILLWFFIGVPLSITGSLMARKT- 451
                               + H S+  +P  T    I ++F + +PLSI G  MA  + 
Sbjct: 427 CGSFLPGIVMIVTLLLNSIVWAHDSTHALPFKTVVMFITVYFIVCIPLSILGGYMANSSK 486

Query: 452 -----CHWDIHPTKTNT---VSKVIPPQKWY-----LQTIPAS---LIGGLFSFGSLSVE 495
                     H ++       +K+ P +  +     L++I  +   L+ G+F F  + VE
Sbjct: 487 TKGSLTDPKFHTSRPELELFANKLKPKKHIFLFGARLKSIKIALPILLSGIFPFVIIYVE 546

Query: 496 LYFVYTSLWFNK--IFYMYGFLFGSAIXXXXXXXXXXXXXXYYSL---SAENWQWQWRSF 550
           L +VY S+W  K   +Y YGFLF + +              Y  L      N  W+W SF
Sbjct: 547 LQYVYKSVWLEKTAFYYFYGFLFANILLLCIVVGEIAIIGTYTMLHMADRNNTDWRWISF 606

Query: 551 LIAGLGCSFYVFLHSL--LFTEVKLGGFTNALLYMGYSFVITSLAFVVTGALGFLSSMLF 608
            + G  C++Y+ L+SL  +F  + + GF++  + + Y  +  +L     G++  L+S  F
Sbjct: 607 FM-GSSCAWYMELYSLYYVFFILNIRGFSSIFISVCYGALFNTLCGCAMGSIASLTSHFF 665

Query: 609 VRTIY 613
           V  +Y
Sbjct: 666 VEKLY 670

>Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  119 bits (298), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 152/656 (23%), Positives = 252/656 (38%), Gaps = 101/656 (15%)

Query: 27  YYEKLHFCKPE-HVEKAGVSIGSVLFGDRLYNSPFQLNMLKNKTCERLCNSTIIGRDAKF 85
           YY+    C P  H +   +S+  ++ GDR + S + L   ++  C+ LC         + 
Sbjct: 81  YYDLPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYILAFGEDNACQTLCARKTTKEGMQS 140

Query: 86  INKLIKNGYYQNWLIDG-LPAAREVYDTRTKSNFYGNGFELGLVEIRQTTGEKLLPNSAD 144
           ++KL++ GY   WLID  LPAA     T     +Y +GF LG V+          P++  
Sbjct: 141 LDKLVREGYVVQWLIDDKLPAATTFISTTDHKKYYASGFPLGFVD----------PDTGK 190

Query: 145 TFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSI-DRS 203
           T+  LH                     NH  + I +H   ND   +VG  V P S+ D  
Sbjct: 191 TY--LH---------------------NHVMLVIRFHSGDNDQNTIVGFEVYPRSVSDYH 227

Query: 204 PDGGCKPTGK---ALSLSESEVNYIHFTYSVEFIPS-ETAWVTRWDKYLHVYD------P 253
             G  K   +    +   E+E+ Y+ FTYSV +    E  W  RWD +L+  +       
Sbjct: 228 CPGASKNYEQYEIVVPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSNEKSA 287

Query: 254 TIQWXXXXXXXXXXXXXXCAVARSLLQAL-----KSDFSRY--------GELNLDETIKE 300
              W                 A   +Q +      +D ++Y         E NLD+    
Sbjct: 288 QFHWMSFANSMGIVLSISFITAVIYIQVMHRDKKNTDSTKYLINIEGAEVEDNLDDDKYG 347

Query: 301 DASWKLGHGDVFRAPDHPM----LLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLP 356
             S  +   D  +     M    +L +LV  GVQ    +I ++ +          R ++ 
Sbjct: 348 KNSVYMVTKDWIQNGRPNMFGLKVLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVI 407

Query: 357 TVMFLLYLGFSFISSFVSMGV----------YKFFNGQKWHINCXXXXXXXXXXXXXXXX 406
           T+  L ++  +F++SFV   +            + +  K   NC                
Sbjct: 408 TMAILCFVLGAFMASFVGTRLSIVTKRRSIEINYLDDSKNFNNCNKFSPVFAIICGSSLP 467

Query: 407 XXXXXXXFV--------HSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTC---HWD 455
                  F+         S+  +P  T    I ++F + +PLS+ G  +A       HW 
Sbjct: 468 GLVMVSTFLLNSIVWAHDSTNALPFRTIVFFISVYFIVCIPLSLFGGTVANNIPLPRHWL 527

Query: 456 IHPTKTNTV---SKVIPPQ---KWYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNK-- 507
              TK  T    S++  P+   K+         + GLF F  + VEL +VY S+W  K  
Sbjct: 528 SGITKDETCGNSSRLFVPRSRTKFNPLVYCGIYLCGLFPFLVIYVELQYVYKSVWLEKTT 587

Query: 508 IFYMYGFLFGSAIXXXXXXXXXXXXXXY------YSLSAENWQWQWRSFLIAGLGCSFYV 561
            +Y YGFL  + I              Y      +        W+W+ F + G     Y+
Sbjct: 588 FYYFYGFLLLNIILLCVLTMEISIIGSYSLMRFCFEDKDVRNNWRWKCFEM-GFSGGVYM 646

Query: 562 FLHSL--LFTEVKLGGFTNALLYMGYSFVITSLAFVVTGALGFLSSMLFVRTIYSA 615
            L+SL  +F  + + GF++ L+ + YS +   +  +  G L +L++  F+  IY +
Sbjct: 647 ELYSLYYIFAVLNIHGFSSTLISICYSLLFNIMCGLGLGGLSYLTASWFINKIYHS 702

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa]
           {ON} Anc_7.411 YER113C
          Length = 670

 Score =  118 bits (296), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 152/664 (22%), Positives = 258/664 (38%), Gaps = 96/664 (14%)

Query: 2   HYHHKNQEGQDISTDDKRTIYSYDYYYEKLHF-CKPE-HVEKAGVSIGSVLFGDRLYNSP 59
           +Y+ K    + I    +  +    Y Y  L F C P  H +   +S+  ++ GDR + S 
Sbjct: 45  NYYSKGDPVELIVNKVESDLTQLPYAYYDLPFTCPPTMHKKPLHLSLNEIIRGDRKWQSD 104

Query: 60  FQLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDG-LPAAREVYDTRTKSNF 118
           + LN  ++  C  LC         K   +L+KNGY   WLID  LPA      T     +
Sbjct: 105 YILNFGEDDQCHILCTRKTTKEGMKEAQELVKNGYVVQWLIDDELPAVTTFISTTDHKKY 164

Query: 119 YGNGFELGLVEIRQTTGEKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRI 178
           Y +GF LG V+          P +  T                       Y   H  I I
Sbjct: 165 YASGFPLGFVD----------PETGKT-----------------------YLNTHVMIVI 191

Query: 179 EYHDRGNDNYRVVGVTVNPVS-IDRSPDGGCKPTGK---ALSLSESEVNYIHFTYSV--- 231
            Y+    + + + G  + P S +D    G  K   +    +  ++ ++ +I FTYSV   
Sbjct: 192 RYNTVDTNKHTIFGFELYPKSTVDFHCPGASKDYEQYELVVPENDDDLTFIPFTYSVYWR 251

Query: 232 -EFIPSETAWVTRWDKYLHVYD------PTIQWXXXXXXXXXXXXXXCAVARSLLQALKS 284
            E++     W  RWD YL+  +          W                 A  L +  K 
Sbjct: 252 EEYL---VDWEHRWDLYLNAGELSNDKSKQFHWISLANSFGIVFLISSITAVILYRTFKI 308

Query: 285 DFSRYGELNLDETIKED-----ASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTI 339
               + +++ +E  K         W L      + P   +L+ I V  GVQ    ++ ++
Sbjct: 309 SRRSFSDISKEEDDKGSIYVVARKWLLNE----QTPLANVLI-IFVSMGVQFLFTVLGSL 363

Query: 340 FLPAVGLITPGSRGTLPTVMFLLYLGFSFISSFVSMGVYKF---------FNGQKWHINC 390
            +          R ++ T+  L ++  +F++SF    + K              +++   
Sbjct: 364 IISCSLKKLHNVRDSVLTMGLLCFVTGAFMASFTGAHLLKSREEMCSESQMKPTRYYPVF 423

Query: 391 XXXXXXXXXXXXXXXXXXXXXXXFVH-SSGVIPLATFTSLILLWFFIGVPLSITGSLMAR 449
                                  + H S+  +P  T   LI ++F + +PLS+ G  +A 
Sbjct: 424 ALLCGSLLPSFVMLVALLLNSIVWAHDSTHALPFGTVLFLISVYFVVCIPLSLLGGYIAV 483

Query: 450 KTCHWD-------------IHPTKTNTVSKVIPPQKWYLQTIPASLIGGLFSFGSLSVEL 496
           K+ +               I   KT T+S  +   +  L ++ A L GGLF F  + VEL
Sbjct: 484 KSTNSKPSFSFSIGNYSDRIFVYKTITMSPSVLINR-PLSSL-AILAGGLFPFIIIYVEL 541

Query: 497 YFVYTSLWFNK--IFYMYGFLFGSAIXXXXXXXXXXXXXXYYSLSAENW---QWQWRSFL 551
            +VY SLW  K   +Y YGFL  + +              +  L++ +     W+W SF 
Sbjct: 542 QYVYKSLWLEKTTFYYFYGFLLANILLLCIVICEISIIGTFILLNSADKNSNNWRWTSFQ 601

Query: 552 IAGLGCSFYVFLHSL--LFTEVKLGGFTNALLYMGYSFVITSLAFVVTGALGFLSSMLFV 609
           I G  C+FY+ ++SL  +F  + + GF++  + + Y  +   +    TG++  L+S  FV
Sbjct: 602 I-GASCAFYMEVYSLYYVFFILNIRGFSSIFISVCYGTLFNIMCGCATGSIACLTSHWFV 660

Query: 610 RTIY 613
           + IY
Sbjct: 661 QKIY 664

>Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  118 bits (296), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 155/663 (23%), Positives = 257/663 (38%), Gaps = 108/663 (16%)

Query: 27  YYEKLHFCKPE-HVEKAGVSIGSVLFGDRLYNSPFQLNMLKNKTCERLCNSTIIGRDAKF 85
           YY+    C P  H     +S+  ++ GDR + S ++L   ++  CE LC         + 
Sbjct: 81  YYDLPFTCPPTMHKTPLHLSLNEIIRGDRKWESDYKLTFGEDNPCEVLCARKTTKEGMQT 140

Query: 86  INKLIKNGYYQNWLIDG-LPAAREVYDTRTKSNFYGNGFELGLVEIRQTTGEKLLPNSAD 144
           ++KLI+ GY   WLID  LPAA     T     +Y +GF LG ++          P++  
Sbjct: 141 LDKLIREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFMD----------PDTGK 190

Query: 145 TFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSP 204
           T+  LH                     NH  + I +H   N    +VG  V P S+    
Sbjct: 191 TY--LH---------------------NHVMLVIRFHSGDNGKNTIVGFEVYPRSVSDYH 227

Query: 205 DGGCKPTGKALSLS----ESEVNYIHFTYSV----EFIPSETAWVTRWDKYLHVYDPTIQ 256
             G   T +   ++    E+E+ Y+ FTYSV    EF   E  W  RWD +L+  + + +
Sbjct: 228 CPGASKTYEQYEITIPEDENELTYLPFTYSVYWREEF---EVDWNHRWDYFLNSGELSDE 284

Query: 257 WXXXXXXXXXXXXXXCAVARSLLQAL----------KSDFSRYGELNLDETIKEDA--SW 304
                            ++ SL+  +           +  S    +N++    ED   + 
Sbjct: 285 QSSQFHWMSFANSVIIVLSISLITLIIYIGVMHTDKNNPHSNKFMINIEGIGAEDVLNND 344

Query: 305 KLGHGDVFRA---------PDHPML--LSILVGSGVQLFLMIICTIFLPAVGLITPGSRG 353
           K     V+           PD   L  L +LV  GVQ    +I ++ +          R 
Sbjct: 345 KYSKNSVYMVAKDWIQNGKPDLFSLKGLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRN 404

Query: 354 TLPTVMFLLYLGFSFISSFVS-----MGVYKFFN----GQKWHINCXXXXXXXXXX---- 400
           ++ T+  L ++  +F++SFV      +   + FN    G   +  C              
Sbjct: 405 SVLTMAILCFVIGAFMASFVGTRLSIVSKTRRFNANYFGDNKNFKCREKFSPIFAIICGS 464

Query: 401 ----XXXXXXXXXXXXXFVHSS-GVIPLATFTSLILLWFFIGVPLSITGSLMARKTC--- 452
                            + H S   +P  T    I ++F + +PLS+ G ++A       
Sbjct: 465 SLPGMIMISTFLLNSIVWAHDSTNALPFKTIVFFISVYFIVCIPLSLFGGIVANNIPLPQ 524

Query: 453 HW------DIHPTKTNTVSKVIPPQKWYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFN 506
           +W      D   +K N +     P K+         + G+F    + VE+ +VY SLW  
Sbjct: 525 YWLSGITIDESDSKNNKLFLPKSPNKFNPLVNCGIYLCGVFPLLVIYVEMQYVYKSLWLE 584

Query: 507 K--IFYMYGFLFGSAIXXXXXXXXXXXXXXY------YSLSAENWQWQWRSFLIAGLGCS 558
           K   +Y YGFLF S I              Y      +        W+W+ F + G    
Sbjct: 585 KTTFYYFYGFLFLSIILLCVLTMEISVIGSYLLMRFCFEDKVVRNNWRWKCFEM-GFSGG 643

Query: 559 FYVFLHSL--LFTEVKLGGFTNALLYMGYSFVITSLAFVVTGALGFLSSMLFVRTIYSAV 616
            Y+ L+SL  +F  + + GF++ L+ + YS +   +  +  GAL +L++  F+  IY  V
Sbjct: 644 VYMELYSLYYIFAVLNIHGFSSILISICYSLLFNIMCGLGLGALSYLTASWFINKIYH-V 702

Query: 617 KVD 619
           KV+
Sbjct: 703 KVN 705

>TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {ON}
           Anc_7.411 YER113C
          Length = 678

 Score =  114 bits (284), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 136/641 (21%), Positives = 242/641 (37%), Gaps = 93/641 (14%)

Query: 27  YYEKLHFCKPEHVEKA-GVSIGSVLFGDRLYNSPFQLNMLKNKTCERLCNSTIIGRDAKF 85
           YY+    C P   +K   +S+  ++ GDR + S ++L   ++ +CE LC         + 
Sbjct: 70  YYDLPFTCPPTEDKKPLHLSLNEIIRGDRKWESDYKLKFGQDASCEALCARKTKPAGMRR 129

Query: 86  INKLIKNGYYQNWLIDG-LPAAREVYDTRTKSNFYGNGFELGLVEIRQTTGEKLLPNSAD 144
             +L++ GY   WLID  LPAA     T     +Y +GF LG V+               
Sbjct: 130 AQELVRQGYVVQWLIDQELPAATTFISTIDHKKYYVSGFPLGFVD--------------- 174

Query: 145 TFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSP 204
                              D E  Y   H  + I Y+    + + +VG  V P S+    
Sbjct: 175 ------------------PDTEKTYLNTHVMMVIRYNAIDPETFTIVGFEVYPKSVS--- 213

Query: 205 DGGCKPTGKA-------LSLSESEVNYIHFTYSVEFIPS-ETAWVTRWDKYLHVYDPT-- 254
           D  C    K        +  +E E+ YI FTYSV +    +  W  RW+ +L+  + +  
Sbjct: 214 DYHCPGASKGYEQYELIVPENEDELTYIPFTYSVYWREEFKVDWSHRWNFFLNSGEMSEA 273

Query: 255 ----IQWXXXXXXXXXXXXXXCAVARSLLQALKSDF---SRYGELNLDETIKEDASWKLG 307
                 W                V  +L + ++      S   +   DE  + D+ + + 
Sbjct: 274 SSRRFHWMTLGNSVGISFLLMLIVIANLYRIVRVGHEAGSEEFQFTFDENEEADSIYGVA 333

Query: 308 HGDVFRAPDHPM---LLSILVGSGVQLFLMIICTI-FLPAVGLITPGSRGTLPTVMFLL- 362
              + +     +   +L+I V  GVQ    II ++ F  ++  +       L    F L 
Sbjct: 334 KTWLAQTDSSSISFKILTIFVSIGVQFLFTIIGSLAFSCSLNKLHNIRNSVLSVASFFLC 393

Query: 363 ---YLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXXXFV---- 415
              YL   F+ +++ +      +G      C                       ++    
Sbjct: 394 HWSYLWHLFVGTWLHIDHRTTNDGSAGR--CRTFSILCGSALPGLVMISTQMLNWIVWAN 451

Query: 416 HSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIH--PTKTNTVSKVIPPQKW 473
            SS  +P  T    + ++F I +PLS+ G  ++ +         P  ++  ++ I P + 
Sbjct: 452 ESSHALPFRTIVLFVSIYFVICIPLSLLGEEVSHRVHRKQAQNFPILSSLGARSIKPCRA 511

Query: 474 YLQTIPASL------------IGGLFSFGSLSVELYFVYTSLWFNK--IFYMYGFLFGSA 519
                P  +            I G   F  + VEL ++Y S+W  K   +Y+YGFL  + 
Sbjct: 512 PTTLAPRKISERLTFDFATFAICGFLPFAVIYVELQYIYKSVWLEKTDFYYLYGFLLANI 571

Query: 520 IXXXXXXXXXXXXXXYYSLSAENW-----QWQWRSFLIAGLGCSFYVFLHSL--LFTEVK 572
           I              Y  +           W+W+ F++ G  C++Y+ L+SL  +F  +K
Sbjct: 572 ILLCIVVCEVSFLGCYVMMRKHKRVATFDSWRWKCFMM-GTSCAWYMELYSLYYIFHTLK 630

Query: 573 LGGFTNALLYMGYSFVITSLAFVVTGALGFLSSMLFVRTIY 613
           + GF +  + + YS +   +     G+LG+L+S   V  ++
Sbjct: 631 MTGFPSIFISVSYSLIFNIMCGCGMGSLGYLTSCWLVNRVF 671

>YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}
           TMN3Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn2p; member
           of Transmembrane Nine family with 9 transmembrane
           segments; localizes to Golgi; induced by
           8-methoxypsoralen plus UVA irradiation
          Length = 706

 Score =  112 bits (281), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 151/659 (22%), Positives = 253/659 (38%), Gaps = 111/659 (16%)

Query: 27  YYEKLHFCKPE-HVEKAGVSIGSVLFGDRLYNSPFQLNMLKNKTCERLCNSTIIGRDAKF 85
           YY+    C P  H +   +S+  ++ GDR + S ++L   ++  CE LC         + 
Sbjct: 81  YYDLPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYKLKFGEDNPCETLCARKTTKEGMQT 140

Query: 86  INKLIKNGYYQNWLIDG-LPAAREVYDTRTKSNFYGNGFELGLVEIRQTTGEKLLPNSAD 144
           ++KL++ GY   WLID  LPAA     T     +Y +GF LG ++          P++  
Sbjct: 141 LDKLVREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFID----------PDTDK 190

Query: 145 TFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSI-DRS 203
           T+  LH                     NH  + I +H   ND   +VG  V P S+ D  
Sbjct: 191 TY--LH---------------------NHVMLVIRFHASDNDKNTIVGFEVYPRSVSDYH 227

Query: 204 PDGGCKPTGK---ALSLSESEVNYIHFTYSV----EFIPSETAWVTRWDKYLHV----YD 252
             G  K   +    +   E+E+ Y+ FTYSV    EF   E  W  RWD +L+      +
Sbjct: 228 CPGASKNYEQYEIVIPEDENELTYLPFTYSVYWREEF---EVDWNHRWDYFLNAGELSDE 284

Query: 253 PTIQ--WXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGE----LNLDETIKED--ASW 304
            +IQ  W                     ++ + +D S        +N++    ED     
Sbjct: 285 QSIQFHWMSLANSVGIVLSISFITLIIYVRVMYTDKSNSKSPKYMINIEGIETEDDLDDD 344

Query: 305 KLGHGDVFRAPD------HPML-----LSILVGSGVQLFLMIICTIFLPAVGLITPGSRG 353
           K G   V+           P L     L +LV  GVQ    II ++ +          R 
Sbjct: 345 KYGKYSVYTVAKDWIQNGRPNLFGLKVLILLVSFGVQFLFTIIGSLTISCSMNKLHNVRN 404

Query: 354 TLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXXX 413
           ++ T+  L ++  +F++SFV   +      ++   N                        
Sbjct: 405 SVLTMAILFFVLGAFMASFVGTRLSMVTKTKRTKANYLDDNRYLKDYKKFSPIFTILCGS 464

Query: 414 FVHSSGVIPLATFTSLILLW--------------------FFIGVPLSITGSLMARKTC- 452
            +   G++ ++TF    ++W                    F + +PLS+ G ++A     
Sbjct: 465 SL--PGIVMVSTFLLNSIVWAHDSTSALPFKTIVFFMSIYFIVCIPLSLFGGIVANNIPL 522

Query: 453 --HWDIHPTKTNTVSK----VIPPQKWYLQTI--PASLIGGLFSFGSLSVELYFVYTSLW 504
             +W    TK  + S      +P  +     +      + G+F    + VE+ +VY SLW
Sbjct: 523 PQYWLSGITKDESNSDGNGLFVPKSRAKFNPLVYCGIYLCGIFPLLVIYVEMQYVYKSLW 582

Query: 505 FNK--IFYMYGFLFGSAIXXXXXXXXXXXXXXY------YSLSAENWQWQWRSFLIAGLG 556
             K   +Y YGFLF S I              Y      +        W+W+ F + G  
Sbjct: 583 LEKTTFYYFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFEDKVVRNNWRWKCFEM-GFS 641

Query: 557 CSFYVFLHSL--LFTEVKLGGFTNALLYMGYSFVITSLAFVVTGALGFLSSMLFVRTIY 613
              Y+ L+SL  +F  + + GF++ L+ + YS +   +  +  GAL +L++  F+  IY
Sbjct: 642 GGVYMELYSLYYIFAVLNIHGFSSILISICYSLIFNVMCSLGLGALSYLTASWFINKIY 700

>KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 676

 Score =  111 bits (278), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 141/633 (22%), Positives = 243/633 (38%), Gaps = 89/633 (14%)

Query: 20  TIYSYDYYYEKLHF-CKP-EHVEKAGVSIGSVLFGDRLYNSPFQLNMLKNKTCERLCNST 77
           T +SY YY   LHF C P + ++   ++   +L+G++ + S +QL   K++ C RLC+  
Sbjct: 80  THFSYGYY--DLHFTCPPSQDMKPLPLTFSDILYGNKKWQSDYQLTFGKDEDCVRLCDRK 137

Query: 78  IIGRDAKFINKLIKNGYYQNWLI-DGLPAAREVYDTRTKSNFYGNGFELGLVEIRQTTGE 136
             G   K   +LIK  Y   WL  D LP A    +T+ K  +Y +GF LG  +       
Sbjct: 138 TNGEGKKQAYELIKQNYVVQWLADDDLPGATTYLNTKDKKKYYSSGFPLGQYD------- 190

Query: 137 KLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVN 196
                                      + +  Y  NH  I I YH        +VG  V 
Sbjct: 191 --------------------------PETDEAYINNHVMIVIRYHTIDQGKNTIVGFEVY 224

Query: 197 PVSI-DRSPDGGCKP-TGKALSLSESEVNYIHFTYSVEFIPS-ETAWVTRWDKYLHVYDP 253
           P S+ D    G  K  T   +  +  ++ +I FTY+V +    +  W  RW+ +++    
Sbjct: 225 PKSVSDHHCPGASKDYTPYKIDPTNEDIEFISFTYAVYWREDFKVDWKNRWNFFIN--GG 282

Query: 254 TIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGELNLDETIKEDASWKLGHGDVFR 313
            ++                 V   LL  + +   R  E +   T +  A W      +F 
Sbjct: 283 ELKESTSNQFHWITFANGIIVTSCLLLIVIAILKR-QETDGSITTQLAAEWSKARVPLF- 340

Query: 314 APDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPTVMFLLYLGFSFISSFV 373
                  L++LV  G+      + T+ +      T     ++ T    L++  SF SSF+
Sbjct: 341 -----FQLNLLVSMGIHFLFTTLGTLIISCSLNHTHRIGSSVLTCAVFLFISGSFTSSFI 395

Query: 374 SMGVYKFFNGQKWHINCXXXXXXXXXXXXXXXXXXXXXXXFVHSSGVIPLATFTSLILLW 433
              +    +  K  +N                          +++  +P  T   L   +
Sbjct: 396 GALLEGQMSQHKL-VNSIIFGSTLPGITLVIVLLLNYILKANNAANTLPHGTVALLFGAY 454

Query: 434 FFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVI----PPQKWYLQT-----------I 478
           F + VP+SI G   A +    +   T  N+ +         +  Y+++           I
Sbjct: 455 FIVCVPISIIGGKCADRFLKVNSTNTLLNSFALAEVNKHDTRPLYVESKNSIPFVLKNPI 514

Query: 479 PASLIGGLFSFGSLSVELYFVYTSLWFNK--IFYMYGFLFGSAIXXXXXXXXXXXXXXYY 536
             +L  GL  F  + VEL F Y SLW  K  ++Y+YGFL  + +              Y 
Sbjct: 515 AITLTFGLIPFALIYVELLFAYKSLWLQKTTLYYLYGFLLSNIVIVCICICLLSIIGCYI 574

Query: 537 SLSAEN------WQ------------WQWRSFLIAGLGCSFYVFLHSLLFT--EVKLGGF 576
            L+  N      W             W+W++F + G   ++Y+  +S+L+     +   F
Sbjct: 575 HLNYGNDSLNFKWDNVIGRVLEACHSWRWKAFHMGG-AVAWYMEAYSILYLIFVARYRDF 633

Query: 577 TNALLYMGYSFVITSLAFVVTGALGFLSSMLFV 609
            ++ L++ YS +   L +   G+L +LSS+ F+
Sbjct: 634 ISSFLFVCYSTLFNILCWTAFGSLSYLSSLWFI 666

>Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C
           (REAL)
          Length = 707

 Score =  107 bits (267), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 157/680 (23%), Positives = 265/680 (38%), Gaps = 102/680 (15%)

Query: 2   HYHHKNQEGQDISTDDKRTIYSYDYYYEKLHF-CKPE-HVEKAGVSIGSVLFGDRLYNSP 59
           +++ KN   + I    +  +    Y Y  L F C P  H +   +S+  ++ GDR + S 
Sbjct: 56  NFYKKNDFLELIVNKVESDLTQLPYAYYDLPFTCPPTMHKKPLHLSLNEIIRGDRKWESD 115

Query: 60  FQLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDG-LPAAREVYDTRTKSNF 118
           ++L   ++  CE LC      +  + ++KL++ GY   WLID  LPAA     T     +
Sbjct: 116 YKLRFGEDNACETLCARKTDKKGMQTLDKLVREGYVVQWLIDDELPAATTFISTTDHKKY 175

Query: 119 YGNGFELGLVEIRQTTGEKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRI 178
           Y +GF LG V+                                  D +  Y  NH  + I
Sbjct: 176 YASGFPLGFVD---------------------------------PDTDKTYLHNHVILVI 202

Query: 179 EYHDRGNDNYRVVGVTVNPVSI-DRSPDGGCKPTGK---ALSLSESEVNYIHFTYSVEFI 234
            +H  G+D   VVG  V P S+ D    G  K   +    +   E ++ Y+ FTYSV + 
Sbjct: 203 RFHGGGDDKNTVVGFEVYPKSVSDYHCPGASKNYEQYEIVVPEDEHDLTYLPFTYSVYWR 262

Query: 235 PS-ETAWVTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARS---------LLQALKS 284
              E  W  RW+ +L+  + + +                 ++ S         +++  K 
Sbjct: 263 EEFEVDWNHRWNYFLNAGELSDEQSAQFHWMSLANSLGIVLSISFITFVIYIRVMRTDKK 322

Query: 285 DFSRYGELNLDETIKEDASW---KLGHGDVFRA---------PD--HPMLLSILVGSGVQ 330
           +   +  L   E I+ + S    K G   V+           PD     +L +LV  GVQ
Sbjct: 323 NTDSHKYLINTEGIEAEDSLDDDKYGKNSVYMVTKDWIQNGKPDLFGLKVLIVLVSFGVQ 382

Query: 331 LFLMIICTIFLPAVGLITPGSRGTLPTVMFLLYLGFSFISSFVS--MGVY--------KF 380
               II ++ +          R ++ T+  L ++  +F++SFV   +G+          +
Sbjct: 383 FLFTIIGSLTISCSMNKLHNVRNSVLTMAILCFVLGAFMASFVGTRLGIVTKRRNINVNY 442

Query: 381 FNGQKWHINCXXXXXXXXXXXXXXXXXXXXXXXFV--------HSSGVIPLATFTSLILL 432
            +  K   NC                       F+         S+  +P  T    I +
Sbjct: 443 LDHNKSFKNCREFSPIFAVICGSSLPGMVMIGTFLLNSVVGAHDSTNALPFRTIVFFISI 502

Query: 433 WFFIGVPLSITGSLMARKTC---HWDIHPTKTNTV---SKVIPPQ---KWYLQTIPASLI 483
           +F + +PLS+ G ++A       +W    TK  T    SK+  P+   ++         +
Sbjct: 503 YFVVCIPLSLFGGIVANNIPLPKYWLSGITKDETDGNGSKLFKPKSRTRFNPLVHCGVYL 562

Query: 484 GGLFSFGSLSVELYFVYTSLWFNKI--FYMYGFLFGSAIXXXXXXXXXXXXXXY------ 535
            G+F    + VE+ +VY SLW  K   ++ YGFLF S I              Y      
Sbjct: 563 CGIFPLLVIYVEMQYVYKSLWLEKTTFYFFYGFLFLSIILLCVLTMEISIIGSYLLMRFC 622

Query: 536 YSLSAENWQWQWRSFLIAGLGCSFYVFLHSL--LFTEVKLGGFTNALLYMGYSFVITSLA 593
           +        W+WR F + G     Y+ L+SL  +F  + + GF++ L+ + YS +   L 
Sbjct: 623 FDDKEVRNNWRWRCFEM-GFSGGVYMELYSLYYIFVVLNIHGFSSILISICYSLLFNILC 681

Query: 594 FVVTGALGFLSSMLFVRTIY 613
            +  GAL  L++  F+  IY
Sbjct: 682 GLGLGALSCLTASWFINRIY 701

>KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} similar
           to uniprot|P40071 Saccharomyces cerevisiae YER113C
           Hypothetical ORF
          Length = 694

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/253 (28%), Positives = 109/253 (43%), Gaps = 46/253 (18%)

Query: 5   HKNQEGQDISTDD-KRTIYSYDYYYEKLHF-CKPEHVEKA-GVSIGSVLFGDRLYNSPFQ 61
           +K  +  D++ +  +  I +  Y Y  L F C P   +K   +S+  V+ GDR + S + 
Sbjct: 49  YKRGDKVDLTVNKVESEITNLPYGYYDLRFVCPPSETKKPLHLSLDEVIRGDRKWESDYN 108

Query: 62  LNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDG-LPAAREVYDTRTKSNFYG 120
           L     + CERLC+   +    +  ++LI+  Y  +WLIDG LPAA     TR+   FY 
Sbjct: 109 LEFGVGQDCERLCDRKTMPDGLRQADRLIRENYMVHWLIDGDLPAATTFASTRSGKKFYT 168

Query: 121 NGFELGLVEIRQTTGEKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEY 180
            GF LG V+                    H+ D  ++              NH  + I Y
Sbjct: 169 AGFPLGRVD--------------------HETDKTHL-------------HNHLMLVIRY 195

Query: 181 HDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKA-----LSLSESEVNYIHFTYSVEFI- 234
                + Y +VG  V P S+    D  C    K+     ++  E+EV YI FTYSV +  
Sbjct: 196 QAFDFNRYAIVGFEVYPRSVS---DYQCPGASKSFEPYVINTEETEVTYIPFTYSVYWRE 252

Query: 235 PSETAWVTRWDKY 247
            S   W  RW+ +
Sbjct: 253 ESNIDWSHRWNLF 265

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/265 (22%), Positives = 98/265 (36%), Gaps = 76/265 (28%)

Query: 417 SSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYL- 475
           SS  +P  T  +L+  +F I +PLS  G   ARK       P       +   P  + L 
Sbjct: 424 SSAALPFGTLLALLTSYFVICLPLSFLGGFSARKL---RSAPANGLNYEQSKVPFSFLLS 480

Query: 476 --------------QTIPA--------SLIGGLFSFGSLSVELYFVYTSLWFNK--IFYM 511
                         + IPA        +++ G   F     EL FVY SLW  K  ++ +
Sbjct: 481 IEYHEYNLLPAGQEKEIPAILSNPFLLTIVTGFPPFVVTCTELLFVYRSLWLQKTNLYSL 540

Query: 512 YGFLFGSAIXXXXXXXXXXXXXXYYSL--------------------------------- 538
           YGFL  + I              Y  +                                 
Sbjct: 541 YGFLLVNFIFLCITVCEVSLVVCYVLMIYTQPGSTDRQASNEGPDIRWSICRSPMTIVKS 600

Query: 539 -------SAENWQ-----WQWRSFLIAGLGCSFYVFLHSL--LFTEVKLGGFTNALLYMG 584
                  +A  W+     W+W++F+ AG   ++Y  L+SL  L   + L  F++ LL++ 
Sbjct: 601 LKNYMASTARRWKASFSSWRWKAFM-AGASVAWYFELYSLYYLIFVLHLRDFSSILLFVC 659

Query: 585 YSFVITSLAFVVTGALGFLSSMLFV 609
           Y+ +   + +   GALG+L+ + F+
Sbjct: 660 YTSLFNLMCWCAFGALGYLTCLWFL 684

>Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113C -
           Hypothetical ORF [contig 33] FULL
          Length = 690

 Score = 83.6 bits (205), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 95/231 (41%), Gaps = 44/231 (19%)

Query: 27  YYEKLHFCKPEHVEKA-GVSIGSVLFGDRLYNSPFQLNMLKNKTCERLCNSTIIGRDAKF 85
           YY+    C P   +K   +S+  ++ GDR + S + L   +   C RLC+        K 
Sbjct: 69  YYDLQFVCPPSDKKKPLHLSLNEIIRGDRKWESDYNLAFGERHDCLRLCDRKTKPEGLKQ 128

Query: 86  INKLIKNGYYQNWLI-DGLPAAREVYDTRTKSNFYGNGFELGLVEIRQTTGEKLLPNSAD 144
            + LI+ GY  +WLI D LPAA     T++   FY  GF LG  E+   TG+  L     
Sbjct: 129 ADALIRQGYVAHWLIDDDLPAATTFAKTKSGKKFYTAGFPLG--EVDAVTGKTRL----- 181

Query: 145 TFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSP 204
                                      NH  + + Y     + + ++G  V P S+    
Sbjct: 182 --------------------------YNHLMLVVRYQTVDVNKHTIIGFEVYPKSVS--- 212

Query: 205 DGGCKPTGK-----ALSLSESEVNYIHFTYSVEFI-PSETAWVTRWDKYLH 249
           D  C    K      ++  ESE+ YI FTYS+ +   S   W  RW+ ++H
Sbjct: 213 DAHCPGANKDYQPYEINTEESEITYIPFTYSIYWREESNIDWSHRWNFFIH 263

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 48/124 (38%), Gaps = 26/124 (20%)

Query: 417 SSGVIPLATFTSLILLWFFIGVPLSITGSLMARK----------------------TCHW 454
           SS  IP  T    +  +F I  PLS+ G   ARK                      T  +
Sbjct: 420 SSSAIPFGTVVVFVAGYFMISFPLSLLGGFSARKMKNAAKLAPANAISKSPFSFLLTLSY 479

Query: 455 DIHPTKTNTVSKVIPPQKWYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFN--KIFYMY 512
           D        + K  P        I  +++ G+  F  + VEL++VY S+W      +Y+Y
Sbjct: 480 DTRSWPATALGKPFPIA--LSNPILLTILAGIAPFVVICVELFYVYKSMWLQTTNFYYLY 537

Query: 513 GFLF 516
           GFL 
Sbjct: 538 GFLL 541

>KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.411
           YER113C
          Length = 680

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 112/237 (47%), Gaps = 39/237 (16%)

Query: 417 SSGVIPLATFTSLILLWFFIGVPLSITGSLMA-----------RKTCHWDIHPTKTN--- 462
           S+ V+P AT   L+ ++F + +PLS+ G  +A           R      I  T+ N   
Sbjct: 441 STNVLPFATIMKLLFIYFIVCIPLSVLGGSIAANKDSEEYSRLRSDSIKRISRTRANKIM 500

Query: 463 ---------TVSKVIPPQKWYLQ-------TIPASLIGGLFSFGSLSVELYFVYTSLWFN 506
                    T  K+    +W L+       T+ + L  G+F F  + VEL FVY S+W+ 
Sbjct: 501 DEDQGTDVRTTRKLKYKVRWQLKKMMLDTVTVVSLLASGIFPFIMIYVELQFVYKSVWYE 560

Query: 507 K--IFYMYGFLFGSAIXXXXXXXXXXXXXXYYSLSAENWQ----WQWRSFLIAGLGCSFY 560
           K   +Y YGFL  + I              Y  ++  +      W+W++F ++   C++Y
Sbjct: 561 KTTFYYYYGFLLANIILLCLVICDIAIICSYLMMTVSSKDNSDSWKWKTFQLSS-SCAWY 619

Query: 561 VFLHSL--LFTEVKLGGFTNALLYMGYSFVITSLAFVVTGALGFLSSMLFVRTIYSA 615
           +  +S+  +F  + +  F++ L+ + YS +  +L  +  G++G+L+S+ FV+ +Y +
Sbjct: 620 MEAYSIYYVFKVLNMRDFSSILISVCYSLLFNALCGLAMGSIGYLASLWFVKRVYRS 676

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 86/216 (39%), Gaps = 46/216 (21%)

Query: 26  YYYEKLHFCKPEHVEKAGV--SIGSVLFGDRLYNSPFQLNMLKNKTCERLCNSTIIGRDA 83
           Y Y  L F  P  V+K  +  S+  V+ GDR + S ++L   K+  C  LC         
Sbjct: 60  YGYYDLPFTCPPTVDKKPLHLSLNEVIRGDRKWQSNYELEFGKDTECTVLCARKTNPDGM 119

Query: 84  KFINKLIKNGYYQNWLIDG-LPAAREVYDTRTKSNFYGNGFELGLVEIRQTTGEKLLPNS 142
           + ++K IK  Y   W ID  LPAA     T  +  +YG+GF LG V+  + TG+      
Sbjct: 120 RSLDKFIKQEYVVQWFIDKELPAATTFISTVDQKKYYGSGFPLGFVD--EETGK------ 171

Query: 143 ADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDR 202
                                     Y  NH  + I YH   + N+ +VG  + P S+  
Sbjct: 172 -------------------------VYVNNHVMMVIRYHAIDDYNFTIVGFEIYPKSVS- 205

Query: 203 SPDGGCKPTGKALSLSE-------SEVNYIHFTYSV 231
             D  C    K     E       +E  +I FTYSV
Sbjct: 206 --DYHCPGASKDYDQYEVVVPEIANEDTFIPFTYSV 239

>CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113c
          Length = 704

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 110/234 (47%), Gaps = 36/234 (15%)

Query: 417 SSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPT-------KTNTVS---- 465
           S+  +P  T   L+ ++F   +PLS+ G ++A   C  D + T       + NT+S    
Sbjct: 473 STNALPFKTEVFLVSIYFVTCIPLSLLGGVLALN-CKVDSYNTLKRITSLRRNTISRKSR 531

Query: 466 -----KVIPPQKWYLQ------TIPASLIGGLFSFGSLSVELYFVYTSLWFNK--IFYMY 512
                KV   Q+          T   +L GG FSF  + VEL +VY S+W  K   +Y Y
Sbjct: 532 SDFTKKVSLYQRLVFDIKHDSFTTFGALAGGFFSFIIIWVELQYVYKSVWLEKTSFYYYY 591

Query: 513 GFLFGSAIXXXXXXXXXXXXXXYYSLSAENWQ-----WQWRSFLIAGLGCSFYVFLHSL- 566
           GFL  + +              Y  L A+N +     W W+SFL+ G  C++Y+ L+SL 
Sbjct: 592 GFLLANILILSIVTIEIAIIGCYVMLKAKNDRYLRHTWGWKSFLM-GSSCAWYMELYSLY 650

Query: 567 -LFTEVKLGGFTNALLYMGYSFVITSLAFVVTGALGFLSSMLFVRTIYSAVKVD 619
            +F  + + GF++  + + YS +   +     G+L +L+S + V  IY   KVD
Sbjct: 651 YIFFVLNMQGFSSIFISVCYSLLFNGMCGWALGSLSYLTSYMLVTQIY---KVD 701

 Score = 70.5 bits (171), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 93/230 (40%), Gaps = 40/230 (17%)

Query: 27  YYEKLHFCKPEHVEKA-GVSIGSVLFGDRLYNSPFQLNMLKNKTCERLCNSTIIGRDAKF 85
           YY+    C P   +K   +S+  +  GDR + S ++L+   +  CE LC           
Sbjct: 80  YYDLPFICPPTKEKKPLHLSLDEIFRGDRKWQSDYKLSFGIDSPCEILCARKTKKEGMIK 139

Query: 86  INKLIKNGYYQNWLID-GLPAAREVYDTRTKSNFYGNGFELGLVEIRQTTGEKLLPNSAD 144
             +L++ GY   WLID  LPAA     +   + +Y  GF +G V+ R  TG+  L     
Sbjct: 140 AKELVQQGYVTQWLIDESLPAATTFISSTNHNKYYAAGFPVGYVDDR--TGKTFLN---- 193

Query: 145 TFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSI-DRS 203
                                      NH  + I YH    + + +VG  V P S+ D  
Sbjct: 194 ---------------------------NHVMLVIRYHPVSEEEFTIVGFEVYPKSVSDYH 226

Query: 204 PDGGCKPTGK---ALSLSESEVNYIHFTYSVEFIPS-ETAWVTRWDKYLH 249
             G  K   K    +   + E+ +I FTYSV +    E  W  RW+ +L+
Sbjct: 227 CPGANKNHDKYEIIVPEKDDELTFIPFTYSVYWREEFEVDWNHRWNYFLN 276

>Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar to
           Ashbya gossypii AGL295C
          Length = 676

 Score = 73.2 bits (178), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 141/672 (20%), Positives = 231/672 (34%), Gaps = 116/672 (17%)

Query: 8   QEGQDISTDDKRTI-----YSYDYYYEKLHF-CKPEHVEK-AGVSIGSVLFGDRLYNSPF 60
           Q+G+++     + +      SY YY   L F C P    +    S+  V  GDR + S +
Sbjct: 46  QDGEEVEMLLNQVVGKPGELSYGYY--DLQFTCTPTKSRRMVHHSLYEVFSGDRKWQSDY 103

Query: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDG-LPAAREVYDTRTKSNFY 119
           +L   +   C  LC            + LI+  Y    LID  +PA++     R    +Y
Sbjct: 104 KLYFNRENKCSTLCFRKTQPSGLIEADSLIRQNYTVQLLIDEIMPASKTYVSMRDNKRYY 163

Query: 120 GNGFELGLVEIRQTTGEKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIE 179
             GF LG V+                                  + +V Y  NHF + I 
Sbjct: 164 VPGFPLGFVD---------------------------------PETDVTYLHNHFMLVIR 190

Query: 180 YHDRGNDNYRVVGVTVNP--VSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSV----EF 233
           Y+    + Y +VG  V P  VS D  P         A++ SE +V +I  TYSV    EF
Sbjct: 191 YNAVDINKYTIVGFEVYPKSVSDDHCPGSSKDYENYAVNPSEKDVVFIPITYSVYWREEF 250

Query: 234 IPSETAWVTRWDKYLHVYDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGELN 293
           +     W  RW+ YL   D  +                       L +L    SR G   
Sbjct: 251 M---VDWENRWNFYLSAGDLDVNKSLCFRGIKVTMVFIILT----LMSLAIIVSRLGLGT 303

Query: 294 LDETIKEDAS-WKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSR 352
               I   AS W      V R     + L+  V  G+Q+      T+ L           
Sbjct: 304 GSMFITAVASEW------VRRGAPCLLFLNTFVSMGIQVIFAAPATLLLICSMGKLHNIS 357

Query: 353 GTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHIN--CXXXXXXXXXXXXXXXXXXXX 410
             L  +  L Y+   F+S+F  + +       K  I                        
Sbjct: 358 NFLVCIAALCYMTGIFMSAFGGILLSGNLLDNKAQIRKYSVLYGSALPALTVAVLVLANS 417

Query: 411 XXXFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMAR---KTCHWDIHPTKTNTVSKV 467
               +     +P    T L+ L+F + +PLS+ G   A    K  H+ ++   T      
Sbjct: 418 IAWIIERGKEMPFRDITLLLALYFMVSLPLSLLGGTSASYKLKDQHFQLYSLSTKYTGTP 477

Query: 468 IPPQK---WY-------------LQTIPASL--------IGGLFSFGSLSVELYFVYTSL 503
           + P K   W+              + IP  L        I G+  F ++ +++ F++  L
Sbjct: 478 VSPSKPTFWFNFEYDTRGTPACAHEQIPMWLSKPFLITSIIGIIPFLAIYLQMEFIWKPL 537

Query: 504 WFN--KIFYMYGFLFGSAIXXXXXXXXXXXXXXYY-------------------SLSAEN 542
           W +   +F +Y  L    I              Y                     +S   
Sbjct: 538 WTHSKSLFQIYVSLIIGMILQSILVMEICILIMYVHMHHGDDSECCFDDTCVTGRISNAV 597

Query: 543 WQWQWRSFLIAGLGCSFY--VFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVTGAL 600
             W+W++F + G    ++    L+ ++F  ++L  F + LLY+ Y  ++    F   G++
Sbjct: 598 SSWRWKAFYMGGAAAWYWEAYSLYYMIFI-LRLRNFGSILLYLSYGTLLNVFYFYSFGSI 656

Query: 601 GFLSSMLFVRTI 612
           G+L+   F+  +
Sbjct: 657 GYLACCWFLNKL 668

>KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {ON}
           Anc_7.411 YER113C
          Length = 664

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 99/224 (44%), Gaps = 36/224 (16%)

Query: 417 SSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQ 476
           SS  +PL T   LI ++F + +PLS+ G   A   C       +  T+     P +  L 
Sbjct: 442 SSRALPLKTILFLISIYFIVCIPLSLLGGSYASDIC-------QKRTLRAFSSPAQQKLA 494

Query: 477 TIPASL------------------IGGLFSFGSLSVELYFVYTSLWFNK--IFYMYGFLF 516
              ++L                  IGGLF F  + VEL  VY  +W  K   +Y+  FLF
Sbjct: 495 VTNSNLARTIKSIFDDPFSGLLASIGGLFPFFIIYVELQHVYKFVWLEKASFYYLRWFLF 554

Query: 517 GSAIXXXXXXXXXXXXXXYYSL-----SAENWQWQWRSFLIAGLGCSFYVFLHSL--LFT 569
            + I              Y  +     S EN  W+WRSF I+   C++Y+ L+SL  +F 
Sbjct: 555 ANIIILCIVVVEIAIISAYIMMHSSRSSLEN-SWRWRSFQISS-SCAWYMELYSLYYIFY 612

Query: 570 EVKLGGFTNALLYMGYSFVITSLAFVVTGALGFLSSMLFVRTIY 613
            +   GF++ LL +  S +   L     G++G+L++  FV  +Y
Sbjct: 613 VLNTTGFSSILLSVCSSALFNGLCGCALGSIGYLATCWFVGRVY 656

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 79/210 (37%), Gaps = 38/210 (18%)

Query: 27  YYEKLHFCKPEHVEKA-GVSIGSVLFGDRLYNSPFQLNMLKNKTCERLCNSTIIGRDAKF 85
           YY+    C P +  K   +S+  +L GDR + S + L   K+  C  LC         + 
Sbjct: 66  YYDLPFICPPTNQRKPLHMSLTEILRGDRKWQSDYSLTFGKDNDCAVLCARKTTPEGIQK 125

Query: 86  INKLIKNGYYQNWLIDG-LPAAREVYDTRTKSNFYGNGFELGLVEIRQTTGEKLLPNSAD 144
              L+K  Y   W ID  LPA+     T     +Y  GF LG V+               
Sbjct: 126 AINLVKKDYIVQWSIDNDLPASTTFISTSENRKYYIPGFSLGFVD--------------- 170

Query: 145 TFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSP 204
                              D E  Y  NH  + I YH   ++++ +VG+ V P S+    
Sbjct: 171 ------------------PDTETAYLNNHVMLVIRYHAIDDEHFTIVGLEVYPKSVSDYH 212

Query: 205 DGGCKPTGKALSL---SESEVNYIHFTYSV 231
             G     +   L    + EV YI FTYSV
Sbjct: 213 CPGASRNYEQFELVANDDEEVTYIPFTYSV 242

>TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411
           YER113C
          Length = 713

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 73/333 (21%), Positives = 116/333 (34%), Gaps = 67/333 (20%)

Query: 27  YYEKLHFCKPEHVEKA-GVSIGSVLFGDRLYNSPFQLNMLKNKTCERLCNSTIIGRDAKF 85
           YY+    C P   ++    S+  +  GD L  S + L   K++ C  LC+     +  + 
Sbjct: 92  YYDLPFVCPPSDTKRPIHNSLTELFNGDYLSESDYILEFAKDEPCHILCSRKTSKKGMQR 151

Query: 86  INKLIKNGYYQNWLIDG-LPAAREVYDTRTKSNFYGNGFELGLVEIRQTTGEKLLPNSAD 144
              LIKN Y   W +D  LP        +     Y  GF LG  +    TG+        
Sbjct: 152 AYDLIKNDYIVQWYVDNDLPVGTTYISNKVNKKQYLPGFSLGYFD--NQTGQA------- 202

Query: 145 TFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSI-DRS 203
                                   Y   H    + YH   +D + +VG+ V P SI D +
Sbjct: 203 ------------------------YLNTHLMFVVRYHAVTSDTFTIVGLEVYPRSIVDYN 238

Query: 204 PDGGCK---PTGKALSLSESEVNYIHFTYSV----EFIPSETAWVTRWDKY------LHV 250
             G  K   P    +  +  +  Y+ F+YSV    EF   +  W  RWD +      L  
Sbjct: 239 CPGASKDFIPLEVKVPENNDDPTYLPFSYSVYWREEF---DLPWNQRWDLFKTADELLRE 295

Query: 251 YDPTIQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGELNLDETIKEDASWKLGHGD 310
            D +  W                V   L   +  +  R         I  + SWK     
Sbjct: 296 KDLSFHW----YSLINSNSITVGVITFLCLVISMNRMR---------ILYNKSWKKRQLS 342

Query: 311 V--FRAPDHPMLLSILVGSGVQLFLMIICTIFL 341
           +       +P + +I + SG+Q F ++I ++ +
Sbjct: 343 ITTTTTTRYPNIFTICITSGIQFFFLLISSVLI 375

>AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER113C
          Length = 657

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 55/116 (47%), Gaps = 4/116 (3%)

Query: 27  YYEKLHFCKPEHVEKAGV-SIGSVLFGDRLYNSPFQLNMLKNKTCERLCNSTIIGRDAKF 85
           YYE L  C P    +A   S+G V   +  + S + L++     C+ LC   +     + 
Sbjct: 64  YYETLFTCPPPAEARAIYGSLGQVFRREMPWESNYVLHVRAETQCQPLCMRELRPDSHRR 123

Query: 86  INKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYGNGFELGLVEIRQTTGEKLLPN 141
           + ++I++G    W +DGLPAA   Y  R  S  Y  GF+LG  E+   TG   L N
Sbjct: 124 LIQMIRDGAQVRWTLDGLPAA-TTYPDRQSSYRYEAGFKLG--EVDAETGHVRLHN 176

>Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON}
           (64237..66282) [2046 nt, 682 aa]
          Length = 681

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 116/521 (22%), Positives = 179/521 (34%), Gaps = 79/521 (15%)

Query: 26  YYYEKLHF-CKPEHVEK-AGVSIGSVLFGDRLYNSPFQLNMLKNKTCERLCNSTIIGRDA 83
           Y Y  L F C P  V K   +   S+  GD L  S ++L    +  CE LC         
Sbjct: 76  YIYHDLPFVCPPTSVRKPVHLEFDSLFRGDTLSESDYKLKFGDDYECEILCARKTNKNGV 135

Query: 84  KFINKLIKNGYYQNWLIDG-LPAAREVYDTRTKSNFYGNGFELGLVEIRQTTGEKLLPNS 142
                +IK  Y   W ID  LP +     T T+   Y  GF LG  +             
Sbjct: 136 SKAIDMIKQDYQILWSIDDELPISMPYISTITQRKKYIPGFPLGRFD------------- 182

Query: 143 ADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDR 202
                               +D    Y  NH  + I Y+   +D + +VG  V   S+  
Sbjct: 183 --------------------KDKNKVYLYNHSMLVIRYNAIDDDKFTIVGFEVYLRSVSD 222

Query: 203 SPDGGCKPTGKALSL----SESEVNYIHFTYSV----EFIPSETAWVTRW---DKYLHVY 251
               G     +   L    ++ ++ +I FTYSV    EF   +  W +RW   D  +   
Sbjct: 223 YHCPGASKNYEEYELVIPENDDDLTFIPFTYSVYWREEF---DIDWTSRWNLFDNDIEEE 279

Query: 252 DPT-IQWXXXXXXXXXXXXXXCAVARSLLQALKSDFSRYGELNLDETIKEDAS--WKLGH 308
           DP  I                  +   +   +       GE N   T  + AS  W   +
Sbjct: 280 DPKLINKSMLSNIMQPTRTGLFLLPLIIFSIIIVKVVENGEKNKFTTEAQLASKCWIESN 339

Query: 309 GDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPTVMFLLY----L 364
               ++     +L++++  GVQ    +I  I L             +   +F+ +    L
Sbjct: 340 NINLKSSFSASILTLVISMGVQSIFSLIGIIILKLSIYKLHDISNIVLLNIFIWFIEGIL 399

Query: 365 GFSFISSFVSMGVY--KFFN-GQKWHINCXXXXXXXXXXXXXXXXXXXXXXXFVHSSGVI 421
             SF+ +++ M +   K  N   K+ I C                        + SS   
Sbjct: 400 ASSFLGTWLRMNILNKKSINYNPKFSILCGSLLPFLLMIFVYPIHSIVW---LIESSSRY 456

Query: 422 PLATFTSLILLWFFIGVPLSITGSLMARK-TCHWD--------IHPTKTNTVSKVIPPQ- 471
           P  T T +I  ++ I VP SI G  +A+K   H+          +    N   K    Q 
Sbjct: 457 PFKTLTMMISFFYIICVPFSIIGGGLAKKYRKHYKEMFGNITLDNENNDNDEKKRFKAQH 516

Query: 472 ------KWYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFN 506
                 K  L T+  SLI  +  F  +  ELY+++T+ W N
Sbjct: 517 RPSSINKNKLGTLVYSLITAIVPFFIIKSELYWIFTNKWLN 557

>TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7.411
           YER113C
          Length = 733

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 85/233 (36%), Gaps = 46/233 (19%)

Query: 27  YYEKLHFCKPEHVEKA-GVSIGSVLFGDRLYNSPFQLNMLKNKTCERLCNSTIIGRDAKF 85
           Y++  + C P + +K+   S+  +  GD    S + L    +  C+ LC         + 
Sbjct: 82  YHDLPYICPPTNTKKSIHNSLKELFNGDYNEQSDYILKFGVDNDCQALCLRKTYNAGIRK 141

Query: 86  INKLIKNGYYQNWLIDG-LPAAREVYDTRTKSNFYGNGFELGLVEIRQTTGEKLLPNSAD 144
             ++I   Y  NW ID  LPAA     + T+   Y  GF LG  +          P +  
Sbjct: 142 AKEMIDEDYIVNWFIDDYLPAATTYISSVTRKKKYFEGFSLGWKD----------PETGS 191

Query: 145 TFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSP 204
                                   Y  NH  + I Y+   ++ + +VG  V P SI   P
Sbjct: 192 Y-----------------------YINNHVMLVIRYNAVDDNKFNIVGFEVYPKSI---P 225

Query: 205 DGGCKPTGKALSLSE-------SEVNYIHFTYSVEFIPS-ETAWVTRWDKYLH 249
           D  C    +     E        E + I F+YSV +    E  W TRW  ++ 
Sbjct: 226 DLQCPGARRGHGHYELKDLENNDEFSLIPFSYSVYWREEFEYDWRTRWSLFVR 278

>Kpol_538.39 s538 complement(83542..85722) [2181 bp, 726 aa] {ON}
           complement(83542..85722) [2181 nt, 727 aa]
          Length = 726

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 38/80 (47%), Gaps = 5/80 (6%)

Query: 119 YGNGFELGLVEIRQTTGEKL-LPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIR 177
           +GN F  G++ +R+T  + + +P +  TF    KRD K+    + + +EV    + F   
Sbjct: 455 HGNRF--GVIAVRETGDDNIAIPKNVATFFAPEKRDVKDKSTGVKKWLEVASITDKFSNT 512

Query: 178 IEYHDRGNDNYRVVGVTVNP 197
           I +   G   Y VV   V P
Sbjct: 513 ISWSPAG--RYVVVATLVKP 530

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,602,169
Number of extensions: 2578613
Number of successful extensions: 8118
Number of sequences better than 10.0: 52
Number of HSP's gapped: 8128
Number of HSP's successfully gapped: 82
Length of query: 619
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 503
Effective length of database: 40,180,143
Effective search space: 20210611929
Effective search space used: 20210611929
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)