Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0J014108.255ON71671635580.0
NCAS0B038808.255ON70668924000.0
YDR108W (TRS85)8.255ON69869623210.0
Suva_2.2688.255ON69569923190.0
Smik_4.3548.255ON69870122910.0
Skud_4.3698.255ON69869622800.0
ZYRO0C01826g8.255ON69971121770.0
Kpol_392.118.255ON67569621280.0
TDEL0F038208.255ON68769021290.0
CAGL0B01705g8.255ON67269520440.0
KAFR0B055708.255ON66970019940.0
TPHA0B032608.255ON71473319780.0
KLTH0G13860g8.255ON70872817770.0
Kwal_56.235838.255ON70074017530.0
SAKL0H17226g8.255ON71975217400.0
KNAG0H032708.255ON64872216300.0
TBLA0E043808.255ON88963614860.0
Ecym_43168.255ON62370713141e-173
AGR096C8.255ON62369312611e-165
KLLA0F18953g8.255ON64769011971e-155
Kwal_55.219923.42ON20776741.4
ZYRO0A07370g2.345ON82977761.6
ZYRO0F07832g2.330ON67497752.1
TBLA0D047601.418ON38244707.0
KAFR0A063804.173ON1877119717.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0J01410
         (716 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {...  1375   0.0  
NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {O...   929   0.0  
YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subun...   898   0.0  
Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W ...   897   0.0  
Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W ...   887   0.0  
Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W ...   882   0.0  
ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {...   843   0.0  
Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}...   824   0.0  
TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.2...   824   0.0  
CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly...   791   0.0  
KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa] ...   772   0.0  
TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {O...   766   0.0  
KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]...   689   0.0  
Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108...   679   0.0  
SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]...   674   0.0  
KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {O...   632   0.0  
TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON} Anc_8...   577   0.0  
Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}...   510   e-173
AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON} S...   490   e-165
KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} simi...   465   e-155
Kwal_55.21992 s55 complement(1067753..1068376) [624 bp, 207 aa] ...    33   1.4  
ZYRO0A07370g Chr1 (601469..603958) [2490 bp, 829 aa] {ON} simila...    34   1.6  
ZYRO0F07832g Chr6 (633692..635716) [2025 bp, 674 aa] {ON} simila...    33   2.1  
TBLA0D04760 Chr4 complement(1174113..1175261) [1149 bp, 382 aa] ...    32   7.0  
KAFR0A06380 Chr1 complement(1288673..1294306) [5634 bp, 1877 aa]...    32   7.4  

>NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {ON}
           Anc_8.255 YDR108W
          Length = 716

 Score = 1375 bits (3558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 679/716 (94%), Positives = 679/716 (94%)

Query: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60
           MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL
Sbjct: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60

Query: 61  YMLLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRSR 120
           YMLLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRSR
Sbjct: 61  YMLLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRSR 120

Query: 121 SNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNSTP 180
           SNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNSTP
Sbjct: 121 SNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNSTP 180

Query: 181 YELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNL 240
           YELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNL
Sbjct: 181 YELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNL 240

Query: 241 NTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQY 300
           NTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQY
Sbjct: 241 NTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQY 300

Query: 301 EIDIKVDLHQPIMSSLEEMIYFLQTPFSAKXXXXXXXXXXXXXXXXXYDLMLPFMKRKLL 360
           EIDIKVDLHQPIMSSLEEMIYFLQTPFSAK                 YDLMLPFMKRKLL
Sbjct: 301 EIDIKVDLHQPIMSSLEEMIYFLQTPFSAKLSISLINSIYNILDSLIYDLMLPFMKRKLL 360

Query: 361 FWEETILQPRRSLFHGAKFLKKFMTKNNNGPQENILTKDSEGNEYFAFSSTELLMRKLAD 420
           FWEETILQPRRSLFHGAKFLKKFMTKNNNGPQENILTKDSEGNEYFAFSSTELLMRKLAD
Sbjct: 361 FWEETILQPRRSLFHGAKFLKKFMTKNNNGPQENILTKDSEGNEYFAFSSTELLMRKLAD 420

Query: 421 WSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKNDINPL 480
           WSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKNDINPL
Sbjct: 421 WSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKNDINPL 480

Query: 481 IERALQTYENCAITLIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWTSTPYA 540
           IERALQTYENCAITLIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWTSTPYA
Sbjct: 481 IERALQTYENCAITLIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWTSTPYA 540

Query: 541 ITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINXXXXXXXXXXXXXXXXXX 600
           ITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKIN                  
Sbjct: 541 ITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINDTATTTTTVTTTTADKVV 600

Query: 601 XXPSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQVAW 660
             PSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQVAW
Sbjct: 601 ATPSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQVAW 660

Query: 661 CLKDMESIYDATDLGKRDDLIVAKLRNLLDENIGGDDGNFKLKDEKLSADHIEVSS 716
           CLKDMESIYDATDLGKRDDLIVAKLRNLLDENIGGDDGNFKLKDEKLSADHIEVSS
Sbjct: 661 CLKDMESIYDATDLGKRDDLIVAKLRNLLDENIGGDDGNFKLKDEKLSADHIEVSS 716

>NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {ON}
           Anc_8.255 YDR108W
          Length = 706

 Score =  929 bits (2400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/689 (66%), Positives = 542/689 (78%), Gaps = 10/689 (1%)

Query: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60
           M FSYEHYMNLLFHLD+ KE+VP EIAKRIVSNAI+PVI VTST +LD+HI ETYNIDSL
Sbjct: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60

Query: 61  YMLLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRSR 120
           YMLLR+F GCVSDRDQANEL   Q+  ++     SN  ++L +P+    P ++ R GRSR
Sbjct: 61  YMLLRFFSGCVSDRDQANELEKSQKDKIS-----SN--NTLTLPTTSPLPKVRTR-GRSR 112

Query: 121 SNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNSTP 180
           SNSLFQRDSTQSQYIRFTKP+ D++A K++NDMLFDYHSLEIYL+ YL LI  NT+++TP
Sbjct: 113 SNSLFQRDSTQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTP 172

Query: 181 YELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNL 240
           YELLK SIYH+FFSLAISSTT LSPYE FNHP+VSLIAVDIS+GQ YDD+RDLLV+FKNL
Sbjct: 173 YELLKKSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNL 232

Query: 241 NTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQY 300
           N++T NFPIFMNTNDMLP+ LLCYD  + EQFE CQ+LTK++KKQLFVE + LPLW + Y
Sbjct: 233 NSSTHNFPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSY 292

Query: 301 EIDIKVDLHQPIMSSLEEMIYFLQTPFSAKXXXXXXXXXXXXXXXXXYDLMLPFMKRKLL 360
             D +V LHQP+MSSLEEMIYFL  P                     Y+LM+PFMKRK+ 
Sbjct: 293 PSDPQVHLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIA 352

Query: 361 FWEETILQPRRSLFHGAKFLKKFMTKNNNGPQENILTKDSEGNEYFAFSSTELLMRKLAD 420
           FW+ETILQPR+SLFHGAKFLKKFMTK     QEN+LTKD++GNEYF  +S+E LMRKLAD
Sbjct: 353 FWDETILQPRKSLFHGAKFLKKFMTKTALTHQENLLTKDAQGNEYFTSASSEFLMRKLAD 412

Query: 421 WSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKNDINPL 480
           WSMM+SDFKTAY+TYESL+ DL++FPKY ASCLEWCA SLLMGAQ+IVTVKM+KNDINPL
Sbjct: 413 WSMMLSDFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPL 472

Query: 481 IERALQTYENCAITLIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWTSTPYA 540
           IE+AL TYENCA T++ +T  +   E  V P+RSYETRCMIL SELFLSLSDTWTSTPYA
Sbjct: 473 IEKALSTYENCA-TVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPYA 531

Query: 541 ITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINXXXXXXXXXXXXXXXXXX 600
           I+YLETIL ECKLG CSQI IWERLSDCY+LR+DPRI++K                    
Sbjct: 532 ISYLETILVECKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDMQ 591

Query: 601 XXPSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQVAW 660
               T  P T +  S+ ++   + ++I+SKGFTR+RK+AFFRL+AAKKWAEQK+WRQV+W
Sbjct: 592 GHVMTPSPLTKEDVSN-DANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSW 650

Query: 661 CLKDMESIYDATDLGKRDDLIVAKLRNLL 689
           CL+ ++  Y    L  RDDLI+ K++N L
Sbjct: 651 CLQSIDDTYSKIGLADRDDLILKKIQNKL 679

>YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subunit
           of TRAPPIII (transport protein particle), a multimeric
           guanine nucleotide-exchange factor for Ypt1p, required
           for membrane expansion during autophagy and the CVT
           pathway; directs Ypt1p to the PAS; late post-replication
           meiotic role
          Length = 698

 Score =  898 bits (2321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/696 (63%), Positives = 528/696 (75%), Gaps = 28/696 (4%)

Query: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60
           MVFSYEHYMNLLFHLD++KE+VPPEIAKRI+SNAIAPVITVTSTP  D HIQETY +DSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60

Query: 61  YMLLRYFGGCVSDRDQANEL-VGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRS 119
           YMLLR+FGGCVSDRDQANE  VG+ E +V    + S+   S+      + P L  +  RS
Sbjct: 61  YMLLRFFGGCVSDRDQANEAKVGQHEHEVC---DASDSTDSIPKNKNLEVPNLSKKGSRS 117

Query: 120 RSNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNST 179
           RSNSLFQRDSTQSQYIRFT+P+ D++  + +NDMLF+YHSLE++L+ YL+L+A NT+   
Sbjct: 118 RSNSLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMV 177

Query: 180 PYELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKN 239
           P+ LLK SIYH+FFSLAISST  LSPYETFNHPI+SLIA+DIS G+ Y+D RDLLV FKN
Sbjct: 178 PHNLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKN 237

Query: 240 LNTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQ 299
           LN  T NFPIFMNTN+MLP+FLLCY+ + QE+FE CQ+L K+LKKQLFVES++L LW + 
Sbjct: 238 LNHNTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCQALAKKLKKQLFVESILLALWKDS 297

Query: 300 --YEIDIKVDLHQPIMSSLEEMIYFLQTPFSAKXXXXXXXXXXXXXXXXXYDLMLPFMKR 357
             Y+ +  + LHQP+MSSLEE+++FLQ P                     YDLM+PFMKR
Sbjct: 298 FIYDENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKR 357

Query: 358 KLLFWEETILQPRRSLFHGAKFLKKFMTKN--NNGPQENILTKDSEGNEYFAFSSTELLM 415
           K+ FWEETILQPR+SLF+GAKF KKFM KN  N   Q N LT+DS+GNEYFA SS+E LM
Sbjct: 358 KVSFWEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLM 417

Query: 416 RKLADWSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKN 475
           RKLADWSMM+SDFKTAYSTYESL  DLD FPKYLASC+EWCA SLLMGAQSIVTVKMIKN
Sbjct: 418 RKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKN 477

Query: 476 DINPLIERALQTYENCAITLIQDTTNKVFAEQSV-EPLRSYETRCMILLSELFLSLSDTW 534
           DINPLIERAL TYENC  + IQ    K      V EP+RSYETRCMIL SELFLSLS+TW
Sbjct: 478 DINPLIERALATYENC--SRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTW 535

Query: 535 TSTPYAITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINXXXXXXXXXXXX 594
           TSTPYAI YLETIL ECKLGPCSQI +WERLSDCY LR+DPRI++++             
Sbjct: 536 TSTPYAIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAMKK-------- 587

Query: 595 XXXXXXXXPSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQ 654
                         + ++ E    +   + ++ILS+G TRRRK+AFFRLIAAKKWAEQKQ
Sbjct: 588 ---------DAKDTEDLRGEHKYSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQ 638

Query: 655 WRQVAWCLKDMESIYDATDLGKRDDLIVAKLRNLLD 690
           WRQV+WCLKD+ES Y        + LI++KL+N L+
Sbjct: 639 WRQVSWCLKDIESTYSEIKFLHGNGLILSKLKNQLN 674

>Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W
           (REAL)
          Length = 695

 Score =  897 bits (2319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/699 (63%), Positives = 538/699 (76%), Gaps = 37/699 (5%)

Query: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60
           MVFSYEHYMNLLFHLDH++E+VPPEIAKRIVSNAIAPVITVTSTP  D HIQE Y++DSL
Sbjct: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60

Query: 61  YMLLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSS----LIVPSGQQQPPLKARR 116
           YMLLR+FGGCVSDRDQANE  GK E D  + + PS   SS    L VPS  +      R 
Sbjct: 61  YMLLRFFGGCVSDRDQANE--GKFEQDEQNAS-PSIESSSKNQNLGVPSALK------RG 111

Query: 117 GRSRSNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTN 176
            RSRSNSLFQRDSTQSQY+RFT+P+ D++  + +NDMLF+YHSLE++L+ YL+L+A NT+
Sbjct: 112 SRSRSNSLFQRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTD 171

Query: 177 NSTPYELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVE 236
              P++LLK SIYH+FFSLAISST  LSPYETFNHPI+SLIA+DIS G+ Y+D RDLLV 
Sbjct: 172 EKVPHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVN 231

Query: 237 FKNLNTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLW 296
           FKNLN  T +FPIFMNTN+MLP+FLLCY+   QE+FE CQ+L K+LKKQLFVES++LPLW
Sbjct: 232 FKNLNHNTESFPIFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESILLPLW 291

Query: 297 NEQYEIDIK---VDLHQPIMSSLEEMIYFLQTPFSAKXXXXXXXXXXXXXXXXXYDLMLP 353
            + + +D++   + LHQP+MSSLEE+++FL+ P   K                 YDLM+P
Sbjct: 292 KDSF-VDVENSNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIP 350

Query: 354 FMKRKLLFWEETILQPRRSLFHGAKFLKKFMTKN--NNGPQENILTKDSEGNEYFAFSST 411
           FMKRK+ FWEETILQPR+SLF+GAKF KKFM K   N   Q N LTKD++GNEYFA SS+
Sbjct: 351 FMKRKISFWEETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSS 410

Query: 412 ELLMRKLADWSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVK 471
           E LMRKLADWSMM+SDFKTAYSTYESL  DLD FPKYLASC+EWCA SLLMGAQSIVTVK
Sbjct: 411 EFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVK 470

Query: 472 MIKNDINPLIERALQTYENCAITLIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLS 531
           MIKNDINPLIERAL TYENC+  + +  + ++ +   +EP+RSYETRCMIL SELFLSLS
Sbjct: 471 MIKNDINPLIERALATYENCS-RMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLS 529

Query: 532 DTWTSTPYAITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINXXXXXXXXX 591
           DTWTSTPYAI YLETIL ECKLGPCSQI +WERLSDCY LR+DPR+++K+          
Sbjct: 530 DTWTSTPYAIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKK----- 584

Query: 592 XXXXXXXXXXXPSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAE 651
                       S    + ++ + + ++   + ++ILS+G TRRRK+AFFRL+AAKKWAE
Sbjct: 585 ------------SVKNTEDLRNDDEYDTDHFTEEDILSEGLTRRRKAAFFRLMAAKKWAE 632

Query: 652 QKQWRQVAWCLKDMESIYDATDLGKRDDLIVAKLRNLLD 690
           QKQWRQV+WCLKD+E+ Y   D    + LI++ L+N L+
Sbjct: 633 QKQWRQVSWCLKDIENTYSDIDFLHGNGLILSNLKNQLN 671

>Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  887 bits (2291), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/701 (63%), Positives = 525/701 (74%), Gaps = 38/701 (5%)

Query: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60
           MVFSYEHYMNLLFHLD++KE+VPPEIAKRIVSNAIAPVITVTSTP  D HIQE Y +DSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60

Query: 61  YMLLRYFGGCVSDRDQANEL-VGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRS 119
           YMLLR+FGGCVSDRDQANE+ VG+ E  V   TN S  + S       + P L  +  RS
Sbjct: 61  YMLLRFFGGCVSDRDQANEVKVGQDEHQVGD-TNAS--MESFSKSKNLEVPNLPKKGSRS 117

Query: 120 RSNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNST 179
           RSNSLFQRDSTQSQYIRFT+P+DD++  + +NDMLF+YHSLE++L+ YL+L+A NT+   
Sbjct: 118 RSNSLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMV 177

Query: 180 PYELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKN 239
           P++LLK SIYH+FFSLAISST  LSPYETFNHPI+SLIA+DIS G+ Y+D RDLLV FKN
Sbjct: 178 PHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKN 237

Query: 240 LNTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQ 299
           LN  T NFP+FMNTN+MLP+FLLCY+   QE+FE CQ+L K+LKKQLFVES++L LW + 
Sbjct: 238 LNHNTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESVLLSLWKDS 297

Query: 300 Y--EIDIKVDLHQPIMSSLEEMIYFLQTPFSAKXXXXXXXXXXXXXXXXXYDLMLPFMKR 357
           +    +  + LHQP+MSSLEE+++FLQ P                     YDLM+PFMKR
Sbjct: 298 FIEANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKR 357

Query: 358 KLLFWEETILQPRRSLFHGAKFLKKFMTKN--NNGPQENILTKDSEGNEYFAFSSTELLM 415
           K+ FWEETILQPR+SLF+GAKF KKFM KN  N     N LT D++GNEYFA SS+E LM
Sbjct: 358 KVSFWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLM 417

Query: 416 RKLADWSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKN 475
           RKLADWSMM+SDFKTAYSTYESL  DLD FPKYLASC+EWCA SLLMGAQ IVTVKMIKN
Sbjct: 418 RKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKN 477

Query: 476 DINPLIERALQTYENCAITLIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWT 535
           DINPLIE+AL TYENC+  + +  + K  +  +VEP+RSYETRCMIL SELFLSLSD WT
Sbjct: 478 DINPLIEKALATYENCS-KIQRSKSEKSSSSNTVEPVRSYETRCMILASELFLSLSDKWT 536

Query: 536 STPYAITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINXXXXXXXXXXXXX 595
           STPYAI YLETIL ECKLGPC QI IWERLSDCY LR+DPRI++++              
Sbjct: 537 STPYAIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGAMK---------- 586

Query: 596 XXXXXXXPSTDKPKTIQWESDLESKLGSG------KNILSKGFTRRRKSAFFRLIAAKKW 649
                        K I+   DL    G+        +ILS+G TR+RK+AFFRLIAA+KW
Sbjct: 587 -------------KGIRDTEDLRGGDGNSTDHFTDDDILSEGLTRKRKAAFFRLIAARKW 633

Query: 650 AEQKQWRQVAWCLKDMESIYDATDLGKRDDLIVAKLRNLLD 690
           AEQKQWRQV+WCLKD+ESIY        D LI++KL N L+
Sbjct: 634 AEQKQWRQVSWCLKDIESIYSDIKFLNGDGLILSKLHNQLN 674

>Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  882 bits (2280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/696 (63%), Positives = 526/696 (75%), Gaps = 28/696 (4%)

Query: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60
           MVFSYEHYMNLLFHLD+++E VPPEIAKRIVSNAIAPVITVTSTP  D HIQETYN+DSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60

Query: 61  YMLLRYFGGCVSDRDQANE-LVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRS 119
           YMLLR+FGGCVSDRDQANE  VG  E +V+   + S  + SL        P    +  RS
Sbjct: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHEVS---DTSVSMESLSKNQNLGVPNALKKGSRS 117

Query: 120 RSNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNST 179
           RSNSLFQRDSTQSQYIRFT+P+ D++  + +NDMLF+YHSLE+YL+ YL+L+  NTN + 
Sbjct: 118 RSNSLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETA 177

Query: 180 PYELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKN 239
           P++LLK SIYH+FFSLAISST  LSPYETFNHPI+SLIA+DIS G+ Y+D RDLLV FKN
Sbjct: 178 PHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKN 237

Query: 240 LNTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQ 299
           LN  T NFPIFMNTN+MLP+FL+CY+   QE+FE CQ+L K+LKKQLFVES+ LPLW E 
Sbjct: 238 LNHNTENFPIFMNTNEMLPVFLICYNDESQEEFEKCQALAKKLKKQLFVESIFLPLWKES 297

Query: 300 Y--EIDIKVDLHQPIMSSLEEMIYFLQTPFSAKXXXXXXXXXXXXXXXXXYDLMLPFMKR 357
           +  + +  + LHQP+MSSLEE+++FLQ P                     YDLM+PFMKR
Sbjct: 298 FIDDENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKR 357

Query: 358 KLLFWEETILQPRRSLFHGAKFLKKFMTKN--NNGPQENILTKDSEGNEYFAFSSTELLM 415
           K+ FWEETILQPR+SLF+GAKF KKFM KN  N   Q N LT+D +GNEYF+ SS+E LM
Sbjct: 358 KVSFWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLM 417

Query: 416 RKLADWSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKN 475
           RKLADWSMM+SDFKTAYSTYESL  DLD FPKYLASC+EWCA SLLMGAQSIVTVKMIKN
Sbjct: 418 RKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKN 477

Query: 476 DINPLIERALQTYENCAITLIQDTTNKVFAEQSV-EPLRSYETRCMILLSELFLSLSDTW 534
           DINPLIERAL TYE C+   IQ    K  +  SV EP+RSYETRCMIL SELFLSLSDTW
Sbjct: 478 DINPLIERALATYEKCS--QIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTW 535

Query: 535 TSTPYAITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINXXXXXXXXXXXX 594
           TSTPYAI YLETIL ECKLGPCSQI IWERLSDCY LR+DPRI++++             
Sbjct: 536 TSTPYAIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVGVMKK-------- 587

Query: 595 XXXXXXXXPSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQ 654
                    S  + + ++   +  +     ++ILS+G TRRRK+AFFRLIAAKKWAEQK 
Sbjct: 588 ---------SFKETEDLRNGDEHYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKH 638

Query: 655 WRQVAWCLKDMESIYDATDLGKRDDLIVAKLRNLLD 690
           WRQV+WCLKD+ES Y        +D I++KL++ L+
Sbjct: 639 WRQVSWCLKDIESTYSEIKFLHCNDSILSKLKSQLN 674

>ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {ON}
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 699

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/711 (59%), Positives = 514/711 (72%), Gaps = 50/711 (7%)

Query: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60
           M  SYE+YMNLLFHLDH +E+VPP+IA+RIVSNA++PVITV+STP+LD HI++TY++DSL
Sbjct: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60

Query: 61  YMLLRYFGGCVSDRDQANE---LVGKQELDVTH--PTNPSNPV-----SSLIVPSGQQQP 110
           YM LR+FG CVSDRDQANE   L  K+E ++    P+   N +     SSL VPS     
Sbjct: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPSTSSDT 120

Query: 111 PLKARRG-------RSRSNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIY 163
                         R RSNSLFQRD TQSQY+RFT+PIDD++    SNDMLFDYHSLE++
Sbjct: 121 KNTTTSTSGTTGGTRKRSNSLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180

Query: 164 LEQYLQLIATNTNNSTPYELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISM 223
           LE  L+L+   T+++TP+ELLK S+YH FFSLAISSTT LSPYETFNHP+VSLIA+DIS 
Sbjct: 181 LENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISA 240

Query: 224 GQTYDDIRDLLVEFKNLNTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLK 283
           GQ Y++ RDLL++FKNLN T  NFPIFM+T D+LP+FLLCY+   +++   CQ L  +LK
Sbjct: 241 GQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLK 300

Query: 284 KQLFVESLILPLWNEQYEIDIKVDLHQPIMSSLEEMIYFLQTPFSAKXXXXXXXXXXXXX 343
           KQLFVESL+LPLW   Y    +V+LHQPIMSSLEEM+YFLQ+P   +             
Sbjct: 301 KQLFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYNIL 360

Query: 344 XXXXYDLMLPFMKRKLLFWEETILQPRRSLFHGAKFLKKFMTKNNNGP---QENILTKDS 400
                DLM+PFMKRK+ FWEETILQPR+SLFHGA F KK M+KN+NG    Q   L KD 
Sbjct: 361 EKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGKDK 420

Query: 401 EGNEYFAFSSTELLMRKLADWSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSL 460
            GNEYF  SSTE LMRKLADWSMM+SDFKTAYSTYESL  DL+ FPKYLASC EWCA S+
Sbjct: 421 NGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVSV 480

Query: 461 LMGAQSIVTVKMIKNDINPLIERALQTYENCAITLIQDTTNKVFAEQSVEPLRSYETRCM 520
           LMGAQ+IVTVKMIKNDI+PLI+RAL+TYENCA    +D+T     E+   P+RSYETRCM
Sbjct: 481 LMGAQNIVTVKMIKNDIDPLIQRALETYENCAAD--EDST----GEELYVPVRSYETRCM 534

Query: 521 ILLSELFLSLSDTWTSTPYAITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYK 580
            L SELFLSLSDTWTSTPYA+  LETILTEC+LGPCS+I IWERLSDCY  RIDPRIR+K
Sbjct: 535 FLASELFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIRHK 594

Query: 581 INXXXXXXXXXXXXXXXXXXXXPSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAF 640
            +                        K  T +   D E    S + I+++G TR+RK+AF
Sbjct: 595 TSAQGA--------------------KAMTDELAPDEE----SNEEIVTRGLTRKRKAAF 630

Query: 641 FRLIAAKKWAEQKQWRQVAWCLKDMESIYDATDLGKRDDLIVAKLRNLLDE 691
           FRLIAA KW EQKQW+Q  WCLK++E  Y   D   R+DLI+A+L+  ++E
Sbjct: 631 FRLIAANKWVEQKQWKQAFWCLKEIEEAYAGLDFVNREDLILARLKRQMNE 681

>Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}
           complement(30871..32898) [2028 nt, 676 aa]
          Length = 675

 Score =  824 bits (2128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/696 (58%), Positives = 503/696 (72%), Gaps = 31/696 (4%)

Query: 3   FSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSLYM 62
           FSYE+YMNL++HLD   E VP +I+KRIVSNAIAPVITV ST +LD H+Q++YNIDSLY+
Sbjct: 6   FSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSLYL 65

Query: 63  LLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRSRSN 122
           L+RYFGGC+SDRDQANE V K  ++ T     ++ +      S   + P   R  RSRSN
Sbjct: 66  LMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYSRSRSN 125

Query: 123 SLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNSTPYE 182
           SLFQRDSTQS YIRFTKPI+D++  + S+DMLFDYHSLE+YLE+ L LI  NTN+ T ++
Sbjct: 126 SLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETDHK 185

Query: 183 LLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNLNT 242
            LK S++H FFS AISSTT LSPYE+FNHP++SL+A+DIS GQ Y+D RDLL++FKN N 
Sbjct: 186 ALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQNN 245

Query: 243 TTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQYEI 302
               FP FM+TND+L +FLLCYD + +EQ EICQ + K+LKKQLF ESL+LPLWN+ +  
Sbjct: 246 AVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSHSE 305

Query: 303 DIKVDLHQPIMSSLEEMIYFLQTPFSAKXXXXXXXXXXXXXXXXXYDLMLPFMKRKLLFW 362
           D++V+LHQP MSSL+EM+YF + P   +                  DLM+PFM+RK+ FW
Sbjct: 306 DVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKISFW 365

Query: 363 EETILQPRRSLFHGAKFLKKFMTKNNN--GPQENILTKDSEGNEYFAFSSTELLMRKLAD 420
           EETILQPR+SLFHG K  +KFM ++++    Q N + KDS GNEYF  SS E L+RKLAD
Sbjct: 366 EETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLRKLAD 425

Query: 421 WSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKNDINPL 480
           WSMMISDFKTAYSTYE+L  DL+  PKYLASCLEWCA S+LMGAQ+IVT KMIKND+NPL
Sbjct: 426 WSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDVNPL 485

Query: 481 IERALQTYENCAITLIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWTSTPYA 540
           IER+L TYE C+I       N    E   EP+RSYETRCM+L SELFLSL+DTWTSTPYA
Sbjct: 486 IERSLDTYEQCSILAQNSLEND---ELLSEPVRSYETRCMLLTSELFLSLNDTWTSTPYA 542

Query: 541 ITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINXXXXXXXXXXXXXXXXXX 600
           ++ LETIL ECKLG CSQI IWERLSDCY +R DPRIR+++                   
Sbjct: 543 LSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRVET----------------- 585

Query: 601 XXPSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQVAW 660
                      + E++   +     +I+SKG  R+RK+AFFRL+AAKKWAEQKQWRQV+W
Sbjct: 586 ---------VTKIENNEGGQQLQTDDIVSKGLARKRKAAFFRLLAAKKWAEQKQWRQVSW 636

Query: 661 CLKDMESIYDATDLGKRDDLIVAKLRNLLDENIGGD 696
           CL+D+E IYD     KR +LI  KL++ L+E   G+
Sbjct: 637 CLRDVEYIYDDLSFSKRPELIYQKLKDELNEERQGN 672

>TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.255
           YDR108W
          Length = 687

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/690 (58%), Positives = 504/690 (73%), Gaps = 35/690 (5%)

Query: 3   FSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSLYM 62
            SYE+YMNLL HLDH  + VP +IAKRIVSNAI+PVI VTSTP+LD HIQET+++DSLYM
Sbjct: 4   LSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSLYM 63

Query: 63  LLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRSRSN 122
           LLR+FG CV DRDQA+E               S+  S+L V SG           R RSN
Sbjct: 64  LLRFFGDCVGDRDQAHECTSAGSPSGDDRAEKSSS-STLAVASGP---------SRKRSN 113

Query: 123 SLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNSTPYE 182
           SLFQRD+TQSQYIRFT+P+ D+V    +NDMLFDYH+LE +LE  L LI  +TN+ TP++
Sbjct: 114 SLFQRDATQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHK 173

Query: 183 LLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNLNT 242
           LLK S+YH FFSLAISST  LSPYETFNHP+VSLIA+DI +GQ Y++ RDLL +FKNLN 
Sbjct: 174 LLKKSLYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNH 233

Query: 243 TTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQYEI 302
           TT NFP+F+NTND+LP+FLLCY+ + +EQ+EICQSLTK+LKKQLFVE ++LPLW + Y+ 
Sbjct: 234 TTKNFPVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKT 293

Query: 303 DIKVDLHQPIMSSLEEMIYFLQTPFSAKXXXXXXXXXXXXXXXXXYDLMLPFMKRKLLFW 362
             +V LHQPIM+SL+E++YFL+ P   +                   LM+PFM+RK+ FW
Sbjct: 294 ATQVILHQPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFW 353

Query: 363 EETILQPRRSLFHGAKFLKKFMTKNNNGP---QENILTKDSEGNEYFAFSSTELLMRKLA 419
           EETILQPRRSLFHG+KFLK+FM+K  +G    Q+  + KD+ G EYF  SS E LMRKLA
Sbjct: 354 EETILQPRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLA 413

Query: 420 DWSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKNDINP 479
           DWSMM+SD+KTAYSTY+SLS DL+ +PKYLASCLEWC+ S+LMGAQ+IVT KM+K DI+P
Sbjct: 414 DWSMMLSDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDP 473

Query: 480 LIERALQTYENCAITLIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWTSTPY 539
           LI+RA++TYENCA+   Q + +K     S+ P+RSYETRCM L SELFLSLSDTWTSTPY
Sbjct: 474 LIQRAVETYENCALYDTQLSGSK--KSNSMAPVRSYETRCMFLASELFLSLSDTWTSTPY 531

Query: 540 AITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINXXXXXXXXXXXXXXXXX 599
           A+  LETIL EC+LGPCSQI IWERLS+CY+ RID RIR+K+N                 
Sbjct: 532 ALRNLETILAECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVN----------------- 574

Query: 600 XXXPSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQVA 659
               +    + ++ E D E K  +  +I+++G TR RK+AFF+LIAA KWAEQKQWRQ +
Sbjct: 575 --DGAMSNEEKVENEDDSE-KEHTHADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQAS 631

Query: 660 WCLKDMESIYDATDLGKRDDLIVAKLRNLL 689
           WCLKD E  Y   +   R DL +AKL+  L
Sbjct: 632 WCLKDTEDAYAGIEFVNRKDLALAKLKETL 661

>CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108w GSG1
          Length = 672

 Score =  791 bits (2044), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/695 (56%), Positives = 497/695 (71%), Gaps = 36/695 (5%)

Query: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60
           MVFSYEHYMNL++HLD A E+VP +IAKR+VSNA+APVITVTST  LD HI+ETY IDSL
Sbjct: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60

Query: 61  YMLLRYFGGCVSDRDQANEL-VGKQELDVTHPT--NPSNPVSSLIVPSGQQQPPLKARRG 117
           YMLLR+FGGCVSDRDQANE+ +G   L VT     N  +  + L VP        +  R 
Sbjct: 61  YMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVP--------RQTRV 112

Query: 118 RSRSNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNN 177
           RS SNSL+QRD+TQSQY+RFTKP+ D++  + +NDMLFDYHSLE+YL++YL ++    + 
Sbjct: 113 RSNSNSLYQRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSP 172

Query: 178 STPYELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEF 237
             P+ LLK SIYH+FF+LAISST++LSP+E FNHPIVSL+A+DI+  + Y+   + L EF
Sbjct: 173 HIPHHLLKTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEF 232

Query: 238 KNLNTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWN 297
           K++N   P+FP F+NTND+LP+FLLCY+ + + +FE CQ+L  +LKKQLFVES+ILPLW+
Sbjct: 233 KSMNNNIPSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWS 292

Query: 298 EQYEIDIKVDLHQPIMSSLEEMIYFLQTPFSAKXXXXXXXXXXXXXXXXXYDLMLPFMKR 357
            ++  ++ V LHQP+MSS+EE+++FLQ P   K                 YDLM PFMKR
Sbjct: 293 TEFTDNLVVSLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKR 352

Query: 358 KLLFWEETILQPRRSLFHGAKFLKKFMTKNNNG-PQENILTKDSEGNEYFAFSSTELLMR 416
           K+ FWEETIL PR+SLFHGAKF KKFM K+     Q N L K++ G+ Y + +S E LMR
Sbjct: 353 KMTFWEETILTPRKSLFHGAKFFKKFMNKSTQALSQPNSLLKENHGSNYLSSTSPEFLMR 412

Query: 417 KLADWSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKND 476
           KLADWSMM+SDFKTAY+TYESL +D +  PKYLASC EWCA SLLMGAQ+IVT KM+KN+
Sbjct: 413 KLADWSMMVSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNE 472

Query: 477 INPLIERALQTYENCAITLIQDTTNKVFAEQS--VEPLRSYETRCMILLSELFLSLSDTW 534
           INP IERAL  YE CA    +   ++ F +      P+RSYETRCM L SELFLSLSDTW
Sbjct: 473 INPAIERALGAYELCA---TESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTW 529

Query: 535 TSTPYAITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINXXXXXXXXXXXX 594
           TSTP+AI YLETIL ECKLGP S+I IWERLSDCY +RIDPRI+++I             
Sbjct: 530 TSTPFAIAYLETILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELLQKKEE-- 587

Query: 595 XXXXXXXXPSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQ 654
                    + D PK         + + + ++ILSKG TR RK+A F+LIAA+KW EQKQ
Sbjct: 588 ---------NMDDPKN--------ADVFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQ 630

Query: 655 WRQVAWCLKDMESIYDATDLGKRDDLIVAKLRNLL 689
           WR+++WCL D+ES Y       +++L+  +LRN L
Sbjct: 631 WRELSWCLDDLESTYSDLKCFNKENLLYTRLRNEL 665

>KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa]
           {ON} Anc_8.255 YDR108W
          Length = 669

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/700 (57%), Positives = 504/700 (72%), Gaps = 39/700 (5%)

Query: 3   FSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSLYM 62
           FSYEHYMNLLFHL+ + E++P EIA+RIVS+AIAPVITVTSTP+LD HIQ+TY+IDSLYM
Sbjct: 4   FSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSLYM 63

Query: 63  LLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRSRSN 122
           LLR+FGGCVSDRDQA+E     + +  H              S       K  R RSRSN
Sbjct: 64  LLRFFGGCVSDRDQASE----SKANAPH--------------SSSSLTTTKTTRARSRSN 105

Query: 123 SLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNSTPYE 182
           SLFQRDSTQSQYIRFT+P+ D+V     NDMLFD+HSLE YL QYL+L+   T +ST ++
Sbjct: 106 SLFQRDSTQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQ 165

Query: 183 LLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNLNT 242
           LLK S+YHNFFSLAISSTT LSP+E+FNHPI+SLIA+DI+  Q+Y+D + LL++FKNL+ 
Sbjct: 166 LLKKSLYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHN 225

Query: 243 TTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQYEI 302
           T   FPI++NT DMLP+FLLCY+A+  E+ + C+ L+ ++KKQLFVES+ LPLW   Y+ 
Sbjct: 226 TIDKFPIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQT 285

Query: 303 DIKVDLHQPIMSSLEEMIYFLQTPFSAKXXXXXXXXXXXXXXXXXYDLMLPFMKRKLLFW 362
           +  + LHQP+MSSL+EMIYFLQ+                      Y L++PFM+RK+ FW
Sbjct: 286 EPFIKLHQPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFW 345

Query: 363 EETILQPRRSLFHGAKFLKKFMTK--NNNGPQENILTKDSEGNEYFAFSSTELLMRKLAD 420
           EET+LQP++S+FHG+KFLKK M++   ++  Q+NILTKD +GNEYFA SS ELL+RKLAD
Sbjct: 346 EETVLQPKKSIFHGSKFLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLAD 405

Query: 421 WSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKNDINPL 480
           WS+M+SDFKT Y+TYE LS DL+ FPKYLASCLEW A SLLMGAQ+IVTVKM+KNDI+PL
Sbjct: 406 WSIMLSDFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPL 465

Query: 481 IERALQTYENCAIT--LIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWTSTP 538
           I+RAL  Y+ CA    L            S+EP+ SYETRC+IL SELFLSLSDTWTSTP
Sbjct: 466 IDRALDAYDACAANTHLSNKKIGPTNESTSLEPVLSYETRCLILSSELFLSLSDTWTSTP 525

Query: 539 YAITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINXXXXXXXXXXXXXXXX 598
           YAI YLE+IL E +LGPCS+I IWERLSDCY LR+DPRI+ K+                 
Sbjct: 526 YAINYLESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKVE----------QVQKQD 575

Query: 599 XXXXPSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQV 658
               P+ ++ + +  + DL     +  NI+S+G TR+RK+AFFRL+AAK WAEQ QW+QV
Sbjct: 576 NLEEPADNEHRILNSQDDL-----NPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQV 630

Query: 659 AWCLKDMESIYDATDLGKRDDLIVAKLRNLLDENIGGDDG 698
            WCL ++  IY    L  RDDLI+ +LR   + NI   D 
Sbjct: 631 KWCLDNITDIYSRVGLVNRDDLILTRLRE--EYNIAVSDS 668

>TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {ON}
           Anc_8.255 YDR108W
          Length = 714

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/733 (53%), Positives = 494/733 (67%), Gaps = 66/733 (9%)

Query: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60
           M F+YE+YMNL+FHLD   E+VP +I+KRIVSNAIAPVITVT+T +LD+HI E Y IDS 
Sbjct: 1   MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60

Query: 61  YMLLRYFGGCVSDRDQANELVGKQE----------------------------------- 85
           Y LLRYFGGC+SDRDQ+NE + K E                                   
Sbjct: 61  YTLLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKMEEELQS 120

Query: 86  -LDVTHPTN-PSNPVSSLIVPSGQQQPPLKAR---RGRSRSNSLFQRDSTQSQYIRFTKP 140
             +V +PTN P+   + L V +       K+    R RSRSNSLFQRDSTQSQ+IRFT+P
Sbjct: 121 DQNVINPTNDPTVNNNYLDVDTKTDNLLPKSSQTTRNRSRSNSLFQRDSTQSQFIRFTRP 180

Query: 141 IDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNSTPYELLKNSIYHNFFSLAISST 200
           I+D++    + DMLFDYH+LEI+L   L+++   T +   ++ L+ S+YH FFS AISST
Sbjct: 181 IEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISST 240

Query: 201 TQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNLNTTTPNFPIFMNTNDMLPIF 260
             LSPYE+FNHPIVSLIA+DI+ GQ Y+  RDLL+ FKN NTT  NFPIFM+TND+LP+F
Sbjct: 241 NCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPVF 300

Query: 261 LLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQYEIDIKVDLHQPIMSSLEEMI 320
           +LCY+ +  E+ E    L+K++KKQLF E + +PLW+++Y  DI V LHQP MSSL+EM+
Sbjct: 301 VLCYNGSSAEESEKSTELSKKIKKQLFAECIRMPLWDKRYSDDITVKLHQPAMSSLDEML 360

Query: 321 YFLQTPFSAKXXXXXXXXXXXXXXXXXYDLMLPFMKRKLLFWEETILQPRRSLFHGAKFL 380
           Y  QT  + K                  DLM+PFM+RK+ FWEETILQP++SLF G K  
Sbjct: 361 YVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTKLF 420

Query: 381 KKFMTKNN--NGPQENILTKDSEGNEYFAFSSTELLMRKLADWSMMISDFKTAYSTYESL 438
           +KFM + +  NG QENI  KD++GNEYFA +S   L+RKLADWSMMISDFKTAY+T+ESL
Sbjct: 421 RKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFESL 480

Query: 439 SRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKNDINPLIERALQTYENCAITLIQD 498
             D++ +PKYLASCLEWCA  +LMGAQ+IVT KMIKND+NPLIER+L  Y NCA+ L  +
Sbjct: 481 LEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLL--N 538

Query: 499 TTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWTSTPYAITYLETILTECKLGPCSQ 558
           +  +       EP+RSYETRCM++ SELFLSLSDTWTSTPYA++ LETIL+ECKLG CSQ
Sbjct: 539 SIAESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGACSQ 598

Query: 559 IQIWERLSDCYKLRIDPRIRYKINXXXXXXXXXXXXXXXXXXXXPSTDKPKTIQWESDLE 618
           I IWERLSDCY LR DPR+++K+                      S+             
Sbjct: 599 IMIWERLSDCYNLRTDPRVKHKLRSNISTSSVSEVSEEEIKKQDVSS------------- 645

Query: 619 SKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQVAWCLKDMESIYDATDLGKRD 678
                   I+ KG TR+RK++FFRL+AAKKWAEQ QWRQV+WCL D+  +Y  T  GKR+
Sbjct: 646 --------IVLKGLTRQRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRE 697

Query: 679 DLIVAKL-RNLLD 690
            LI  KL RNLL+
Sbjct: 698 SLIYQKLKRNLLE 710

>KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 708

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/728 (49%), Positives = 468/728 (64%), Gaps = 70/728 (9%)

Query: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60
           M  S+  YMNL FHLD A E VP EI+++IVS+A++PV+TVTST  LD HIQE+Y +DSL
Sbjct: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIVSSAVSPVVTVTSTAALDEHIQESYGVDSL 60

Query: 61  YMLLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRSR 120
           YMLLRYFG CVSDRDQA                 + P   L   SG+        R R+R
Sbjct: 61  YMLLRYFGDCVSDRDQAE----------------AGP--ELGTESGKN-------RNRAR 95

Query: 121 SNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNSTP 180
           SNSLFQR +  S Y+RFT+P+ D++ ++ S D+LFDYHSLE++LE+YL L+  NT + TP
Sbjct: 96  SNSLFQRQA--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDTP 153

Query: 181 YELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNL 240
           + LL++SIYH FF+ AISST  LSPYE+FNHP+ SL+A+DIS  Q Y++ RDLL+ FKN+
Sbjct: 154 HTLLQHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNM 213

Query: 241 NTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQY 300
           + TTP+FP F+N ND+LP+FLLCY+ + +EQFE+CQSL+K +KKQLFVESL+LP W +  
Sbjct: 214 HNTTPHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNI 273

Query: 301 EIDIKVD--LHQPIMSSLEEMIYFLQTPFSAKXXXXXXXXXXXXXXXXXYDLMLPFMKRK 358
                    LHQPIMSSLEE +Y +    +                    +LM+PFMKRK
Sbjct: 274 NAGASPSRILHQPIMSSLEETMYSMMKESTITLPLSLINYIYDRLTNLIDELMIPFMKRK 333

Query: 359 LLFWEETILQPRRSLFHGAKFLKKFMTKN-NNGPQENILTKDSEGNEYFAFSSTELLMRK 417
           + FW+E+ILQPR+S+F  +KF +K ++K     P  +  T   +G  YFA +S E ++RK
Sbjct: 334 ISFWDESILQPRKSIFPNSKFFRKLISKTPAPPPASDSATHSQQGVAYFAATSNEFILRK 393

Query: 418 LADWSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKNDI 477
           LADWS M+SDFK AYSTYE LS+D +  P+YLASCLEWCA S+LMGAQSIVTVKMIKNDI
Sbjct: 394 LADWSFMLSDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDI 453

Query: 478 NPLIERALQTYE--------------NCAITLIQDTTNK-------VFAEQSVEPL---- 512
           +PLI RAL++YE              + A+    +  +K       V  E S + L    
Sbjct: 454 DPLINRALKSYELSARKAKEKNAQLKSSALAKKAEKDSKSATLPSTVSDEHSGQELDEGV 513

Query: 513 --------RSYETRCMILLSELFLSLSDTWTSTPYAITYLETILTECKLGPCSQIQIWER 564
                   +SYETRCM+L +ELFLSLSDTWT+TPYAI YLETIL EC LG  S+I +WER
Sbjct: 514 SSAPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWER 573

Query: 565 LSDCYKLRIDPRIRYKINXXXXXXXXXXXXXXXXXXXXPSTDKPKTIQWESDLESKLGSG 624
           L+ CY LR+DPR++ K+                      S D  +T +++  +     S 
Sbjct: 574 LAYCYALRVDPRVKGKLPSLDGQSGQNEKRGEESEGSDESDD--ETQKYDHKI-----SQ 626

Query: 625 KNILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQVAWCLKDMESIYDATDLGKRDDLIVAK 684
             + S G  RRRKS  FRLIA KKW E KQWRQ  W LKD+E +Y   D   RDDLI+ K
Sbjct: 627 NCMASLGLARRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEK 686

Query: 685 LRNLLDEN 692
           LR  + E+
Sbjct: 687 LRKKIHEH 694

>Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108W
           (GSG1) - involved in meiosis [contig 176] FULL
          Length = 700

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/740 (48%), Positives = 469/740 (63%), Gaps = 92/740 (12%)

Query: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60
           M  SYE YMNL+ HLD A E VP EI+++IVSNA++PV+TVTS+  LD HIQE+Y +DSL
Sbjct: 1   MPLSYERYMNLVSHLDSASEPVPSEISRKIVSNAVSPVVTVTSSAALDKHIQESYGLDSL 60

Query: 61  YMLLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRSR 120
           YMLLRYFG C+SDRDQA+    +QE  V                      P K+R  RSR
Sbjct: 61  YMLLRYFGDCISDRDQAD---SEQESGVE---------------------PNKSR-ARSR 95

Query: 121 SNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNSTP 180
           S SLFQR +  SQ++RFT+P+ DI+  + + D+LFDYHSLE++L++YL+L+   T+  TP
Sbjct: 96  SGSLFQRQA--SQFLRFTRPLSDIIGTRETRDLLFDYHSLEVFLQKYLELVDVKTSPDTP 153

Query: 181 YELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNL 240
           + LL++SIYH FF+ AISST  LSPYE FNHP+ SL+A+DIS  + Y+D RDLLV FKN+
Sbjct: 154 HTLLQHSIYHKFFTTAISSTAHLSPYECFNHPVCSLLALDISQNEGYEDARDLLVTFKNM 213

Query: 241 NTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQY 300
           +  TP+FP F+N ND+LP+FLLCY+   +EQFE CQSL K +KKQLFVESL+LP W+  +
Sbjct: 214 HNKTPHFPSFINVNDILPVFLLCYEEGSREQFETCQSLAKMMKKQLFVESLLLPCWSVNF 273

Query: 301 ---EIDIKVDLHQPIMSSLEEMIYFLQTPFSAKXXXXXXXXXXXXXXXXXYDLMLPFMKR 357
              +   +V LHQPIMSSLEE ++ +    +                    +LM+PFMKR
Sbjct: 274 TAKDTPTRV-LHQPIMSSLEETMFSMLKDSAFDLPLPFIEHIYDRLTKLVDELMIPFMKR 332

Query: 358 KLLFWEETILQPRRSLFHGAKFLKKFMTKNNNGPQEN-ILTKDSEGNEYFAFSSTELLMR 416
           K+ FWEE+ILQPRRS+F  +KF +K ++K       N   T   +G  YFA +S ELL+R
Sbjct: 333 KISFWEESILQPRRSIFPNSKFFRKLISKAPTPSTNNDSATHSEQGLAYFAATSNELLLR 392

Query: 417 KLADWSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKND 476
           KLADWS M+SDFKTAYSTYE LS+D +  P+YLA CLEWCA S+LMGAQSIVTVKMIKND
Sbjct: 393 KLADWSFMLSDFKTAYSTYELLSKDFEQHPEYLAPCLEWCALSVLMGAQSIVTVKMIKND 452

Query: 477 INPLIERALQTYENCAITL---------------------------------IQDTTNKV 503
           I+PLI RAL++YE CA                                    +  TT+  
Sbjct: 453 IDPLITRALKSYELCASKAKERNGLLKSKLQNRDHDKSLNGFETISNSHDDRVSGTTDFE 512

Query: 504 FAEQSVEPLRSYETRCMILLSELFLSLSDTWTSTPYAITYLETILTECKLGPCSQIQIWE 563
            +    +  +SYETRCM+L +ELFLSLSDTWT+TPYAI YLETIL +C +G  S+I IWE
Sbjct: 513 ISSTPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDQCTVGALSEIVIWE 572

Query: 564 RLSDCYKLRIDPRIRYKINXXXXXXXXXXXXXXXXXXXXPSTDKPKTIQWESDL------ 617
           RL+ CY LR+DPR++ ++                      S+D+ + +  ES+       
Sbjct: 573 RLAYCYALRVDPRVKSRLTASEIQ----------------SSDQNEKLDEESEGSDNDSG 616

Query: 618 -ESKLGSGK----NILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQVAWCLKDMESIYDAT 672
            ES++   K     I S G TR+RK+  FRLIA KKW E KQWRQ  W  +D+E +Y   
Sbjct: 617 DESQVCQHKMSQSCIASSGLTRKRKATLFRLIATKKWTESKQWRQACWSFQDLEVMYSHL 676

Query: 673 DLGKRDDLIVAKLRNLLDEN 692
               R+DLI+ KL   + ++
Sbjct: 677 VFANREDLILKKLEKRIAQH 696

>SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 719

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/752 (47%), Positives = 481/752 (63%), Gaps = 90/752 (11%)

Query: 1   MVFSYEHYMNLLFHLDHAKESVP--PEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNID 58
           M  SYE+YMNLL+H+DH+ ESV    E+AK+IVSNA++PV+ VTST  LD+H+QE Y + 
Sbjct: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIVSNAVSPVVAVTSTSLLDSHLQEAYGLH 60

Query: 59  SLYMLLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGR 118
           S+YMLLR+FG CV+DRDQ NE            TN                      +GR
Sbjct: 61  SMYMLLRFFGDCVTDRDQENET----------ETN---------------------FKGR 89

Query: 119 SRSNSLFQRDSTQSQYIRFTKPIDDIVAIK-SSNDMLFDYHSLEIYLEQYLQLIATNTNN 177
            RSNSLFQR+S  S ++RFT+P+ D+V ++ S + MLFDYHSLE++L++YL+L+    + 
Sbjct: 90  PRSNSLFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSA 147

Query: 178 STPYELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEF 237
           +TP+ LLK+SIYH FF+ AISST  LSPYE+FNHP++SL+A+DIS G TY++ RDLL+ F
Sbjct: 148 NTPHRLLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRF 207

Query: 238 KNLNTTT---PNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILP 294
           KN+N+ T    +FP F+N ND+LP+FLLCY+ +  EQFE CQSL K LKKQLFVES++LP
Sbjct: 208 KNMNSATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLP 267

Query: 295 LWNEQYEIDI---KVDLHQPIMSSLEEMIYFL--QTP------FSAKXXXXXXXXXXXXX 343
           LW +  + D    +  LH PIMSSLEEM+YFL  + P      ++               
Sbjct: 268 LWRDSEDYDAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELPLAL 327

Query: 344 XXXXYD--------LMLPFMKRKLLFWEETILQPRRSLFHGAKFLKKFMTKNNNGPQENI 395
               YD        LM+PFMKRK+ FWEETILQPR+S+F  AKFL++F++K+        
Sbjct: 328 VETIYDRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPATPAAP 387

Query: 396 LTKDSEG----NEYFAFSSTELLMRKLADWSMMISDFKTAYSTYESLSRDLDTFPKYLAS 451
           +   S+G    + +F  SS E L+RKLADWS M+SD++TAY+TY++LS+DL+   +YLA 
Sbjct: 388 INSKSDGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAP 447

Query: 452 CLEWCATSLLMGAQSIVTVKMIKNDINPLIERALQTYENCAITLIQDTTNKVFAEQSVEP 511
           CLEWCA S+LMGAQSIVTVKMIKNDI+PLI ++LQ YE CA  L      +  +    +P
Sbjct: 448 CLEWCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSPVDSKP 507

Query: 512 LRSYETRCMILLSELFLSLSDTWTSTPYAITYLETILTECKLGPCSQIQIWERLSDCYKL 571
            +SYETRCM+L +ELFLSLSDTWT+TPYAI YLETIL  C LGP SQ+ +WE+L+ CY+L
Sbjct: 508 AQSYETRCMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYEL 567

Query: 572 RIDPRIRYKINXXXXXXXXXXXXXXXXXXXXP--------STDKPKTIQWE--SDLESKL 621
           R+DPR+ +                       P        ST+K +T   E  SD +SK 
Sbjct: 568 RVDPRVSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKD 627

Query: 622 GS------------------GKNILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQVAWCLK 663
            +                   K+I   G TRRRK+AFFRLIAA KW EQKQW+Q +W L+
Sbjct: 628 EALSNREKEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLR 687

Query: 664 DMESIYDATDLGKRDDLIVAKLRNLLDENIGG 695
           D++++Y       R  LI+ +L   ++ N+  
Sbjct: 688 DVDTVYSGLVFSYRKGLILERLVGEIEANMHA 719

>KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {ON}
           Anc_8.255 YDR108W
          Length = 648

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/722 (47%), Positives = 444/722 (61%), Gaps = 120/722 (16%)

Query: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60
           M FSYEHYMNLL HL+ A E+VPP+IA+RIVS+A+APVITVTS+  LD+HI E+Y + S 
Sbjct: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60

Query: 61  YMLLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRSR 120
           Y+L R FGGC+SDRDQ   L+    LD +                          R R R
Sbjct: 61  YLLFRLFGGCISDRDQ---LMEHYTLDDSS----------------------TGGRTRKR 95

Query: 121 SNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYL----QLIATN-- 174
           SNSLFQRD+TQSQ+IRF +P+ D++   +    LFD  SLE YL  YL    +L AT+  
Sbjct: 96  SNSLFQRDATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPE 155

Query: 175 ----------------TNNSTPYELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIA 218
                                P++LL+N++YHNFF+LA+SSTT++SP+ETFN P+++LIA
Sbjct: 156 KVEQLPDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIA 215

Query: 219 VDISMGQTYDDIRDLLVEFKNLNTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSL 278
           +D+S GQ Y+ +RDL+  FKNLN    +FP+F+N ND+LP+ +LCYDA  + Q   C+ L
Sbjct: 216 IDVSRGQDYEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQL 275

Query: 279 TKRLKKQLFVESLILPLWNEQYEIDIKVDLHQPIMSSLEEMIYFLQTPFSAKXXXXXXXX 338
            +++KK LFV+S+ L LW+E  E  + V LH+PIMSSL+E++ F  +  SA         
Sbjct: 276 QRKIKKCLFVDSIPLALWDEDPESPL-VPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDG 334

Query: 339 XXXXXXXXXY-------------DLMLPFMKRKLLFWEETILQPRRSLFHGA-KFLKKFM 384
                                  ++++PFM RK  +WEE ILQPR+S+FHG+  F KKF+
Sbjct: 335 HSRAALPLNIITHMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFI 394

Query: 385 TKNNNGPQENILTKDSEGNEYFAFSSTELLMRKLADWSMMISDFKTAYSTYESLSRDLDT 444
            K           +D    ++F  SSTE L+RKLADWS+M+SDFKTAY TY+SLS DL  
Sbjct: 395 GKTTT-------QRDPSDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQN 447

Query: 445 FPKYLASCLEWCATSLLMGAQSIVTVKMIKNDINPLIERALQTYENCAITLIQDTTNKVF 504
            P YLASCLEWCA SLL+GAQ+IVTVKMIK +I PLIERA+ TY                
Sbjct: 448 SPNYLASCLEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATYRQ-------------- 493

Query: 505 AEQSVEPLRSYETRCMILLSELFLSLSDTWTSTPYAITYLETILTEC-KLGPCSQIQIWE 563
                +   SYETRCMIL +ELFL+L DTWTSTPYAI YLETIL +C +LG CSQ+ IWE
Sbjct: 494 -----QGRSSYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIWE 548

Query: 564 RLSDCYKLRIDPRIRYKINXXXXXXXXXXXXXXXXXXXXPSTDKPKTIQWESDLESKLGS 623
           RLSDCY+ R DPR+   ++                    P + +P               
Sbjct: 549 RLSDCYQSRTDPRVASALS----------------TNTSPGSAQP--------------- 577

Query: 624 GKNILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQVAWCLKDMESIYDATDLGKRDDLIVA 683
           G  IL++GFTR+RK+AFFRLIAAKKWAEQ QWRQV WCL D++ IY A+ L  +  L++ 
Sbjct: 578 GNEILAQGFTRKRKAAFFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLID 637

Query: 684 KL 685
           +L
Sbjct: 638 RL 639

>TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON}
           Anc_8.255 YDR108W
          Length = 889

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/636 (48%), Positives = 416/636 (65%), Gaps = 60/636 (9%)

Query: 115 RRGRSRSNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATN 174
           ++ R RSNSLFQRDSTQSQYIRFTKPI D+V  +   D LFD+ SLE  L+ YL++I TN
Sbjct: 182 QKTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIETN 241

Query: 175 TNNSTPYELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLL 234
           T    P+  LK S+YH FFS+ ++STT L P+E+F+HPIVSL+++D+++ Q YD  +++L
Sbjct: 242 TTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEML 301

Query: 235 VEFKNLNTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILP 294
           ++FKN+++ TPNFP+++N ND+LP+FLLCYDA+  EQ +I + ++ ++KKQLF ES++LP
Sbjct: 302 IKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILLP 361

Query: 295 LWNEQ-YEIDIKVDLHQPIMSSLEEMIYFLQTPFSA-------KXXXXXXXXXXXXXXXX 346
           LWN++ Y  D  V LH+P+MSS++E +YFLQ            K                
Sbjct: 362 LWNDKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIANL 421

Query: 347 XYDLMLPFMKRKLLFWEETILQPRRSLFHGAKFLKKFMTKN-----------------NN 389
             +L++PFM+RK+ FW+ETILQPR+S+F   K  K FM +N                  +
Sbjct: 422 SVNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRNSNVSSSTGTSSSEISNSIS 480

Query: 390 GPQENILTKDSEGNEYFAFSSTELLMRKLADWSMMISDFKTAYSTYESLSRDLDTFPKYL 449
               ++LTKDS G+EYF+  STE  +RKLADWSMM+SDFKTAY+TYESLSRDL+   KY+
Sbjct: 481 KHHHSLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKYM 540

Query: 450 ASCLEWCATSLLMGAQSIVTVKMIKNDINPLIERALQTYEN------------------- 490
           ASCLEW A S+LMGAQ+IVT KM+KND++PLIE AL++YE                    
Sbjct: 541 ASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVPNSRLPSNNINSLN 600

Query: 491 CAITLIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWTSTPYAITYLETILTE 550
              ++   T  +V   ++   +RSYE RCM+LLSELFLSLSDTWTSTPYA+ YLETIL++
Sbjct: 601 SRSSISSATKAEVSLIENNHTIRSYEIRCMLLLSELFLSLSDTWTSTPYALRYLETILSD 660

Query: 551 CKLGPCSQIQIWERLSDCYKLRIDPRIRYK-----INXXXXXXXXXXXXXXXXXXXXPST 605
            KLGPCSQ  +WERLS CY LR+DPRI+ K     IN                       
Sbjct: 661 YKLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEKYR 720

Query: 606 DKPKTIQWESDLESKL----------GSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQW 655
           +  K  ++  D ++ L            G +ILS GFTR+RK+AFF+LIAAKKW+EQKQW
Sbjct: 721 NDGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTRKRKAAFFKLIAAKKWSEQKQW 780

Query: 656 RQVAWCLKDMESIYDATDLGKRDDLIVAKLRNLLDE 691
           RQ+ WCLKD+E++Y       R DLI+ KL++ L++
Sbjct: 781 RQLDWCLKDIENVYKEVGFSDRKDLILIKLKDQLNK 816

 Score =  133 bits (334), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 62/94 (65%), Positives = 74/94 (78%), Gaps = 8/94 (8%)

Query: 1  MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60
          M FSYE+YMNLLFHLD   E +P +IAKRIV N+IAP+I+VT+TP+LD H+Q++YNIDSL
Sbjct: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60

Query: 61 YMLLRYFGGCVSDRDQ--------ANELVGKQEL 86
          YMLLRYFGGC+SDRDQ         NEL  K EL
Sbjct: 61 YMLLRYFGGCISDRDQYHEPHHQHPNELDHKNEL 94

>Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}
           similar to Ashbya gossypii AGR096C
          Length = 623

 Score =  510 bits (1314), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 299/707 (42%), Positives = 415/707 (58%), Gaps = 93/707 (13%)

Query: 2   VFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSLY 61
           + SYE YMNLL + D   + VP EI+++++ NA++P I+V ST  L+ H++E + I SLY
Sbjct: 1   MLSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLY 60

Query: 62  MLLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRSRS 121
            LLRYFG  + DRDQ ++ +                       S + QP       R R 
Sbjct: 61  KLLRYFGDYIQDRDQLDDKI-----------------------SAKLQP----NNRRQRQ 93

Query: 122 NSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNSTPY 181
           NSLFQR+S  S+YIRF  P+ DI+++  ++ +  +++ LE  L ++L+ I  +T N +P 
Sbjct: 94  NSLFQRNS--SRYIRFQTPLTDIISVGDNHQV--EFNDLEESLSEFLKDIEEHTVNDSPC 149

Query: 182 ELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNLN 241
           ELLK+SI+H F ++ +SSTT LSPY +FNHPI++L+A+DI+ G+ Y+  R+LL+EFKNL 
Sbjct: 150 ELLKHSIFHKFITM-LSSTT-LSPYHSFNHPILALLALDITQGEEYELARELLMEFKNLP 207

Query: 242 TTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQYE 301
            T   FP F+NTND+LP+F+LC+D +  +Q+E  QSL K +KKQLFVES+ LP++     
Sbjct: 208 NTLSKFPAFINTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPIFTNFR- 266

Query: 302 IDIKVDLHQPIMSSLEEMIYFLQTPFSAKXXXXXXXXXXXXXXXXXYDLMLPFMKRKLLF 361
            D  + LH PI +SL+E +Y    P S K                  DLM+PFM RK+ F
Sbjct: 267 -DRSIVLHPPITNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISF 325

Query: 362 WEETILQPRRSLFHGAKFLKKFMTKNNNGPQENILTKDSEGNEYFAFSSTELLMRKLADW 421
           W+ETILQPR+S+FH  K LK+F++K++  P  ++ T     + +F  SS E L+RKLADW
Sbjct: 326 WDETILQPRKSIFHSNKLLKRFISKSSGSPTASMPT---SPDGHFLASSNEFLLRKLADW 382

Query: 422 SMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKNDINPLI 481
             M+SD+KTAYS YE L RD + +P Y++SC E+ A SLLMGA SIVT KMIKNDI+PLI
Sbjct: 383 CFMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDPLI 442

Query: 482 ERALQTYENCAITLIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWTSTPYAI 541
            + L    N  I+L Q                    RCMI ++ELFLSLSDTWTS P+AI
Sbjct: 443 MKYLDYAVNNIISLDQ-------------------IRCMIYMTELFLSLSDTWTSAPFAI 483

Query: 542 TYLETILTE--CKLGPCSQIQIWERLSDCYKLRIDPRIRYKINXXXXXXXXXXXXXXXXX 599
            YLE IL +   KLGP  +  IWER+S  Y+LRIDPRI                      
Sbjct: 484 KYLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIH--------------------- 522

Query: 600 XXXPSTDKPKTIQWESDLES-------KLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQ 652
                 D   T   + DLE        KL  GK I ++GFTR RK A F+L+AAKKW + 
Sbjct: 523 -----ADDDSTSDCDHDLEEELYLNPHKLHCGK-IQNQGFTRYRKEAVFQLLAAKKWLQC 576

Query: 653 KQWRQVAWCLKDMESIYDATDLGKRDDLIVAKLRNLLDENIGGDDGN 699
            Q RQ AW LK    +Y        +  ++++L + + ++      N
Sbjct: 577 GQTRQGAWSLKRCNRVYRDLPFANAEGTLLSRLADAVVDSENSQRAN 623

>AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR108W
           (GSG1)
          Length = 623

 Score =  490 bits (1261), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 290/693 (41%), Positives = 405/693 (58%), Gaps = 90/693 (12%)

Query: 2   VFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSLY 61
           + SYE YMNL+ + +H  + VP EI++R++ NA++P ++V ST  L+ H+ E ++  SLY
Sbjct: 1   MLSYETYMNLVHYPEHWSQPVPHEISRRVICNALSPCVSVQSTAALEAHLAEEFSEGSLY 60

Query: 62  MLLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRSRS 121
           MLLRYF   V +R    E VG                      SGQ++P           
Sbjct: 61  MLLRYFADYVRER---GEEVGSV--------------------SGQRRP----------- 86

Query: 122 NSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNSTPY 181
            S++QR +  S+Y+RF +P++++  I++      D+  LE  L Q+L+ I   T N +P 
Sbjct: 87  GSVYQRQT--SRYVRFQRPLEEV--IETVEQQAVDFEDLEEALGQHLRDIEARTTNESPS 142

Query: 182 ELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNLN 241
           ELLK+SI+H F ++   S+T LSPY T NHPI++L+A+D++ G+ Y   R+LLV+FKNL 
Sbjct: 143 ELLKHSIFHKFITML--SSTALSPYHTVNHPIMALLALDVTQGEEYTLARELLVQFKNLP 200

Query: 242 TTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQYE 301
           + +  FP ++NTND+LP+F+LC+D +  EQ+E  Q+L K +KKQLFVES+ LP++   YE
Sbjct: 201 SKSSKFPSYINTNDVLPVFILCFDESSSEQWETVQALQKAIKKQLFVESVPLPIFT-NYE 259

Query: 302 IDIKVDLHQPIMSSLEEMIYFLQTPFSAKXXXXXXXXXXXXXXXXXYDLMLPFMKRKLLF 361
            D  V LH PI +SL+E +Y    P   +                  DLM+PFM RK+ F
Sbjct: 260 SD-PVVLHPPITNSLQEQVYDGSHPPLLRLCPQLVDVIYETINAMVEDLMIPFMNRKISF 318

Query: 362 WEETILQPRRSLFHGAKFLKKFMTKNNNGPQENILTKDSEGNEYFAFSSTELLMRKLADW 421
           W+ETILQPR+S+FHG KFLK+FM K N+      L+  S+G  YF  SS E L+RKLADW
Sbjct: 319 WDETILQPRKSIFHGNKFLKRFMNKTNSSAA-GTLSTSSDG--YFLASSNEFLLRKLADW 375

Query: 422 SMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKNDINPLI 481
           S M+SD+KTAYS Y  L RD + +P+YL+SC E+ A SLLMGA SIVT KMIKNDI+PLI
Sbjct: 376 SFMLSDYKTAYSIYYILLRDFELYPQYLSSCQEFSALSLLMGAHSIVTTKMIKNDIDPLI 435

Query: 482 ERALQTYENCAITLIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWTSTPYAI 541
            + +            D+T       S+  L  +  RC++ ++ELFLSLSDTWTS P+AI
Sbjct: 436 MKYM------------DSTVA-----SLNYLGKF--RCLVYMAELFLSLSDTWTSAPFAI 476

Query: 542 TYLETILT--ECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINXXXXXXXXXXXXXXXXX 599
            YLE IL   + KLGP S+  +WER+S  Y+LRIDPRI                      
Sbjct: 477 KYLELILQNEQLKLGPLSRTMLWERISYAYQLRIDPRIHTDDEYL--------------- 521

Query: 600 XXXPSTDKPKTIQWESDL---ESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQWR 656
                +D    +  E D     +KL   + I S G TR RK A FRL+AAKKW E    R
Sbjct: 522 -----SDNFMELTTEDDFCMNPNKLHHWR-IHSLGLTRHRKEAVFRLLAAKKWLEYGHIR 575

Query: 657 QVAWCLKDMESIYDATDLGKRDDLIVAKLRNLL 689
           Q AW LK    +Y        D  ++++L +++
Sbjct: 576 QGAWSLKGCNKVYRNLGFANADGTLLSRLVDMV 608

>KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} similar
           to uniprot|P46944 Saccharomyces cerevisiae YDR108W GSG1
           Subunit of TRAPP (transport protein particle) a
           multi-subunit complex involved in targeting and/or
           fusion of ER-to-Golgi transport vesicles with their
           acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 647

 Score =  465 bits (1197), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 265/690 (38%), Positives = 393/690 (56%), Gaps = 59/690 (8%)

Query: 3   FSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSLYM 62
           FSYE YMNL+ + +H    +P EI+K+++ N ++P I V S  +LDNH+++ YNIDS+ M
Sbjct: 5   FSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSISM 64

Query: 63  LLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQ-QPPLKARRGRSRS 121
           L RYFG  + DRDQ                          +PS    + P     GR RS
Sbjct: 65  LFRYFGDYIQDRDQ--------------------------IPSTTDLKDPGSVSSGRHRS 98

Query: 122 NSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTN-NSTP 180
           +SLFQR +  S+ +RFT+ ++D+++I  S D +     ++ +L QYLQ +    N N TP
Sbjct: 99  DSLFQRQA--SECVRFTRSLEDLISI-DSEDHILQSTDIDSFLSQYLQNLEPIMNENGTP 155

Query: 181 YELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNL 240
            +LLK+SIYH FF     S+  LS Y +F+HP+V+L+ +DI+ GQ Y++ R++L+ FKNL
Sbjct: 156 SKLLKHSIYHRFF--ITLSSINLSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNL 213

Query: 241 NTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQY 300
           N T  NFP F+N ND+LP+F+LCYD N +EQ+E  Q+LTK LKKQLFVES+ + L+   +
Sbjct: 214 NNTLENFPEFININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISLFTP-H 272

Query: 301 EIDIKVDLHQPIMSSLEEMIYFLQTPFSAKXXXXXXXXXXXXXXXXXYDLMLPFMKRKLL 360
           +      LH PI  SL E ++ +  P S                    ++M+PFM RKL+
Sbjct: 273 DNQKSTTLHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLV 332

Query: 361 FWEETILQPRRSLFHGAKFLKKFMTKNNNGP---QENILTKDSEGNEYFAFSSTELLMRK 417
           FW+ET+LQPR+S+F   KF ++F++  +N P   + N     +EG+  F  SS E L+RK
Sbjct: 333 FWDETVLQPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLLRK 392

Query: 418 LADWSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKNDI 477
           LADWS M+SDFK AYS Y+ L++D +++P+YLA CLE+   SLLMGAQ+I+T K IK ++
Sbjct: 393 LADWSFMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTEV 452

Query: 478 NPLIERALQTYENCAITLIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWTST 537
           +PL+ RA++ Y+       QD  + +               C++  S+L LSLSDTW S+
Sbjct: 453 DPLMTRAIEQYKK------QDEKHSLRV-----------IHCILTFSDLLLSLSDTWVSS 495

Query: 538 PYAITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRI--RYKINXXXXXXXXXXXXX 595
           P A+ YL  I     LGP + + I ER++  Y++ ID R+   +                
Sbjct: 496 PLAVNYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADESEAA 555

Query: 596 XXXXXXXPSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQW 655
                     +     +W +  E+KL    N+ S+G TR RK + ++L+AAKKW E  + 
Sbjct: 556 ENSKKGENGLEVDDMHEWRN--ENKLIQN-NLRSEGLTRFRKYSLYQLVAAKKWVELHKR 612

Query: 656 RQVAWCLKDMESIYDATDLGKRDDLIVAKL 685
            Q  WC+      Y+   L KR D +  +L
Sbjct: 613 NQAKWCIYHAAPAYEKLSLSKRPDGLFHRL 642

>Kwal_55.21992 s55 complement(1067753..1068376) [624 bp, 207 aa]
           {ON} YNL306W (MRPS18) -  [contig 124] FULL
          Length = 207

 Score = 33.1 bits (74), Expect = 1.4,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 11/76 (14%)

Query: 87  DVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRSRS------NSLFQRDSTQSQYIRFTKP 140
           DV    N SNP+S++I PS  ++P  +A R R         N LF +++T   Y   +  
Sbjct: 29  DVAQAVNASNPMSNVISPS--EEPGSRAYRKRGEHTVKYVLNCLFSKNNTHFTY---SAV 83

Query: 141 IDDIVAIKSSNDMLFD 156
           ++D+   K++ D  ++
Sbjct: 84  VEDLNYAKNNPDASYN 99

>ZYRO0A07370g Chr1 (601469..603958) [2490 bp, 829 aa] {ON} similar
           to uniprot|P32567 Saccharomyces cerevisiae YMR165C SMP2
           Protein involved in respiration and plasmid maintenance
          Length = 829

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 7/77 (9%)

Query: 640 FFRLIAAKKWAEQKQWRQVAWCLKDMESIYDATDLGKRDDLIVAKLRNLLDENIGGDDGN 699
           + R    +K+ +   WR+    + D+E + D ++    D    AK ++  D N   +DG 
Sbjct: 611 YLRSKQEEKFTDVNFWRE---PIPDLEELTDTSNSDGED----AKSKDARDGNYNSNDGR 663

Query: 700 FKLKDEKLSADHIEVSS 716
             + D+ LS DH+++SS
Sbjct: 664 SSMLDKSLSHDHLQLSS 680

>ZYRO0F07832g Chr6 (633692..635716) [2025 bp, 674 aa] {ON} similar
           to uniprot|P53118 Saccharomyces cerevisiae YGL144C ROG1
           Protein with putative serine active lipase domain
          Length = 674

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 22/97 (22%)

Query: 615 SDLESKLGSGKNILSKGFTRRRKSAFFRL--IAAKKWAEQKQWRQVAWCLKDMESIYDAT 672
           S+ E      KNIL + FT RRK     L    A++W E   WR+V   LK      DA 
Sbjct: 494 SEAEDTYKHSKNILLEPFTIRRKDKGKSLEETIARRWHEGVSWRKVVVSLKP-----DA- 547

Query: 673 DLGKRDDLIVAK----------LRNLLDENIGGDDGN 699
                +++IV +          + +L++ +  GDD N
Sbjct: 548 ----HNNIIVRRRFSNAYGWPVMDHLIEAHFNGDDNN 580

>TBLA0D04760 Chr4 complement(1174113..1175261) [1149 bp, 382 aa]
           {ON} Anc_1.418 YCL001W-B
          Length = 382

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 25/44 (56%)

Query: 641 FRLIAAKKWAEQKQWRQVAWCLKDMESIYDATDLGKRDDLIVAK 684
            +L+  KKW  +K  R++    ++ E ++    L K+DD+IV K
Sbjct: 1   MKLLGLKKWNGKKNGREIKLLAENKEDLFSIYQLVKKDDVIVFK 44

>KAFR0A06380 Chr1 complement(1288673..1294306) [5634 bp, 1877 aa] {ON}
            Anc_4.173 YLR342W
          Length = 1877

 Score = 32.0 bits (71), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 50/119 (42%), Gaps = 23/119 (19%)

Query: 158  HSLEIYLEQYLQLIATNTNNSTPYELLKNSIYHNFFSLAISSTTQLSP---YE--TFNHP 212
            H+L  Y  +YLQLI  N +N     L   SI   F  L +  T   +P   YE  T NHP
Sbjct: 1089 HALIFYRGEYLQLIDANQDNYLEECLKIRSILAEFEELNVEQTNPYAPELKYEEQTANHP 1148

Query: 213  IV------------SLIAVDISMG--QTYDDI--RDLLVEFKNLNTTTPNF--PIFMNT 253
            +             S +  D++ G  QT+  +  R L      L+   P+F   +FM T
Sbjct: 1149 VAIVGAREYIFSENSGVLGDVAAGKEQTFGTLFARTLAQIGGKLHYGHPDFVNAVFMTT 1207

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,084,296
Number of extensions: 3346267
Number of successful extensions: 10897
Number of sequences better than 10.0: 38
Number of HSP's gapped: 11192
Number of HSP's successfully gapped: 51
Length of query: 716
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 599
Effective length of database: 40,065,477
Effective search space: 23999220723
Effective search space used: 23999220723
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)