Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0J014008.257ON58858831610.0
KLTH0G13794g8.257ON72557418830.0
Kwal_56.236078.257ON72557418780.0
NCAS0B038708.257ON59658418480.0
SAKL0H17160g8.257ON73953018570.0
Kpol_392.98.257ON59458718210.0
KLLA0F19041g8.257ON76352418320.0
ZYRO0C01782g8.257ON73053518120.0
TDEL0F038408.257ON72653617970.0
Ecym_43138.257ON59759817600.0
KAFR0B055608.257ON60558817550.0
YDR109C8.257ON71551717610.0
Skud_4.3708.257ON71452917550.0
Smik_4.3558.257ON70460417430.0
CAGL0B01727g8.257ON57757917270.0
Suva_2.2698.257ON72552017380.0
TBLA0E044008.257ON58959217100.0
KNAG0H032608.257ON58058116840.0
AGR092W8.257ON59658916480.0
TPHA0B032408.257ON58558515940.0
Suva_14.931.111ON5435945774e-66
Skud_14.891.111ON5695925565e-63
YNL249C (MPA43)1.111ON5425915345e-60
TDEL0C059001.111ON5435955275e-59
ZYRO0F16016g1.111ON5425905153e-57
Smik_14.861.111ON5435985012e-55
Kwal_33.135301.111ON5345924863e-53
KLTH0F03080g1.111ON5336034713e-51
SAKL0C03432g1.111ON5476004706e-51
KNAG0F006601.111ON5355994012e-41
KLLA0C02937g1.111ON5164923553e-35
NCAS0A007801.111ON5495181511e-09
NDAI0H002204.9ON8101991073e-04
NCAS0C059004.9ON7031971055e-04
TPHA0K022804.9ON667201940.010
YHL032C (GUT1)4.9ON709204920.018
TDEL0G018204.9ON698210890.040
Skud_8.124.9ON710204850.11
KLLA0E00595g4.9ON661112840.15
Suva_8.194.9ON732133830.20
CAGL0E03916g4.9ON672115820.25
SAKL0H25938g4.9ON685235810.30
Smik_8.94.9ON708136810.31
KLLA0A09977g5.27ON53575761.1
CAGL0M13651g5.27ON50860761.2
TBLA0G012104.150ON1825152733.0
ADR128C2.618ON86756723.7
Smik_4.6875.519ON84898706.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0J01400
         (588 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8....  1222   0.0  
KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} simi...   729   0.0  
Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {...   728   0.0  
NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257    716   0.0  
SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} simi...   719   0.0  
Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON} (24389..26...   706   0.0  
KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]...   710   0.0  
ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} simila...   702   0.0  
TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {O...   696   0.0  
Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar t...   682   0.0  
KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON} Anc_8...   680   0.0  
YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON} P...   682   0.0  
Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON...   680   0.0  
Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON...   676   0.0  
CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {...   669   0.0  
Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON...   674   0.0  
TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa] ...   663   0.0  
KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.2...   653   0.0  
AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic ho...   639   0.0  
TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.2...   618   0.0  
Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {O...   226   4e-66
Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {O...   218   5e-63
YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON} ...   210   5e-60
TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON} Anc_1...   207   5e-59
ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} simi...   202   3e-57
Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {O...   197   2e-55
Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {...   191   3e-53
KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {...   186   3e-51
SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {...   185   6e-51
KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {O...   159   2e-41
KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {...   141   3e-35
NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {O...    63   1e-09
NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}...    46   3e-04
NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4...    45   5e-04
TPHA0K02280 Chr11 (490104..492107) [2004 bp, 667 aa] {ON} Anc_4....    41   0.010
YHL032C Chr8 complement(36379..38508) [2130 bp, 709 aa] {ON}  GU...    40   0.018
TDEL0G01820 Chr7 (364972..367068) [2097 bp, 698 aa] {ON} Anc_4.9...    39   0.040
Skud_8.12 Chr8 complement(24374..26506) [2133 bp, 710 aa] {ON} Y...    37   0.11 
KLLA0E00595g Chr5 complement(49243..51228) [1986 bp, 661 aa] {ON...    37   0.15 
Suva_8.19 Chr8 complement(37989..40187) [2199 bp, 732 aa] {ON} Y...    37   0.20 
CAGL0E03916g Chr5 (371422..373440) [2019 bp, 672 aa] {ON} simila...    36   0.25 
SAKL0H25938g Chr8 (2281415..2283472) [2058 bp, 685 aa] {ON} simi...    36   0.30 
Smik_8.9 Chr8 complement(20054..22180) [2127 bp, 708 aa] {ON} YH...    36   0.31 
KLLA0A09977g Chr1 (876594..878201) [1608 bp, 535 aa] {ON} simila...    34   1.1  
CAGL0M13651g Chr13 (1341331..1342857) [1527 bp, 508 aa] {ON} sim...    34   1.2  
TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4....    33   3.0  
ADR128C Chr4 complement(934445..937048) [2604 bp, 867 aa] {ON} S...    32   3.7  
Smik_4.687 Chr4 (1219205..1221751) [2547 bp, 848 aa] {ON} YDR416...    32   6.9  

>NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8.257
          Length = 588

 Score = 1222 bits (3161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 588/588 (100%), Positives = 588/588 (100%)

Query: 1   MEKDIYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCF 60
           MEKDIYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCF
Sbjct: 1   MEKDIYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCF 60

Query: 61  CVKKVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRAL 120
           CVKKVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRAL
Sbjct: 61  CVKKVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRAL 120

Query: 121 KETKEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATG 180
           KETKEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATG
Sbjct: 121 KETKEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATG 180

Query: 181 RKTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNF 240
           RKTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNF
Sbjct: 181 RKTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNF 240

Query: 241 LTAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRVGMANAI 300
           LTAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRVGMANAI
Sbjct: 241 LTAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRVGMANAI 300

Query: 301 GRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHP 360
           GRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHP
Sbjct: 301 GRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHP 360

Query: 361 SYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPS 420
           SYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPS
Sbjct: 361 SYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPS 420

Query: 421 MKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSL 480
           MKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSL
Sbjct: 421 MKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSL 480

Query: 481 LMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENILWSTMN 540
           LMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENILWSTMN
Sbjct: 481 LMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENILWSTMN 540

Query: 541 KMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVED 588
           KMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVED
Sbjct: 541 KMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVED 588

>KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 725

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/574 (58%), Positives = 444/574 (77%), Gaps = 18/574 (3%)

Query: 2   EKDIYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFC 61
           ++ + YY+GVDVGTGS RACIID +G I S AE  I R++LK + ITQSSQEIW+AVC C
Sbjct: 29  QQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHC 88

Query: 62  VKKVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALK 121
           VK VV + G   +++ GIGFDATCSLVVV++ TN+ VAVGPDF++++Q+IILWMDHRA++
Sbjct: 89  VKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIE 148

Query: 122 ETKEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGR 181
           ET+ IN+T D+CLKYVGGQMS+EME+PKIKWLK H+ ++ F  C+F+DLADYLTFKA+G+
Sbjct: 149 ETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGK 208

Query: 182 KTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGS-HGRNF 240
           +TRSFCS VCKQG++P+GVEGS  GWS++FL  I LEEL  +D+ ++GGSV  S  G+NF
Sbjct: 209 ETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNF 268

Query: 241 LTAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGT-VDLEQLFR-----V 294
           L+AGE+I  ++    EEL LS  C+VGSG+IDAYAGW+GTV + T V +  L +     V
Sbjct: 269 LSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKV 328

Query: 295 GMANAIGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQH 354
           GM  A GRLAAVAGTSTCHI +S+DPIFV GVWGPY+D +   +WC EGGQSCTGALL H
Sbjct: 329 GMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAH 388

Query: 355 VLQTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRS 414
           VL THP+Y EL ++++   ++KFDYLN+RL  +A++   RSV+ LAKH+FFYGD HGNRS
Sbjct: 389 VLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRS 448

Query: 415 PLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGG 474
           P+ADPSM+ AI+G SMD S+D+LA  YL ACEFIAQQ RQI++ MC +GH++SAI+MSGG
Sbjct: 449 PIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGG 508

Query: 475 QCRNSLLMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENI 534
           QCRN LLM+LLADC+GL ++IP YID+AVVFG+A+LGA AS+ + L+G+ S   ++ ++ 
Sbjct: 509 QCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSALSVSRKSS 568

Query: 535 LW-----------STMNKMTKVGSYIMPVPKDHP 557
           +            S ++K  ++G   +P P   P
Sbjct: 569 IAGEPANAGQPKKSAVSKFGQLGGDDLPSPYTAP 602

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 38/52 (73%)

Query: 533 NILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVD 584
           + +W+ M  MT  G  + P  +++ DR+LL+AKYKIFLDMA+ Q++YR IVD
Sbjct: 669 DAMWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVD 720

>Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {ON}
           YDR109C - Hypothetical ORF [contig 176] FULL
          Length = 725

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/574 (58%), Positives = 444/574 (77%), Gaps = 18/574 (3%)

Query: 2   EKDIYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFC 61
           ++ + YYIGVDVGTGS RACIID +G I S AE  I R++LK + ITQSSQEIW+AVC C
Sbjct: 29  QQKMLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHC 88

Query: 62  VKKVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALK 121
           VK VV + G   +++ GIGFDATCSLVVV++ +N+ VAVGPDF ++NQ+IILWMDHRA++
Sbjct: 89  VKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIE 148

Query: 122 ETKEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGR 181
           ET++IN+T D+CLKYVGGQMS+EME+PKIKWLK H+  + F  C+F+DLADYLTFKA+G+
Sbjct: 149 ETEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGK 208

Query: 182 KTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGS-HGRNF 240
           +TRSFCS VCKQG++P+GVEGSK GWS++FL  I LE+   +D+ K+GGSV  S  G+NF
Sbjct: 209 ETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNF 268

Query: 241 LTAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGT-VDLEQLFR-----V 294
           L+AGE++  ++    EEL LS  C+VGSG+IDAYAGW+GTV + T V +  L +     V
Sbjct: 269 LSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKV 328

Query: 295 GMANAIGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQH 354
           GM  A GRLAAVAGTSTCHI +S+DPIFV GVWGPY+D +   +WC EGGQSCTGALL H
Sbjct: 329 GMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAH 388

Query: 355 VLQTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRS 414
           V+ THP+Y EL ++++   ++KFDYLN+RL  +A++   RSV+ LA+H+FFYGD HGNRS
Sbjct: 389 VMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRS 448

Query: 415 PLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGG 474
           P+ADPSM+ AI+G SMD S+D+LA  YL ACEFIAQQ RQI+E M  +GH+++AI+MSGG
Sbjct: 449 PIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGG 508

Query: 475 QCRNSLLMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENI 534
           QCRN LLM+LLADC+GL ++IP YID+AVVFG+A+LGA AS+ + L+G+ S+  ++ ++ 
Sbjct: 509 QCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSELSVSRKSS 568

Query: 535 LW-----------STMNKMTKVGSYIMPVPKDHP 557
           +            S ++K+ + GS  +P P   P
Sbjct: 569 IAGHPTDGSQPKKSAVSKLGQFGSDDLPSPYTAP 602

 Score = 70.1 bits (170), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 40/55 (72%)

Query: 533 NILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVE 587
           + +W+ M  MT  G  + P P+D+PDR LLD KYKIFLDMA+ Q++YR +V+ VE
Sbjct: 669 DAMWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVE 723

>NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257
          Length = 596

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/584 (57%), Positives = 441/584 (75%), Gaps = 7/584 (1%)

Query: 7   YYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKKVV 66
           YY+G+DVGTGSVRAC++D  G + S  E SI+R+ELK + ITQS++EIW+A CFCVK  +
Sbjct: 16  YYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAI 75

Query: 67  NELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETKEI 126
            +    +  V GIGFDATCSLV ++K T++ V VGP+F + + ++ILWMDHRA+KE  EI
Sbjct: 76  EQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEI 135

Query: 127 NSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTRSF 186
           N+TND+CLKYVGG MS+EM++PKIKWLK +M  ++F +CEF++LADYLTFKATG++TRSF
Sbjct: 136 NATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSF 195

Query: 187 CSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLTAGEY 246
           CSVVCKQG +P GVEGS  GWSK+FL +I LE+L  N Y  LGG++      NF ++G+ 
Sbjct: 196 CSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQSSGKC 255

Query: 247 IAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGS---GTVDLEQLFRVGMANAIGRL 303
           + PL+++A+ EL LS+ C+VG+GIIDAYAG +GT+ +   G+  ++    +G+ NAIGRL
Sbjct: 256 LGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKNDSSIGLQNAIGRL 315

Query: 304 AAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHPSYK 363
           A+VAGTSTCH++LSKDP+FVPGVWGPY+D +  GYWC EGGQ+CTG LL +VL  HP++K
Sbjct: 316 ASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIHPAFK 375

Query: 364 ELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPSMKG 423
           EL   S    ++KF YLN  L E+  +    S L LAKHIFFYGD  GNRSP ADP M  
Sbjct: 376 ELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADPMMSA 435

Query: 424 AIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSLLMK 483
           AI+G SM+ +L+NLA TYLAACEFIAQQ RQI+E +  AG  +S IYMSGGQCRN LLMK
Sbjct: 436 AIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNKLLMK 495

Query: 484 LLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENILWSTMNKMT 543
           LL+DC+GL +++P+Y+D+AVVFGAAILGA+A    +    E D       +LW TM++MT
Sbjct: 496 LLSDCTGLPIMLPKYVDAAVVFGAAILGATADASRKSVEIECDFGF----MLWETMDRMT 551

Query: 544 KVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVE 587
             G+ + P   +HPDR LLD KY+IFLDMA+ Q++YR +VD ++
Sbjct: 552 PHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDID 595

>SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein of unknown function and similar to
           uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 739

 Score =  719 bits (1857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/530 (63%), Positives = 422/530 (79%), Gaps = 9/530 (1%)

Query: 1   MEKD-IYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVC 59
           ME++ + YY+GVDVGTGS RACIID++G I S AE  I RQELK   ITQSSQEIW A+C
Sbjct: 27  MEQNKMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAIC 86

Query: 60  FCVKKVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRA 119
           +CVK VV + G   +++ GIGFDATCSLVVV+  +++ VAVGPDF ++ Q+IILWMDHRA
Sbjct: 87  YCVKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRA 146

Query: 120 LKETKEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKAT 179
           + ETKEIN+TND+CLKYVGGQMS+EME+PKIKWLK ++ ++ F +C+F+DLADYLTFKAT
Sbjct: 147 IDETKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKAT 206

Query: 180 GRKTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVS--GSHG 237
           G +TRS+CS VCKQG++P+GVE SK GWSK+FL NI LE+L  +D+ KLGGS+   GS G
Sbjct: 207 GLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLGGSIKSDGSGG 266

Query: 238 RNFLTAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGT-VDLEQLF---- 292
             FL+AGE I  L+  A EEL L   C+VGSG+IDAYAGW+GTV + T VD+ +L     
Sbjct: 267 STFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADN 326

Query: 293 -RVGMANAIGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGAL 351
            + G+ +A GRLAAVAGTSTCHI +SKDPIFV GVWGPY+D +  G+WC EGGQSCTGAL
Sbjct: 327 EKTGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGAL 386

Query: 352 LQHVLQTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHG 411
           L HVL  HP+Y EL  +S+   ++KFDYLN+RL  + ++   RSV+ LAKH+FFYGD HG
Sbjct: 387 LAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHG 446

Query: 412 NRSPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYM 471
           NRSP+ADPSM+ A++G SMD S+D+LA  YL ACEFIAQQ RQI+E M  +GH I+AI+M
Sbjct: 447 NRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFM 506

Query: 472 SGGQCRNSLLMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLN 521
           SGGQCRN LLM+LLADC+GL ++IP YID+AVVFG+A+LGA AS+ + LN
Sbjct: 507 SGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLN 556

 Score = 80.5 bits (197), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 54/93 (58%), Gaps = 4/93 (4%)

Query: 496 PEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENILWSTMNKMTKVGSYIMPVPKD 555
           PE  ++A+ FG+      A+   QL   +  +     + LW  M  MT  G  + P   D
Sbjct: 641 PEEANAALSFGSK----KATAQEQLALEKEKSASGKGDALWDVMYNMTGGGKVVQPSSDD 696

Query: 556 HPDRILLDAKYKIFLDMADRQKRYRAIVDAVED 588
           HPDR+LLDAKYKIFLDMA+ Q+RYR  VD VE+
Sbjct: 697 HPDRVLLDAKYKIFLDMAETQRRYREAVDKVEN 729

>Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON}
           (24389..26173) [1785 nt, 595 aa]
          Length = 594

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/587 (56%), Positives = 435/587 (74%), Gaps = 6/587 (1%)

Query: 7   YYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKKVV 66
           +YIGVDVGTGSVRAC+I+D G I S     I ++ELK + ITQSS+EIW+ +C CV  V+
Sbjct: 3   HYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNYVL 62

Query: 67  NELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETKEI 126
            E       V GIGFDATCSLVV+DK T + V VGP+F D N++IILWMDHRA+KET EI
Sbjct: 63  QESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETDEI 122

Query: 127 NSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTRSF 186
           N+T D+CLKYVGG+MS+EMELPKIKWLK +++  VF+ C+F+DL DYLT+KAT +  RSF
Sbjct: 123 NATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVRSF 182

Query: 187 CSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSH-GRNFLTAGE 245
            S VCKQG++P+GVEGS +GWSK+F   IDL+EL+ ++++ +GGS+       N  + GE
Sbjct: 183 SSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSVGE 242

Query: 246 YIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGS-----GTVDLEQLFRVGMANAI 300
           Y+  L++ + +EL L   CIVGSGIIDAYAGW+GTV +     GT++ +      + ++I
Sbjct: 243 YVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSKLDSSI 302

Query: 301 GRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHP 360
           G LA +AGTSTCHI LS  PIFV G+WGPY+D ++  +WC EGGQSCTGALL+H+L THP
Sbjct: 303 GNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTTHP 362

Query: 361 SYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPS 420
           +Y EL E  EK+ +  F++LN RLAE+ K ++ RS++ L KH F YGD HGNRSP++D S
Sbjct: 363 AYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISDES 422

Query: 421 MKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSL 480
           M+ AI+G SMDTS+D+LA  YL+ACEFI+QQ+RQII  +  AGH I  IYMSGGQ RN L
Sbjct: 423 MRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARNQL 482

Query: 481 LMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENILWSTMN 540
           LM+LLADC+GL V+IP YID++V+FG+AILGA A   Y +   + +   +    LW+ M 
Sbjct: 483 LMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKHLDGNKNWDHGKTLWNKMC 542

Query: 541 KMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVE 587
           K+T  G+ I P   +HPDR+LL+AKYKIFLDMA+ Q++YR  +D +E
Sbjct: 543 KLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIE 589

>KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]
           {ON} similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 763

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/524 (63%), Positives = 416/524 (79%), Gaps = 10/524 (1%)

Query: 2   EKDIYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFC 61
           E+ + YY+GVDVGTGS RAC+ID+LG I S AE  I R ELK + ITQSSQEIW A+C+C
Sbjct: 31  ERKMVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYC 90

Query: 62  VKKVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALK 121
           VK VV + G     + GIGFDATCSLVVVD   N  V VGPDF D+ Q+IILWMDHRA++
Sbjct: 91  VKNVVRDSGVDPRTIHGIGFDATCSLVVVDN-NNEDVGVGPDFTDNLQNIILWMDHRAIE 149

Query: 122 ETKEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGR 181
           ET+EIN+T D+CLKYVGGQMS+EME+PKIKWLK ++ +  FA+C+F+DLADYLTFKATG 
Sbjct: 150 ETEEINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGS 209

Query: 182 KTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFL 241
           + RS+CS VCKQG++P+GVEGSK GWSK+FL+ I LEEL  +D+AKLGGSV+ +    FL
Sbjct: 210 EIRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTET---TFL 266

Query: 242 TAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGT-VDLEQLFRV-----G 295
           +AGE I  L +++  EL LS  C+VGSG+IDAYAGW+GTV + T V++  L +      G
Sbjct: 267 SAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHG 326

Query: 296 MANAIGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHV 355
           +  A GRLAAVAGTSTCHI +SKDPIFV GVWGPY+D +  G+W  EGGQSCTGALL HV
Sbjct: 327 IDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHV 386

Query: 356 LQTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSP 415
           L THP+Y EL ++S+   ++KFDYLN+RL  +A++    SV+ LAKH+FFYGD HGNRSP
Sbjct: 387 LTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSP 446

Query: 416 LADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQ 475
           +ADPSM+ AI+G SMD S+D+L+  YL ACEFIAQQ RQI+E MC++GHE++AI+MSGGQ
Sbjct: 447 IADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQ 506

Query: 476 CRNSLLMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQ 519
           CRN LLM+LLADC+GL ++IP YID+AVVFG+A+LGA AS+ + 
Sbjct: 507 CRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFN 550

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 40/57 (70%)

Query: 531 TENILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVE 587
           T++ LW  M  MT  G  + P  +D PDR+LL+AKYKIFLDMA  Q++YR +VD V+
Sbjct: 707 TKDKLWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEVK 763

>ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 730

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/535 (61%), Positives = 412/535 (77%), Gaps = 9/535 (1%)

Query: 1   MEKDIYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCF 60
           +E+ + YYIGVDVGTGS RAC+ID +G I S AE  I R+ELK   ITQSS+EIW A+C+
Sbjct: 27  LEQRMIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICY 86

Query: 61  CVKKVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRAL 120
           CVK VV + G   +++ GIGFDATCSLV V+      V VGPDF + +Q+IILWMDHRA+
Sbjct: 87  CVKTVVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAV 146

Query: 121 KETKEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATG 180
           +ET EINSTN   LKYVGGQMSIEME+PKIKWLK HM ++ F    F+DLAD+LT+KATG
Sbjct: 147 QETAEINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATG 206

Query: 181 RKTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGS---HG 237
             TRSF S VCKQG++P+GVEGS  GWS +FL  IDL EL  ND+AKLGGSV      H 
Sbjct: 207 LGTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHR 266

Query: 238 RNFLTAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGT-VDLEQLFR--- 293
            NFL+AG+Y+  L+ +A  +L L+  C+VGSG+IDAYAGW+GTV + T  ++ +L +   
Sbjct: 267 SNFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEK 326

Query: 294 --VGMANAIGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGAL 351
             +G+  A GRLAAVAGTSTCH+ LS+DPIFVPGVWGPY+D +  G+WC EGGQSCTGAL
Sbjct: 327 GKLGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGAL 386

Query: 352 LQHVLQTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHG 411
           L HVL THP+Y +LE +SE  G++KFDYLN+RL  +     ERSV+ LAKH+FFYGD HG
Sbjct: 387 LAHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHG 446

Query: 412 NRSPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYM 471
           NRSP+AD +M+ AI+G SMD S+D+LA  YL ACEFIAQQ RQI+E MC +GH IS+I+M
Sbjct: 447 NRSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFM 506

Query: 472 SGGQCRNSLLMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESD 526
           SGGQCRN LLM+LLADC+GL +IIP YID+AVVFG+A+LGA AS+ Y  + +++D
Sbjct: 507 SGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTD 561

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 67/128 (52%), Gaps = 9/128 (7%)

Query: 462 AGHEISAIYMSGGQCRNSLLMKLLADCS-GLSVIIPEYIDSAVVFGAAILGASASKLYQL 520
           A H  S+ +M GG     +     A+ S G ++   E  +  V F       S     Q 
Sbjct: 601 APHATSSSHMGGGSYFPIVGSDAAANLSPGEAIAETEDEEEPVTF------KSVKSTTQE 654

Query: 521 NGSE-SDTVINTENILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRY 579
           N +E +DT  N E  LW  M  MT  G  + P P  +PDR+LL+AKYKIFLDMA+ Q++Y
Sbjct: 655 NLAEKTDTNSNGEE-LWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQY 713

Query: 580 RAIVDAVE 587
           R+ +D VE
Sbjct: 714 RSAIDRVE 721

>TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {ON}
           Anc_8.257 YDR109C
          Length = 726

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/536 (60%), Positives = 417/536 (77%), Gaps = 11/536 (2%)

Query: 1   MEKDIYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCF 60
           +E+ + YY+GVDVGTGS RACIID+ G I S AE  I R+ELK + ITQSSQEIW+++C 
Sbjct: 28  LEQAMIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICH 87

Query: 61  CVKKVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRAL 120
           CVK VV + G   +++ GIGFDATCSLVVVD   ++ V VGP F +++Q+I+LWMDHRA+
Sbjct: 88  CVKSVVRDSGVPVERIHGIGFDATCSLVVVDD-EDKEVGVGPVFANNDQNIVLWMDHRAI 146

Query: 121 KETKEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATG 180
            ET EIN+TND+CLKYVGGQMS+EME+PKIKWLK ++ K+ F +C+F+DLADYLTFKAT 
Sbjct: 147 AETNEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATN 206

Query: 181 RKTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYN----DYAKLGGSVSGSH 236
           + TRSFCS VCKQG++P+GVEGSK GWSKDFL  I+L EL  N    D      + +   
Sbjct: 207 KDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGT 266

Query: 237 GRNFLTAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGT-VDLEQL---- 291
             +FL+AGEY+  L+++A EEL L   C+VGSG+IDAYAGW+GTV + T V+L  L    
Sbjct: 267 THSFLSAGEYVGALDEEAAEELGLPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEAD 326

Query: 292 -FRVGMANAIGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGA 350
             + G+  A GRLAAVAGTSTCHI LS+DP+FV GVWGPY+D +  G+W  EGGQSCTGA
Sbjct: 327 RTKKGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGA 386

Query: 351 LLQHVLQTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLH 410
           LL HV+ THP++ EL  +S+   ++KFDYLN+RL  + ++  +RSV+ LAKH++FYGD H
Sbjct: 387 LLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYH 446

Query: 411 GNRSPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIY 470
           GNRSP+ADPSM+ AI+G SMD S+D+LA  YL ACEFIAQQ RQI+E MCDAGH+IS I+
Sbjct: 447 GNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIF 506

Query: 471 MSGGQCRNSLLMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESD 526
           MSGGQCRN LLM+LLADC+GL +IIP YID+AVVFG+A+LGA AS+ +  + ++S+
Sbjct: 507 MSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFNSHHAKSE 562

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 33/58 (56%), Positives = 41/58 (70%)

Query: 530 NTENILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVE 587
           N  + LW  M +MT  G  + P P+D PDR+LL+AKYKIFLDMAD Q+RYR  +D VE
Sbjct: 664 NNGDALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVE 721

>Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar to
           Ashbya gossypii AGR092W
          Length = 597

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/598 (54%), Positives = 437/598 (73%), Gaps = 18/598 (3%)

Query: 5   IYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKK 64
           + +YIGVDVGT SVRAC++D  GTI S A   I RQE++ + +TQSS EIWRA+CFC++K
Sbjct: 2   LQHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRK 61

Query: 65  VVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETK 124
           ++ +    +D + GIGFDATCSLVV+++VTN+GVAVGP+F+D  QDIILWMDHRA+ E  
Sbjct: 62  IICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVN 121

Query: 125 EINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTR 184
           EINST   CLKYVGG+MSIEM++PKIKWLK ++ +  F +CEFYDL D+LT++ATG K R
Sbjct: 122 EINSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCR 181

Query: 185 SFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLTAG 244
           SFCS VCK G++P+GV+GS  GW +D   +I L EL   +++KLGG VS S   NFL+AG
Sbjct: 182 SFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVS-STASNFLSAG 240

Query: 245 EYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRVGMANAIGRLA 304
           +Y+  L+D+A  +L L+ +CIV SG+IDAYAGW+GT+ +G           +A++  RLA
Sbjct: 241 DYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQESELASS--RLA 298

Query: 305 AVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHPSYKE 364
            VAGTSTCHI +SK P F+ GVWGPY+D +  GYW TEGGQSCTGALL HVL++HP+Y  
Sbjct: 299 TVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHPAYDT 358

Query: 365 LEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPSMKGA 424
           L ++++  G++KFD++N RL E+ +    +SV  L KH+FFYGD HGNRSP+ADP+M+  
Sbjct: 359 LCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPNMRAT 418

Query: 425 IVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSLLMKL 484
           I+G SMD S+D+LA   L ACEFIAQQ RQI+E +  +GHEI++IYMSGGQCRN +L+KL
Sbjct: 419 IIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVLIKL 478

Query: 485 LADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINT------------- 531
           LA+C+ L +++P+YID+AVVFG+A+LG +AS+ Y L+G      ++T             
Sbjct: 479 LANCTKLPIVLPKYIDAAVVFGSALLGVAASEKY-LHGCSDTASVSTIVDQQRITSELKP 537

Query: 532 -ENILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVED 588
            ++ILW+ M  +T +G  I P      +  LLD KY+IFLDM + QKRYR +V   E+
Sbjct: 538 KQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRAEN 595

>KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON}
           Anc_8.257 YDR109C
          Length = 605

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/588 (55%), Positives = 434/588 (73%), Gaps = 12/588 (2%)

Query: 4   DIYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVK 63
           D +++IGVDVGTGSVRAC+ID  G I +  +  I R+ELK   ITQSS+EIW ++CFCV+
Sbjct: 17  DNFHFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVR 76

Query: 64  KVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKET 123
           KV+ +     ++V GIGFDATCSL VVDK T  G+AVGP F+ ++Q+II+WMDHRA +ET
Sbjct: 77  KVIADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQET 136

Query: 124 KEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKT 183
            EINS  D  LKYVGG+MSIEME+PKIKWLK HM ++ F +  F+DL DYLTFKATG + 
Sbjct: 137 DEINSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQN 196

Query: 184 RSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLTA 243
           RS CS VCKQG++P+GVEGS  GWS+ FL N  L EL  N++ ++GG   G++ RNFL+A
Sbjct: 197 RSLCSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGP--GNNSRNFLSA 254

Query: 244 GEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRV-------GM 296
           GEY++ L+  + E+L L++ C+VGSG+IDAYAG +GT+ +    +++  R         +
Sbjct: 255 GEYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAA---RIDESARTQDDANGQDL 311

Query: 297 ANAIGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVL 356
            NAIGRLAAVAGTSTCHI LS  PIFV GVWGPYKD + K YWC EGGQSCTG LL+HV+
Sbjct: 312 QNAIGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVI 371

Query: 357 QTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPL 416
            THP+Y+EL+  + K+ ++ F+ LN  + ++A++    ++L L K +F YGD HGNRSP+
Sbjct: 372 TTHPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPI 431

Query: 417 ADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQC 476
           ADP M+ +I+G SMDT++++LA  YLAACEFIA Q R II  M +AGH I +IYMSGGQC
Sbjct: 432 ADPRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQC 491

Query: 477 RNSLLMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENILW 536
           RN++LM+LLAD +GL V+IP+YID+AVVFGAA++GA+A  ++    +  D V   E+ LW
Sbjct: 492 RNNILMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFNQCETNDDRVPQVEHTLW 551

Query: 537 STMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVD 584
           + M KMT  G+ I P    H  + LL+ KYKI++DMA  QK+YR+++D
Sbjct: 552 NAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLID 599

>YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON}
           Putative kinase
          Length = 715

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/517 (60%), Positives = 408/517 (78%), Gaps = 10/517 (1%)

Query: 7   YYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKKVV 66
           +Y+GVDVGTGS RAC+ID  G + S AE  I R++L ++ ITQSS+EIW AVC+CV+ VV
Sbjct: 39  FYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVV 98

Query: 67  NELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETKEI 126
            E G   ++V+GIGFDATCSLVVV       +AVGPDF +++Q+IILWMDHRA+KET+EI
Sbjct: 99  EESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEI 158

Query: 127 NSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTRSF 186
           NS+ D+CLKYVGGQMS+EME+PKIKWLK ++   +F  C+F+DL DYLTFKATG++ RSF
Sbjct: 159 NSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSF 218

Query: 187 CSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLTAGEY 246
           CS VCKQG +P+GVEGS +GWSK+FL +I L ELT ND+ +LGGS+     +NFLTAGE 
Sbjct: 219 CSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSL--REKKNFLTAGEC 276

Query: 247 IAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGS-------GTVDLEQLFRVGMANA 299
           I+PL+ +A  +L L++ C+V SGIIDAYAGW+GTV +       G  + E  ++     A
Sbjct: 277 ISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETEN-YKKDFNGA 335

Query: 300 IGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTH 359
           IGRLAAVAGTSTCHI+LSK+PIFV GVWGPY+D + +G+W  EGGQSCTG LL H++ TH
Sbjct: 336 IGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTH 395

Query: 360 PSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADP 419
           P++ EL  ++   G++KF+YLN  L  + ++   RSV+ LAKH+FFYGD HGNRSP+ADP
Sbjct: 396 PAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADP 455

Query: 420 SMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNS 479
           +M+  I+G SMD S+++LA  YL+ACEFI+QQ RQIIE M  +GHEI+AI+MSGGQCRNS
Sbjct: 456 NMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNS 515

Query: 480 LLMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASK 516
           LLM+LLADC+GL ++IP Y+D+AVVFG+A+LGA+AS+
Sbjct: 516 LLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASE 552

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (65%)

Query: 530 NTENILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVE 587
           N  + LW  M ++T     + P  K HPDRILLD KY+IFLDM + Q++YR +VD VE
Sbjct: 653 NGTSFLWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVE 710

>Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON}
           YDR109C (REAL)
          Length = 714

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/529 (60%), Positives = 407/529 (76%), Gaps = 16/529 (3%)

Query: 2   EKDIYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFC 61
           + ++ +Y+GVDVGTGS RACIID  G + S AE  I R+EL+ + ITQSS+EIW AVC C
Sbjct: 34  DPEVKFYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHC 93

Query: 62  VKKVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALK 121
           VK V+ E     D+V G+GFDATCSLVVV     +GVAVGPDF  ++Q+IILWMDHRA+K
Sbjct: 94  VKAVIQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMK 153

Query: 122 ETKEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGR 181
           ET+EINS+ D+CLKYVGGQMS+EME+PKIKWLK ++  ++F  C+F+DL DYLTFKATG+
Sbjct: 154 ETEEINSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGK 213

Query: 182 KTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFL 241
           + RSF S VCKQG +P GVEGS LGWS++FL  I L EL  +D+ KLGGS+   H +NFL
Sbjct: 214 ENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLR--HKKNFL 271

Query: 242 TAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRVGMAN--- 298
           +AGE I  L+ +A  EL L++ C+V SG+IDAYAGW+GTV +     E   R G+A    
Sbjct: 272 SAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKP---ESPIR-GLAENED 327

Query: 299 -------AIGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGAL 351
                  AIGRLAAVAGTSTCHI+LSKDPIFV G+WGPY+D + +G+W  EGGQSCTG L
Sbjct: 328 NTYNYNGAIGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVL 387

Query: 352 LQHVLQTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHG 411
           L HV++ HP+Y EL +++   G++KF+YLN+ L  M K+ NERSV+ LA+H+FFYGD HG
Sbjct: 388 LDHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHG 447

Query: 412 NRSPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYM 471
           NRSP+AD +M+  I+G SMD S+++LA TYL+ACEFI+QQ RQI+E M  +GH+I AI+M
Sbjct: 448 NRSPIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFM 507

Query: 472 SGGQCRNSLLMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQL 520
           SGGQCRN LL +LLADCSGL ++IP YID AVVFG+A+LGA+AS+ + L
Sbjct: 508 SGGQCRNDLLTRLLADCSGLPIVIPRYIDGAVVFGSALLGAAASEAFDL 556

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 38/55 (69%)

Query: 534 ILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVED 588
           ILW  M ++T     + P    HPDRILLD KY+IFLDMA+ QKRYR +VD +E+
Sbjct: 656 ILWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLEE 710

>Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON}
           YDR109C (REAL)
          Length = 704

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/604 (53%), Positives = 428/604 (70%), Gaps = 41/604 (6%)

Query: 2   EKDIYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFC 61
           E +  +Y+GVDVGTGS RACIID  G I S AE  I R+EL ++ ITQSS+EIW AVC+C
Sbjct: 25  ESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYC 84

Query: 62  VKKVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALK 121
           V+KV+ E G    ++ GIGFDATCSLVVV     + +AVGPDF +++Q+IILWMDHRA+K
Sbjct: 85  VRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMK 144

Query: 122 ETKEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGR 181
           ET+EIN + + CLKYVGGQMS+EME+PKIKWLK ++   +F  C+F+DL DYLTF+ATG+
Sbjct: 145 ETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGK 204

Query: 182 KTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFL 241
           + RSF SVVCKQG +P GVEGS LGWSK FL +I L ELT ND+ KLGGS+     +NFL
Sbjct: 205 ENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQ--KNFL 262

Query: 242 TAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGS-------GTVDLEQLFRV 294
           +AGE I PL+ +A  +L L++ C+V SGIIDAYAGW+GTV +       G  + E  ++ 
Sbjct: 263 SAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENED-YKH 321

Query: 295 GMANAIGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQH 354
               AIGRLAAVAGTSTCHI+LSK  IFV G+WGPY+D + +G+W  EGGQSCTG LL H
Sbjct: 322 DFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDH 381

Query: 355 VLQTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRS 414
           V+ THP++ +L ++++   ++KF+YLN+ L  + ++  ERSV+ LAKH+FFYGD  GNRS
Sbjct: 382 VITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNRS 441

Query: 415 PLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGG 474
           P+ADP+M+  I+G SMD S+D+LA  YL ACEFI+QQ RQIIE M  +GH I+A++MSGG
Sbjct: 442 PIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSGG 501

Query: 475 QCRNSLLMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLN------GSESDTV 528
           QCRN LLM+LLADC+GL ++IP YID AVVFG+A+LGA+ASK++ LN       S+  ++
Sbjct: 502 QCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFDLNKRRRVIKSKKSSL 561

Query: 529 INTE-------------------------NILWSTMNKMTKVGSYIMPVPKDHPDRILLD 563
           + TE                          +  S +N   +  S + P+ K+ P  ++ D
Sbjct: 562 VQTEFLEGLYPSIQNLPLENHSTNVVASYKLACSNLNAPARTSSDLFPISKEQPADMISD 621

Query: 564 AKYK 567
              K
Sbjct: 622 KSSK 625

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 39/57 (68%)

Query: 532 ENILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVED 588
           +NILW  M ++T     I P  K HPDRILLD KY+IFLDM + Q+ YR +VD VE+
Sbjct: 644 KNILWKVMQELTGNAKVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVEE 700

>CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {ON}
           similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109c
          Length = 577

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/579 (54%), Positives = 419/579 (72%), Gaps = 9/579 (1%)

Query: 7   YYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKKVV 66
           YYIGVDVG+GSVRAC++DD G + S A   I ++E     +TQSS EIW AVC+CVK  +
Sbjct: 3   YYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSAI 62

Query: 67  NELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETKEI 126
                    + GIGFDATCSLVV++K +   VA GP+F+++NQ+II+WMDHRA++ETKEI
Sbjct: 63  GNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETKEI 122

Query: 127 NSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTRSF 186
           N + D CLKYVGGQMS+EME+PKIKWLK HM+ + F +  F DL DYLTF A+G  TRS+
Sbjct: 123 NRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTRSY 182

Query: 187 CSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLTAGEY 246
           CS VCKQG +P GVEGS  GWS +FL  I LEE++ +++  LGG    +   NF  AG  
Sbjct: 183 CSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGP---NESGNFTYAGNQ 239

Query: 247 IAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRV-GMANAIGRLAA 305
           ++ +++  I+   ++  CIVGSGIIDAYAGW+GTV S T+++     V  +    GRLAA
Sbjct: 240 LSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNNKEVVDIEECAGRLAA 299

Query: 306 VAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHPSYKEL 365
           VAGTSTCHIVLSK  IFVPGVWGPY+D +   YWC EGGQS TGALL H+L  HPS  EL
Sbjct: 300 VAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSANEL 359

Query: 366 EEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPSMKGAI 425
             + ++  ++KF +LN  + E+++++N  + L L K  F YGD HGNRSP+ADP+M+ AI
Sbjct: 360 SNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNMRAAI 419

Query: 426 VGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSLLMKLL 485
           +G SMDTS+D+LA+TYLAACEFIA Q + II+ + +AGH I AIYMSGGQCRN++LM+L+
Sbjct: 420 IGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNILMQLI 479

Query: 486 ADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENILWSTMNKMTKV 545
           A+C+GL +IIP+YIDSAVVFG+AILGA A   Y  + + SD      ++LWSTM+ MT  
Sbjct: 480 ANCTGLPLIIPKYIDSAVVFGSAILGAMA---YSSSKNNSDK--GGADLLWSTMSNMTPD 534

Query: 546 GSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVD 584
           G+ + P  +D  +R L++ K+KIFLDMA  Q+ YR +V+
Sbjct: 535 GTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVE 573

>Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON}
           YDR109C (REAL)
          Length = 725

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/520 (60%), Positives = 407/520 (78%), Gaps = 8/520 (1%)

Query: 7   YYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKKVV 66
           +++GVDVGTGS RACIID  G I S AE  I R+E++++ ITQSS+EIW AVC CVK V+
Sbjct: 43  FHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAVL 102

Query: 67  NELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETKEI 126
            E      +V GIGFDATCSLVVV     +G+AVGPDF++++Q+IILWMDHRA+KET+EI
Sbjct: 103 QESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETEEI 162

Query: 127 NSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTRSF 186
           NST D+CLKYVGGQMS+EM++PKIKWLK ++  ++F  C+F++L DYLTFKATG++ RSF
Sbjct: 163 NSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENRSF 222

Query: 187 CSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLTAGEY 246
            S VCKQG +P GVE SKLGWS++FL +I L ELT ND+ +LGGS+     +NFL+AGE 
Sbjct: 223 ASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDK--KNFLSAGEC 280

Query: 247 IAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGT------VDLEQLFRVGMANAI 300
           +  L+  +  EL L++ CIVGSGIIDAYAGW+GTV +        +   +  +  + +AI
Sbjct: 281 VGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSAI 340

Query: 301 GRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHP 360
           GRLAAVAGTSTCHI+LSKDPIFV GVWGPY+D + + +W  EGGQSCTGALL HV++THP
Sbjct: 341 GRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVIKTHP 400

Query: 361 SYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPS 420
           ++ EL ++++   ++ F+YLN+ L  + ++ NERSV+ LAKH FFYGD HGNRSP+ADP+
Sbjct: 401 AFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPIADPN 460

Query: 421 MKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSL 480
           M+  I+G SMD S+++LA TYL ACEFI+QQ RQIIEAM + GH I AI+MSGGQCRN L
Sbjct: 461 MRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQCRNGL 520

Query: 481 LMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQL 520
           LM+LLADC+GL ++IP YID+AVVFG+A+LGA+AS+   L
Sbjct: 521 LMRLLADCTGLPIMIPRYIDAAVVFGSALLGAAASEASDL 560

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 41/58 (70%)

Query: 530 NTENILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVE 587
           N+ ++LW  M ++T     + P  K HPDRILLD KY+IFLDMA+ Q++YR +VD VE
Sbjct: 660 NSGDLLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVE 717

>TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa]
           {ON} Anc_8.257 YDR109C
          Length = 589

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/592 (54%), Positives = 437/592 (73%), Gaps = 17/592 (2%)

Query: 7   YYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKKVV 66
           YYIGVDVGTGS RAC+ID  G I S  EL+I RQELK   ITQS+ +IW  +C C++ ++
Sbjct: 3   YYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRNIL 62

Query: 67  NELGC--TRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETK 124
            E        ++KGIGFDATCSLVV++  T++ VAVGP+F D++Q++ILWMDHRAL ET 
Sbjct: 63  QESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIETV 122

Query: 125 EINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTR 184
           EINST+ +CLKYVGGQMS+EME+PKIKWLK +M+  V+  C+F DL D+LT+KATG   R
Sbjct: 123 EINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNSIR 182

Query: 185 SFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSV-SGSHGR-NFLT 242
           SFCS VCKQG++P+GVEGS  GW+++FL NI LE+L  +++ KLGG V   S G+ +F T
Sbjct: 183 SFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSFST 242

Query: 243 AGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVD-LEQLFRV-----GM 296
           AGE+I  L+D++ + + +S +C V SGIIDAYAGW+GT+ + T + +EQL        GM
Sbjct: 243 AGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLNGM 302

Query: 297 ANAIGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVL 356
             + GRLA VAGTSTCHI L+  PIFVPGVWGPY+D +   +WC EGGQSCTGALLQHVL
Sbjct: 303 ICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQHVL 362

Query: 357 QTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPL 416
           +THP+YKEL  IS++  ++ F+ LN ++ E+  + +    + L K++FFYGD HGNRSP+
Sbjct: 363 ETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRSPV 422

Query: 417 ADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQC 476
           AD +M+G I+GLSMD+SL++L + YL ACEFIAQQ R I++ M  +G+ + ++YMSGGQC
Sbjct: 423 ADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGGQC 482

Query: 477 RNSLLMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENILW 536
           RN LLM+L+++C GL V+IP+ ID+AVVFG+A++GA AS+L +   S SD     + ILW
Sbjct: 483 RNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSK---SHSDNTKKPDQILW 539

Query: 537 STMNKMTKVGSYIMPVPKDHPDRI--LLDAKYKIFLDMADRQKRYRAIVDAV 586
             M KMT  G  I+  P+D   ++  LL  KY+I+LDM   QKRYR++V+ +
Sbjct: 540 DVMCKMT--GQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVNGL 589

>KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.257
           YDR109C
          Length = 580

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/581 (55%), Positives = 404/581 (69%), Gaps = 12/581 (2%)

Query: 7   YYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKKVV 66
           YYIGVDVGTGS RA ++   G   +  E  I RQEL+ D ITQSS EIW AVC CV+ VV
Sbjct: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65

Query: 67  NELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETKEI 126
            + G     VKGIGFDATCSLV VD VT   V VGP+F+DS Q+IILWMDHRA +ET  I
Sbjct: 66  TKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAI 125

Query: 127 NSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTRSF 186
           N+T D CLKYVGGQMS+EMELPKIKWLK HM +  F +C+F+DL DYLTF AT +  RSF
Sbjct: 126 NATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSF 185

Query: 187 CSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLTAGEY 246
           CS VCKQG++P GV+GS+  WS +FL  + L EL   ++ +LGG+        FLTAG+ 
Sbjct: 186 CSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESK--PKFLTAGQP 243

Query: 247 IAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFR-VGMANAIGRLAA 305
           +  L  +A E+  LS  CIV SG+IDAYAGW+G+VG+     +Q  +  G+  AI RLA 
Sbjct: 244 VGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGA---KFDQSHKSSGLDVAITRLAL 300

Query: 306 VAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHPSYKEL 365
           +AGTSTCHI+LSK P FVPGVWGPY+D +  GYWC EGGQSCTGALL H+L+THP+++EL
Sbjct: 301 IAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHPAHEEL 360

Query: 366 EEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPSMKGAI 425
             ++ K  ++ F+YL   L  +  +   R+VL L++  F YGD HGNRSPLADPSM+  +
Sbjct: 361 VRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPSMRATV 420

Query: 426 VGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSLLMKLL 485
           +G SMD S+++LA  YLAACEFIA Q RQI+E M   GH +  +YMSGGQCRNSLLM+L+
Sbjct: 421 IGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSLLMQLI 480

Query: 486 ADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENILWSTMNKMTKV 545
           AD  G+ V++P+Y D  VVFGAA+L   ASK    +G E+D        LW  M  MT +
Sbjct: 481 ADSVGVPVVLPKYTDCCVVFGAALLACCASK--GCDGIEADQSTR----LWDIMTAMTPM 534

Query: 546 GSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAV 586
           G+ ++P      +R  +DAKY IFLDM +RQK YR+ +D V
Sbjct: 535 GTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQV 575

>AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR109C and
           Non-syntenic homolog of Saccharomyces cerevisiae YNL249C
           (MPA43)
          Length = 596

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/589 (52%), Positives = 407/589 (69%), Gaps = 10/589 (1%)

Query: 7   YYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKKVV 66
           YY+GVDVGT   RACIID  G I +  +  I R + K D ITQSS EIW AVC  V+  V
Sbjct: 9   YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAV 68

Query: 67  NELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETKEI 126
            E     D+V GI FDATCSLVV+D+ ++  VAVGPDF+D+ Q++ILWMDHRA+ E  EI
Sbjct: 69  AESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASEI 128

Query: 127 NSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTRSF 186
           NST    L+YVGG+MS+EM++PKIKWL+RHM +  FA+C+FYDL D+LT++ATG ++RSF
Sbjct: 129 NSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRSF 188

Query: 187 CSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLTAGEY 246
           CS VCK G+VP GV+ S  GWS++FL  I LEEL  + + +LGG++    G  F +AGE 
Sbjct: 189 CSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALD-EPGSEFRSAGEP 247

Query: 247 IAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRVGMANAIGRLAAV 306
           +  L++ A   L L+  C+VGSG+IDAYAGW+GTVG+      +    G+    GRLAAV
Sbjct: 248 VGLLSEAAAASLGLTPRCVVGSGVIDAYAGWVGTVGASPDGARE--SGGVEELAGRLAAV 305

Query: 307 AGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHPSYKELE 366
           AGTSTC I+LS+ P FV GVWGPY+D + +GYWCTEGGQSCTGALL H L THP+Y EL 
Sbjct: 306 AGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHPAYTELH 365

Query: 367 EISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPSMKGAIV 426
           + +++ G+  FDY+N RL ++   +  RS+  LAKH F YGD HGNRSPLADPSM+ A+V
Sbjct: 366 QAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSMRAAMV 425

Query: 427 GLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSLLMKLLA 486
           GLSMD S D+LA   L A EFIA Q R I++ M  AG  +  +Y+SGGQ RN LL +LLA
Sbjct: 426 GLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQLLA 485

Query: 487 DCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENI-------LWSTM 539
           D     V+ P ++ +AVVFG+A+L A+A + Y  N + + + I   +        LW  M
Sbjct: 486 DAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRAPMHRLWQIM 545

Query: 540 NKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVED 588
           +++T  G+ + P P   PD  LL+AKYK+FL+MA+ QK YR +VD VE+
Sbjct: 546 SRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVEN 594

>TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.257
           YDR109C
          Length = 585

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/585 (51%), Positives = 409/585 (69%), Gaps = 11/585 (1%)

Query: 8   YIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKKVVN 67
           YIGVDVGTGS RACI +  G I +     I +QEL+   ITQSS EIW A+   +K+V++
Sbjct: 4   YIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVID 63

Query: 68  ELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETKEIN 127
                   + GI FDATCSLVV DK +   +AVGP+F+DSNQ+IILWMDHRA  ET  IN
Sbjct: 64  ISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDLIN 123

Query: 128 STNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTRSFC 187
           STND+ LKYVGG+MS+E ELPKIKWLK H+S + F RC F DLAD+LT+KATG+   SF 
Sbjct: 124 STNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHSFS 183

Query: 188 SVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLTAGEYI 247
           S VCKQG++P GVEGSKLGWSK+FL  I LEEL+ N++ KLGGS++   G NFL  G+ +
Sbjct: 184 SAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEG-NFLIPGDLV 242

Query: 248 APLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDL------EQLFRVGMANAIG 301
             ++ +      L   C+VG+G+IDAY+GW+GTV S   D       ++L ++    ++G
Sbjct: 243 GHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKI--EGSLG 300

Query: 302 RLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHPS 361
           R+A V+GTSTCHIVLSK P+F+ GVWGPY+D + +  W TEGGQS TGALL ++++THP+
Sbjct: 301 RIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPA 360

Query: 362 YKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPSM 421
           Y+ELE I+ +   N F YL+ +L E+       SV  L K++F YGD +GNRSPLADP M
Sbjct: 361 YQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLM 420

Query: 422 KGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSLL 481
            G I+G +MD+S+++LA  YLAACEFIA Q R II+ +   GH I+AIYMSGG C+N LL
Sbjct: 421 SGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLL 480

Query: 482 MKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENILWSTMNK 541
           M+L+++C  L +++ +YIDS+VVFGAAILG+ A+K+  +  ++ +  +N  ++LWS M  
Sbjct: 481 MELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENKLEYSLN--DVLWSQMKL 538

Query: 542 MTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAV 586
           MT  G+ +MP  +    R  L AKY+++LDM D   +YR  ++ V
Sbjct: 539 MTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEV 583

>Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  226 bits (577), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 187/594 (31%), Positives = 293/594 (49%), Gaps = 84/594 (14%)

Query: 9   IGVDVGTGSVRACIID---DLGTIKSQAELSI-HRQELKTDCITQSSQEIWRAVCFCVKK 64
           IG+D+G+ S R  I D   D+    +Q  +   H    K+    Q S EI +A+  C + 
Sbjct: 9   IGIDIGSSSARVGIYDYYNDVLLAMAQEPVPYYHDSSKKSWKFWQKSTEIIKALQNCFQ- 67

Query: 65  VVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETK 124
              EL  T+  V+  G  ATCSL +  K    G  + P  N+ N  +I WMD  A+ E +
Sbjct: 68  ---ELKITQYNVRSCGVSATCSLAIFQKDLTNGNLI-PYPNEDN--VIFWMDSSAVDECE 121

Query: 125 EINST-NDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKT 183
            +N   + + L Y+GG+   EM +PK+K+     S +   +   +DL  Y+ ++  GR  
Sbjct: 122 WLNEKCSQQLLDYLGGKFIPEMGIPKLKYFLNEHSHNQEKQFHIFDLHQYIAYE-LGRLY 180

Query: 184 R-SFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLT 242
           R +   +  ++ +  +G +G   GWS  F          YND  KL  +V         T
Sbjct: 181 RWNTDELSARENINGIGNDGEASGWSSSF----------YNDIMKLPSNV---------T 221

Query: 243 AGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRVGMANAIGR 302
            G  +  LN            CI      D+YA W              F V   N    
Sbjct: 222 IG--LTGLNSNNSSSTTTVCSCI------DSYASW--------------FAVSSPNLEAS 259

Query: 303 LAAVAGTSTCHIVLSKDPIF---VPGVWGPYKDTI--TKG-YWCTEGGQSCTGALLQHVL 356
           L  +AGTSTC++  S  P+    +PGVWGP+ DTI  T G Y     GQSCTG L++H+ 
Sbjct: 260 LFMIAGTSTCYMYGS--PVTTTKIPGVWGPF-DTILETNGNYSVYTAGQSCTGKLIEHLF 316

Query: 357 QTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPL 416
           ++HP+ ++++    ++G + ++ L   + ++ K+ N +S+  LAKH+FFYGD  GNR+P 
Sbjct: 317 KSHPAARKIQ----RSGEDIYEVLENSIQDIEKK-NRKSIHILAKHMFFYGDYEGNRTPF 371

Query: 417 ADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAM--CDAGHEISAIYMSGG 474
           AD  M+G+ +G S DTS+ NL   Y++  EF++ Q + II+     ++G  I  + +SG 
Sbjct: 372 ADSQMRGSFIGESTDTSILNLTYKYVSMLEFLSFQTKLIIDTFQGQNSGARIEELRVSGS 431

Query: 475 QCRNSLLMKLLADCS-GLSVIIP-EYIDSAVVFGAAILGASASKLYQLNG--SESDTVIN 530
           Q +N  L+ L++  + G+ +  P E ID   V GA +LG SA++  Q+     E D   +
Sbjct: 432 QAKNGRLLSLISLVNDGIKIKRPNENIDLMGVMGAYMLGKSANEKKQIIDIIRERDANAD 491

Query: 531 TENILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVD 584
           +E        +    G+Y +        R LL  KY+I LDMA +Q++Y  +VD
Sbjct: 492 SE--------EFEPFGTYQLGNDCILLKR-LLSVKYRIHLDMAKQQQQYHRLVD 536

>Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {ON}
           YNL249C (REAL)
          Length = 569

 Score =  218 bits (556), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 179/592 (30%), Positives = 282/592 (47%), Gaps = 76/592 (12%)

Query: 9   IGVDVGTGSVRACIID---DLGTIKSQAELSIHRQELKTDC-ITQSSQEIWRAVCFCVKK 64
           IG+DVG+ S R  I +   D     +Q  +  ++   +T     Q S EI +A+  C++K
Sbjct: 34  IGIDVGSSSARVGIYNYENDALLGMAQEPVPYYQDSSRTSWKFWQRSTEIIKALQKCLQK 93

Query: 65  VVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETK 124
               L  T   VK  G  ATCSL + +K    G  + P  N+ N  +I WMD  A+ E K
Sbjct: 94  ----LKITEYNVKSCGVSATCSLAIFEKDKRNGSLI-PYPNEDN--VIFWMDSSAIDECK 146

Query: 125 EINST-NDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKT 183
           ++N+  + + L ++GG    EM +PK+K+     S +   +   +DL  Y+ ++ +    
Sbjct: 147 QLNAECSQQLLDFLGGSFVPEMGIPKLKYFLNEYSHNQDKQFHIFDLHQYIAYELSHLYQ 206

Query: 184 RSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLTA 243
            +   ++ ++    +GV+G   GWS  F  NI    L  N        + GS+G      
Sbjct: 207 WNNEVLLKRENNKMVGVDGEASGWSPSFYENI--MHLPSN-------VIIGSNGATC--- 254

Query: 244 GEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRVGMANAIGRL 303
                    + I    + + C      ID+YA W              F V   +    L
Sbjct: 255 ---------KKIASSAIVRSC------IDSYASW--------------FAVSSPHLETSL 285

Query: 304 AAVAGTSTCHIVLSK-DPIFVPGVWGPYKDTI--TKGYWCTEGGQSCTGALLQHVLQTHP 360
             +AGTSTC++  +    I +PGVWGP+   +     +     GQSCTG L++H+  THP
Sbjct: 286 FMIAGTSTCYMYGTPITDIKIPGVWGPFDSILDSNSHFSVYAAGQSCTGKLIEHLFVTHP 345

Query: 361 SYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPS 420
             KE+     K G + +  L   + ++ K+ N +SV    K IFFYGD  GNR+P ADP 
Sbjct: 346 CAKEI----LKRGADIYQVLERTIHDIEKQ-NGQSVHVFTKDIFFYGDYEGNRTPFADPR 400

Query: 421 MKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAM--CDAGHEISAIYMSGGQCRN 478
           MKG+ +G + DTS+ NL   Y+   EF++ Q R II+     + G  I  + +SG Q +N
Sbjct: 401 MKGSFIGETTDTSILNLIHKYICILEFLSFQTRLIIDTFKRQNIGMCIQELRISGSQAKN 460

Query: 479 SLLMKLLADC-SGLSVIIP-EYIDSAVVFGAAILGASASKLYQLNG--SESDTVINTENI 534
             L+ L++   +G+++  P + +D   V GA +L  SA++  Q+     E DT  + E  
Sbjct: 461 KRLLSLISLVNNGITINKPKDNVDLMGVRGAYLLAKSANEGKQIIDVIRERDTSDDNEKF 520

Query: 535 LWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAV 586
                 ++    S +         R LL AKY+I LDMA +Q+RY  ++D V
Sbjct: 521 EPLPEYQLLNDSSLL---------RRLLWAKYRIHLDMAKQQQRYHKLIDEV 563

>YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON}
           MPA43Putative protein of unknown function; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 542

 Score =  210 bits (534), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 170/591 (28%), Positives = 279/591 (47%), Gaps = 74/591 (12%)

Query: 9   IGVDVGTGSVRACII----DDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKK 64
           IG+DVG+ S R  +     D L  +  +          K+    Q S EI +A+  C++K
Sbjct: 9   IGIDVGSSSARIGVYNYYNDALLEMAQEPVPYYQDSSKKSWKFWQKSTEIIKALQKCLQK 68

Query: 65  VVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETK 124
               L     +VK  G  ATCSL + ++     + + P  N+ N  +I WMD  A+ E +
Sbjct: 69  ----LNIREYEVKSCGVSATCSLAIFERDRTSNMLI-PYPNEDN--VIFWMDSSAVNECQ 121

Query: 125 EIN-STNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKT 183
            +N     + L Y+GG+   EM +PK+K+     S         +DL  Y+ ++ +    
Sbjct: 122 WLNMQCPQQLLDYLGGKFVPEMGVPKLKYFLDEYSHLRDKHFHIFDLHQYIAYELSRLYE 181

Query: 184 RSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLTA 243
            +   ++ ++ +  +G +G   GWS  F +NI            L  +VS   G   L A
Sbjct: 182 WNIEGLLGRENLNGIGNDGEVSGWSSSFYKNI----------INLPSNVSI--GTTSLVA 229

Query: 244 GEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRVGMANAIGRL 303
            ++I+                 V    ID+YA W              F V   +    L
Sbjct: 230 NKHIS---------------TTVVRSCIDSYASW--------------FAVASPHLETSL 260

Query: 304 AAVAGTSTCHIV-LSKDPIFVPGVWGPYKDTITKG---YWCTEGGQSCTGALLQHVLQTH 359
             +AGTS+C++   +     +PGVWGP+ DTI      +     GQSCTG L++H+ ++H
Sbjct: 261 FMIAGTSSCYMYGTTISDTRIPGVWGPF-DTILDNRGDFSVYAAGQSCTGKLIEHLFESH 319

Query: 360 PSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADP 419
           P  +++     K+G + +  L   + ++ K +N  S+  L K +FFYGD  GNR+P ADP
Sbjct: 320 PCARKIL----KDGADIYQVLEQTIRDIEK-NNGLSIHILTKDMFFYGDYEGNRTPFADP 374

Query: 420 SMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGH--EISAIYMSGGQCR 477
            +KG+ +G S DTS+ NL   Y+   EF++ Q + II+   +      I  + +SG Q +
Sbjct: 375 RIKGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTFQNENSNIHIKELRISGSQAK 434

Query: 478 NSLLMKLLADC-SGLSVIIP-EYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENIL 535
           N  L+ L++   +G+++I P E +D   + GA +L  SA +  QL    ++  I+ ++  
Sbjct: 435 NERLLSLISLVNNGVAIIKPKENVDMMGIKGAYVLAKSAKEKKQLADVITERDISNDSEK 494

Query: 536 WSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAV 586
           + ++ +       I+        R LL  KY I LDMA +QKRY  +VD V
Sbjct: 495 FESLAEYRLGNDSILL-------RKLLCVKYHIHLDMAKQQKRYHKLVDEV 538

>TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON}
           Anc_1.111 YNL249C
          Length = 543

 Score =  207 bits (527), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 175/595 (29%), Positives = 285/595 (47%), Gaps = 76/595 (12%)

Query: 9   IGVDVGTGSVRACII---DDLGT--IKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVK 63
           IG+D+G+ SVR  +    DDL    +K +     H      +  TQS+ EI + +  C+ 
Sbjct: 6   IGIDLGSSSVRVGLFTLEDDLMVQCVKQKISYYYHGDSALWE-YTQSTDEIMKVIERCL- 63

Query: 64  KVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKET 123
              ++L      +K  G  ATCS+ +  K  N             Q++I WMD+ +  E 
Sbjct: 64  ---HDLKIDEYNIKSCGVSATCSMALFIKEHNHLEPFNTISGSHRQNVIFWMDNSSKTEC 120

Query: 124 KEINSTNDECLK-YVGGQMSIEMELPKIKWLKRHM-SKDVFARCEF--YDLADYLTFKAT 179
           K +N+  ++ L+ ++GG+   EM +PKI  L  ++ S D          DL  YL ++  
Sbjct: 121 KLLNNLCEKRLRDFMGGKFIPEMGIPKINRLINYLKSSDDLQNLSVVAMDLHRYLAYEIA 180

Query: 180 GRKTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRN 239
            R   +F  ++       +G +G   GWS  F          Y D  K+  ++       
Sbjct: 181 KRFKWNFDRLLNTTNFNEIGHDGELSGWSSKF----------YIDTLKIPSNI------- 223

Query: 240 FLTAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRVGMANA 299
             T G    PL D    + E  K  +  +  ID Y+ WL ++ S T + E LF VG    
Sbjct: 224 --TIGPE-PPLED----DFEYCKGIV--ASCIDCYSSWL-SLCSPTPE-ESLFIVG---- 268

Query: 300 IGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTI--TKGYWCTEGGQSCTGALLQHVLQ 357
                   GTSTC++  +     +PGVWGP+ D +  +  Y   EGGQSCTG L++H+LQ
Sbjct: 269 --------GTSTCYLYATTRMKTIPGVWGPFTDILDNSNTYAVYEGGQSCTGKLIEHLLQ 320

Query: 358 THPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLA 417
           THP+      I++ +     + +   ++ + +++  RS+    KH+FFYGD  GNR+P A
Sbjct: 321 THPASSS---IAKDDWPLLLEKIEQEISAIEEQTG-RSIHFKTKHMFFYGDFQGNRTPYA 376

Query: 418 DPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHE--ISAIYMSGGQ 475
           DP M G  +G + D S +NL   Y+   EF+A Q + +I     A  +  I+ I + G Q
Sbjct: 377 DPEMSGMTIGETTDVSFNNLILRYICILEFLAFQIKYMISIFNKAQGQDKITEIRICGSQ 436

Query: 476 CRNSLLMKLLADC-SGLSVIIPEY-IDSAVVFGAAILGASASKLYQLNGSESDTVINTEN 533
            +N  L+ L++    G ++ +P+  ++ + V GA +LG SA     LN S  D +   ++
Sbjct: 437 AKNKRLLSLISLLHEGGTIKLPKTDVELSGVSGAFLLGKSA----LLNKSPLDLIQEKDD 492

Query: 534 ILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVED 588
                     +V  +  P   + P  +LL+AKY+I LDMA +Q  YR +++ + +
Sbjct: 493 --------QKQVDIFETPSSINQPLSMLLEAKYEIHLDMAKQQLIYREMINKIPE 539

>ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein
          Length = 542

 Score =  202 bits (515), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 163/590 (27%), Positives = 265/590 (44%), Gaps = 79/590 (13%)

Query: 9   IGVDVGTGSVRACII----DDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKK 64
           IG+D+G+ SVR  +     D +   K +        E      TQSS+EI  A+  C + 
Sbjct: 10  IGIDLGSSSVRVSLFNFQNDQIIAYKIKTVPYYFTPESTNWKYTQSSREILTAIDQCFQ- 68

Query: 65  VVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETK 124
              EL   + ++K  G  ATCSL +    T     +  + +D +++++ WMD  A+KET+
Sbjct: 69  ---ELNIDKHEIKSCGVGATCSLAIFQ--TKDNALIPWNLDDPDKNVVFWMDSIAIKETQ 123

Query: 125 EINS-TNDECLKYVGGQMSIEMELPKIK-WLKRHMSKDVFARCEFYDLADYLTFKATGRK 182
           E+N     E   ++GG    EM +PK++ ++    + D  +  E  DL  Y+      + 
Sbjct: 124 EVNKLATPEVQAHMGGSFVPEMAVPKLRHFIDILKNTDNNSTFEIIDLHRYIAMSLAQQN 183

Query: 183 TRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLT 242
              + +V     +  +G +G   GWS  F  N+    L       +G +    H      
Sbjct: 184 GWDYTNVCNFPNLNEIGHDGELAGWSSAFYENV----LQLPPNIVIGPTKHSQHS----- 234

Query: 243 AGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRVGMANAIGR 302
                             SK+ +  S  ID Y+ W   + S              N    
Sbjct: 235 ------------------SKQGLKVSSCIDCYSNWFALLPS--------------NLQNS 262

Query: 303 LAAVAGTSTCHIVLSKD-PIFVPGVWGPYKDTITKG--YWCTEGGQSCTGALLQHVLQTH 359
           L  V GTSTC++  S +    +PGVWGP+ +   +   +   E GQSCTG L++H+ +TH
Sbjct: 263 LFIVGGTSTCYLYASSEFSHHIPGVWGPFSNIFDRSDQFSIYEAGQSCTGKLIEHLFKTH 322

Query: 360 PSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADP 419
           P+      I  ++  + F  +N    E  +++ + S+    KH+FFYGDL GNR+P ADP
Sbjct: 323 PASSH---IDTRDWPHLFSQIND-FIEKVEQNTQDSIHMQTKHMFFYGDLDGNRTPYADP 378

Query: 420 SMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAM--CDAGHEISAIYMSGGQCR 477
           SM G  +G + DTS  NL   Y++  EFIA Q + ++      +   +IS +   G   +
Sbjct: 379 SMSGMFIGETTDTSFRNLVYKYVSILEFIAFQIKHMLAIFNTLNGDEDISNLQFCGSLAK 438

Query: 478 NSLLMKLLADCSGLSVI-IPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENILW 536
           N  L+ LLA  +    I +PE          A++GA  S L     +   +++   +   
Sbjct: 439 NKRLLNLLALLNPRLRIAMPE-------MDVALMGAYGSYLMGKASTSDKSIVEVAH--- 488

Query: 537 STMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAV 586
                  +  SY  P   D     LL+ KY+I+ +MA++Q++YR  V+ V
Sbjct: 489 ------NQTYSYRPPEKTDGLLVELLEVKYQIYFNMAEQQRKYRKQVNNV 532

>Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  197 bits (501), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 172/598 (28%), Positives = 278/598 (46%), Gaps = 88/598 (14%)

Query: 9   IGVDVGTGSVRACII---DDLGTIKSQAELSIHRQELKTDC-ITQSSQEIWRAVCFCVKK 64
           IG+D+G+ S R  I    +D     +Q  +  ++   K      Q S EI  A+  C +K
Sbjct: 9   IGIDLGSSSARVGIYSYYNDALLGMAQEPVPYYQDFTKKSWKFWQKSTEIIEALQKCFQK 68

Query: 65  VVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETK 124
               L  T   VK  G  ATCSL + ++V +   A+ P  N++N  +I WMD  A  E +
Sbjct: 69  ----LKITEYNVKSCGVSATCSLAIFERV-HTSEALIPYPNENN--VIFWMDSSATDECE 121

Query: 125 EINST-NDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKT 183
            +N+  + + L Y+GG+   EM +PK+K+     S     R   +DL  Y+ ++      
Sbjct: 122 WLNAECSKQLLDYLGGRFVPEMGIPKLKYFLNEYSHRQDKRFHIFDLHQYIAYELGRLYQ 181

Query: 184 RSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLTA 243
            +   ++  + +  +G +G   GWS  F +NI                         + +
Sbjct: 182 WNIDGLLRGENINGIGNDGEASGWSSSFYKNI-----------------------MNIPS 218

Query: 244 GEYIAP--LNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRVGMANAIG 301
              I P  L  + +    + + CI      D+YA W              F V       
Sbjct: 219 NVIIGPVGLVSKKVISTTVVRSCI------DSYASW--------------FAVSPPFLER 258

Query: 302 RLAAVAGTSTCHIVLSKDPIF---VPGVWGPYKDTIT-KG-YWCTEGGQSCTGALLQHVL 356
            L  +AGTS+C++  +  P+    +PGVWGP+ + +  KG +     GQSCTG L++H+ 
Sbjct: 259 SLFMIAGTSSCYMYGT--PVSNTKIPGVWGPFNNILDDKGDFSVYAAGQSCTGKLIEHLF 316

Query: 357 QTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPL 416
           ++HP  +++     K+G + +  L   +  + K+    S+  LAK +FFYGD  GNR+P 
Sbjct: 317 ESHPCARKIL----KSGADIYQVLEQTIHGIEKKKG-LSIHILAKDMFFYGDYEGNRTPF 371

Query: 417 ADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCD--AGHEISAIYMSGG 474
           ADP MKG+ +G + DTS+ NL   Y++  EF++ Q + II+      A   I  + +SG 
Sbjct: 372 ADPRMKGSFIGETTDTSILNLTYKYISILEFLSFQTKLIIDTFQSQKACIRIQELRISGS 431

Query: 475 QCRNSLLMKLLADC-SGLSVIIP-EYIDSAVVFGAAILGASASKLYQLNGSESDTVINTE 532
           Q RN  L+ L++   +G+S+  P + +D   + GA IL  SA++  QL     +  +  +
Sbjct: 432 QARNERLLSLISLVNNGMSINRPRDNVDMMGIKGAYILAKSANEKKQLVDVIRERDVGDD 491

Query: 533 NILWSTMNKMTKVGSYIMPVPKDHPDRILLD----AKYKIFLDMADRQKRYRAIVDAV 586
           N       K   +  Y +       D  LL      KY+I LDMA +QK Y  +VD V
Sbjct: 492 N------EKFQPLSEYCL-----GNDSTLLKNLLCVKYRIHLDMAKQQKYYYKLVDEV 538

>Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {ON}
           YNL249C (MPA43) - Overexpression leads to increased
           levels of the lyase PDC1 [contig 116] FULL
          Length = 534

 Score =  191 bits (486), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 175/592 (29%), Positives = 276/592 (46%), Gaps = 83/592 (14%)

Query: 9   IGVDVGTGSVRACIIDDLGTIKSQAELS--IHRQELKTDCITQSSQEIWRAVCFCVKKVV 66
           +G+D+G+  VR    + L T +  A +S  ++  E +    TQSS EI RA+  C + + 
Sbjct: 8   LGIDLGSTGVRVGAYN-LETDEPIAVVSRTVNYYEQEKGRYTQSSAEIMRAIVECFESLN 66

Query: 67  NELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFND----SNQDIILWMDHRALKE 122
            ++      V+  G  ATCSL V  + + +G+     + D    ++Q+++ WMD  A++E
Sbjct: 67  IDIWA----VQSCGVAATCSLAVFIRNSTKGLQPFGVYEDLRPLNDQNVVFWMDSNAIEE 122

Query: 123 TKEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRK 182
              IN        Y GG    EM +PK+    +  SK+  +  E +DL  Y+ +    R 
Sbjct: 123 CSNINDLAINEKAYFGGSFIPEMGVPKLASFLKSCSKNN-SDFEVFDLHTYVAYDLANRY 181

Query: 183 TRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLT 242
                 ++ +     +G +G   GW  +F          Y    KL  +V          
Sbjct: 182 GWDASFLINRPNHNGIGHDGEIKGWKDEF----------YEKTLKLPPNVR--------- 222

Query: 243 AGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRVGMANAIGR 302
               I PL       +      +  +  ID Y+ W     S       LF   MA     
Sbjct: 223 ----IGPLC------INRRFSPVKVASCIDCYSSWFSMFSS--TPERSLF---MA----- 262

Query: 303 LAAVAGTSTCHIVLSKDPI-FVPGVWGPYKDTI----TKGYWCTEGGQSCTGALLQHVLQ 357
               AGTSTC++  +  P   +PG+WGP+ D +       +   E GQS TG L++H+ +
Sbjct: 263 ----AGTSTCYLYANNKPSECLPGIWGPFTDILDSKDPPSWSVYEAGQSTTGKLIEHLFE 318

Query: 358 THPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLA 417
           +HP+ K   E  ++N +  F+ L T +  + ++S E SV    KH+F YG+L GNR+P  
Sbjct: 319 SHPAAKPYLE--DRNVL--FNRLETEINLIEQQSAE-SVHFKTKHMFNYGELQGNRTPYC 373

Query: 418 DPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCR 477
           DP M G  +G S DTS  +L   Y+   EF+A Q R I E +   G  I+ I ++G Q +
Sbjct: 374 DPEMSGMFIGESADTSFRDLTLKYVTVLEFLAFQVRHIKECL---GAPINDIRVAGSQAK 430

Query: 478 NSLLMKLLADCS-GLSVIIP-EYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENIL 535
           N+ L+ L++  + G  V IP    D   V GA +LG   +K   LN  E   +I  EN  
Sbjct: 431 NNRLLSLISFVNHGSRVRIPATRADYVGVQGAYLLG--KAKHLGLNVVE---LITQENGG 485

Query: 536 WSTMNKMTKVGSYIMPVPKDHPD--RILLDAKYKIFLDMADRQKRYRAIVDA 585
            S M  +       + + K+  +  R L + KYKI+L+MA  Q++YR +V+A
Sbjct: 486 ESPMKDIE------VRIEKNEENKLRALFEIKYKIYLNMAQTQRQYREMVNA 531

>KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43
          Length = 533

 Score =  186 bits (471), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 167/603 (27%), Positives = 276/603 (45%), Gaps = 105/603 (17%)

Query: 9   IGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKT-----DCITQSSQEIWRAVCFCVK 63
           +G+D+G+ +VR  I D    +K+   + I  + +       + +TQSS +I  A+  C++
Sbjct: 11  LGIDLGSTAVRVGIYD----LKTDKLIDIVAKPVPYTNHGGNRVTQSSTDIMSAIHGCIQ 66

Query: 64  KVVNELGCTRDQVKGIGFDATCSLVVVDK-------VTNRGVAVGPDFNDSNQDIILWMD 116
            +  +L      V   G  ATCSL V  +       +   GV   P  N     ++ WMD
Sbjct: 67  DLNPDL----KSVLSCGVAATCSLAVFTQDIEDLKPLDIHGVKQEPCHN-----VVFWMD 117

Query: 117 HRALKETKEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTF 176
             A  E + +N T     +++GG    EM +PK+  + +    +   + E +DL  Y+ +
Sbjct: 118 SSATLECEIVNKTAGRLKEFMGGSFVPEMGIPKLASIFKKPEAEGH-KLEVFDLHSYIAY 176

Query: 177 KATGRKTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSH 236
           +   +       ++ K     +G +G   GW   F          YND  KL  +V    
Sbjct: 177 ELAIKYGWDTSRIINKPNENRIGHDGELKGWDAGF----------YNDVLKLPANVK--- 223

Query: 237 GRNFLTAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRVGM 296
                     I P++    E       CI      D Y+ W              F +  
Sbjct: 224 ----------IGPIHALNTESPVRVASCI------DCYSNW--------------FSMCS 253

Query: 297 ANAIGRLAAVAGTSTCHIVL-SKDPIFVPGVWGPYKDTI----TKGYWCTEGGQSCTGAL 351
           ++    L   AGTSTC++   +++   +PGVWGP+ + +     K +   E GQS TG L
Sbjct: 254 SSPNNSLFMAAGTSTCYLYANTENKGCIPGVWGPFTNILDGSEAKEWSVYEAGQSTTGKL 313

Query: 352 LQHVLQTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHG 411
           ++H+ +THP+ +       K     F  + + + ++ +   E SV   +KH+F YG+L G
Sbjct: 314 IEHLFETHPAARAYSMDKSK----LFSAIESAIEKLEQDFGE-SVHFRSKHMFTYGELQG 368

Query: 412 NRSPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYM 471
           NR+P  D SM G  +G + DTS  +L   Y+   EF+A Q + I E       EI  I +
Sbjct: 369 NRTPYCDSSMSGMFIGETTDTSFQDLVLKYVTILEFLAFQVKHIKECF---KAEIKDIRI 425

Query: 472 SGGQCRNSLLMKLLADCSG-LSVIIP-EYIDSAVVFGAAILGASASKLYQLNGSESDTVI 529
           +G Q +N+ L+ L +  +  ++V IP +  D   V GA +LG +A K            I
Sbjct: 426 AGSQAKNTRLLTLFSLVNDQITVKIPAQRTDYMGVEGAYLLGKAAHK-----------NI 474

Query: 530 NTENILWSTMNKMTKVGSYIMPVPK----DHPDRI--LLDAKYKIFLDMADRQKRYRAIV 583
           N  +++    +K  ++ S+I+ +      +H  ++  LL+AKYKI+LDMA  Q RYRA+V
Sbjct: 475 NIIDLI----DKRDRLQSHILELGPMKLGNHNTKLKQLLEAKYKIYLDMAQTQMRYRAMV 530

Query: 584 DAV 586
           D+V
Sbjct: 531 DSV 533

>SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
          Length = 547

 Score =  185 bits (470), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 176/600 (29%), Positives = 272/600 (45%), Gaps = 90/600 (15%)

Query: 9   IGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELK------TDCITQSSQEIWRAVCFCV 62
           +GVD+G+ SVR  I     ++++ + L +  + ++      +   TQS+ EI  A+  C+
Sbjct: 13  VGVDLGSSSVRVGIY----SLENDSLLHVVERPVRYYSCGSSGRFTQSTGEIMAALQECL 68

Query: 63  KKVVNELGCTRD--QVKGIGFDATCSLVVVDKVTNRGVAVGPDFN----DSNQDIILWMD 116
               +ELG       +   G  ATCS+ V       G     D +     S+++++ WMD
Sbjct: 69  ----DELGLRPGGRSIVSCGVAATCSMAVFTVEAGDGSLAPLDMSGLDGSSDKNVVFWMD 124

Query: 117 HRALKETKEINSTNDECLKY-VGGQMSIEMELPKIKWLKRHMSKDVFARC-EFYDLADYL 174
             A +    ++      +K  + G    EM +PK+     H+      R  E +DL  Y+
Sbjct: 125 SVASEACDALDKRVSTHVKAALCGGFIPEMGVPKLL----HLVGQFPGRSLEVFDLHKYI 180

Query: 175 TFKATGRKTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSG 234
            +    R      ++  +     +G +G   GW ++F RN+           KL  +V+ 
Sbjct: 181 AYDLARRYGWDMAALANRPNSNGIGHDGEVGGWPQEFYRNV----------LKLPATVAV 230

Query: 235 SHGRNFLTAGEYIAPLNDQAIEELELSKECIVG-SGIIDAYAGWLGTVGSGTVDLEQLFR 293
                F                     K   VG +  ID YA W G     T   + LF 
Sbjct: 231 GPASTF---------------------KGQRVGVASCIDCYASWFGVCS--TQPEQSLF- 266

Query: 294 VGMANAIGRLAAVAGTSTCHIVLSK-DPIFVPGVWGPYKDTI--TKGYWCT-EGGQSCTG 349
                       VAGTSTC++  S      +PG+WGP+ + +   +  W   E GQS TG
Sbjct: 267 -----------LVAGTSTCYLYASAASKTVLPGMWGPFTNLLDGEEARWSVYEAGQSTTG 315

Query: 350 ALLQHVLQTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDL 409
            LL+H+ +THP+ ++    + +     F  L  R+A+M   S   S+  LA+H+F YG+L
Sbjct: 316 RLLEHLFETHPAARDYAGDTGR----LFKDLEDRIADMEADSGC-SIHHLARHMFLYGEL 370

Query: 410 HGNRSPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAM-CDAGHEISA 468
            GNR+P ADP M G  VG + DTS  NLA  Y+   EF+A Q RQI+E     A   I  
Sbjct: 371 QGNRTPYADPRMCGMFVGETTDTSFANLALKYVVVLEFLAFQTRQIVEGFRTGAAAAIGE 430

Query: 469 IYMSGGQCRNSLLMKLLADCSG-LSVIIPEYIDS-AVVFGAAILGASASKLYQLNGSESD 526
           + ++G Q RN  L+ L++  +G + V +P      A V GA +LG    K   L+ S  D
Sbjct: 431 LRVAGSQARNRRLLSLMSLVNGNMPVRVPARAAPLAGVRGAYLLG----KARYLDVSLLD 486

Query: 527 TVINTENILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAV 586
            V      + +   ++T+  +Y          R LL+AKY I LDMA  Q+RYR+ +DAV
Sbjct: 487 VVRKPGATIPTV--EVTESSNYPACGATKENLRRLLEAKYAIHLDMAQVQQRYRSEIDAV 544

>KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {ON}
           Anc_1.111 YNL249C
          Length = 535

 Score =  159 bits (401), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 162/599 (27%), Positives = 261/599 (43%), Gaps = 100/599 (16%)

Query: 9   IGVDVGTGSVRACII---DD--LGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVK 63
           IG+D+G+ SVR  I    DD  LG                    TQ S EI  A+    K
Sbjct: 8   IGIDLGSSSVRVGIYSLHDDSLLGVFSKPVPYYYESNRTSLWEYTQDSAEILTAI----K 63

Query: 64  KVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKET 123
           +  +     +  VK  G  ATCSLV+ ++    G          +++++ WMD  A +ET
Sbjct: 64  ECFDMADLQKYDVKSCGVAATCSLVLCER---SGDDTFQHCEGDSRNVVFWMDSMAKEET 120

Query: 124 KEINST-NDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFA--RCEFYDLADYLTFKATG 180
             +N+    + L ++GG    EM +PK+    + +S +     + E +DL  Y+ +K   
Sbjct: 121 NSLNARCPQDILGHMGGGFIPEMGIPKLSRFLKSISDEPKGNIQWEVFDLHKYVAYKL-- 178

Query: 181 RKTRSFCSVVCKQGMVP----MGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSH 236
              + +C    +    P    +G +G   GWSK F          Y+   +L  +V    
Sbjct: 179 --AQEYCWNTERLSNHPNSNGIGHDGELAGWSKSF----------YDKIVRLPPNV---- 222

Query: 237 GRNFLTAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRVGM 296
                T G    P   +  + L +   C      ID Y+ W   + S  ++   LF    
Sbjct: 223 -----TIG---CPKTIENEDSLVIVDSC------IDCYSSWFSPLQS--LNKNTLF---- 262

Query: 297 ANAIGRLAAVAGTSTCHIVLS---KDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQ 353
                    VAGTSTC+I      K    V G+WGP+ D +       E G SC+G L++
Sbjct: 263 --------LVAGTSTCYIYSPGTMKTETSVKGIWGPFTDILGANKVVYESGSSCSGKLIE 314

Query: 354 HVLQTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNR 413
           H+  +HPS   L  +S    ++K +        + +  N  S+   A + F YGDL GNR
Sbjct: 315 HLFTSHPSAISL-NLSTGQLISKLE----EEINIWETQNATSIHFEACNNFLYGDLDGNR 369

Query: 414 SPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSG 473
           +P  DP M+G  +G S DTS  +L   Y+   E +A Q + +++   +  + I+ +++ G
Sbjct: 370 TPFGDPYMRGMFIGESPDTSFRDLLVKYVCILECLAFQTKLMVDNF-EKLNSINELFICG 428

Query: 474 GQCRNSLLMKL--LADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINT 531
            Q +N+ L+KL  L + + L ++  E  D   V GA +LG +        G+  D V   
Sbjct: 429 SQAKNTRLLKLISLINDNALILVPKEKEDLMGVEGAYLLGKAGYL-----GTSVDLV--- 480

Query: 532 ENILWSTMNKMTKVGSYIMPVPKDHPDRI-------LLDAKYKIFLDMADRQKRYRAIV 583
                     +++   YI     +  D+I       LL  KY I L+MA++Q+R+R +V
Sbjct: 481 ---------PVSEPREYISVKYTNDSDKIQQTKLYKLLLTKYIIHLEMAEQQQRFRKMV 530

>KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
           and similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 516

 Score =  141 bits (355), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 130/492 (26%), Positives = 212/492 (43%), Gaps = 77/492 (15%)

Query: 9   IGVDVGTGSVRACIID---DLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKKV 65
           IGVD+G+   R  I D   D    +++ ++   R       ITQ + +I  AV    +K 
Sbjct: 6   IGVDLGSTEFRIGIFDYYTDSLVKETKEKVPYFRH--GNGIITQCTSDILTAV----EKA 59

Query: 66  VNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVG--PDFNDSNQDIILWMDHRALKET 123
            N L      +  +G  ATCS+VV  +     +      D N    DII WM   A++ET
Sbjct: 60  FNTLYIQEYNICSLGVGATCSMVVGKQKDENLIPFNLIHDKNGRYHDIIFWMHSAAIEET 119

Query: 124 KEINSTNDEC-LKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRK 182
           + +N+  DE  L + GG+   EM +PK+  L +    D        DL  +L +K + + 
Sbjct: 120 EYLNNITDESILCHFGGKFFPEMAIPKLLHLNKLYKDDGLT---VLDLHIWLLWKISLKL 176

Query: 183 TRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLT 242
                  V +     +G +G   GWSK+F  ++ L ++   + A                
Sbjct: 177 GHKELMPVQEPNSNGIGHDGELFGWSKEFYEHLQLNKIFIGNNA---------------- 220

Query: 243 AGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRVGMANAIGR 302
               +   N+Q             G   ID YA W            Q +   M N    
Sbjct: 221 ----VIKKNEQ------------FGDSCIDCYASWF-----------QCWSTAMLNR--T 251

Query: 303 LAAVAGTSTCHIVLSK-DPIFVPGVWGPYKDTITK--------GYWCTEGGQSCTGALLQ 353
           L  VAGTSTC +  S     F+PG+WGP+KD +           Y   E G S TG LL+
Sbjct: 252 LFVVAGTSTCFLYASDCFESFIPGIWGPFKDILVNRKHISKHDNYSVYEAGISRTGVLLE 311

Query: 354 HVLQTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNR 413
            +L THP+ K+       + +N  + +  ++ ++ ++S+ +S+  + K+ FF+ D     
Sbjct: 312 KLLSTHPAVKD-------SDVNFLETVEHKI-DLIEQSDTQSIHLMIKNTFFHEDYEEFE 363

Query: 414 SPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSG 473
           S        G+I+    + +L +LA  Y+   E +A Q   +I A  +    IS + ++G
Sbjct: 364 SSFVQKDTSGSILKEGYNPTLKDLALKYVVIIETLAFQIVDVINAFEEGHITISKLLITG 423

Query: 474 GQCRNSLLMKLL 485
            Q +NS L+++L
Sbjct: 424 SQAKNSRLLQIL 435

>NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {ON}
           Anc_1.111 YNL249C
          Length = 549

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 117/518 (22%), Positives = 202/518 (38%), Gaps = 100/518 (19%)

Query: 9   IGVDVGTGSVRACII--DDLGTIKSQAELSIHRQELKTDC--ITQSSQEIWRAVCFCVKK 64
           IG+DVG+ SVR  I   +D  TIK+  +  +++ E  +     TQ++  + R   F    
Sbjct: 5   IGIDVGSTSVRIGIFNYEDGTTIKTIVKEMLYKHEPDSKLWHYTQNAF-VMRDSIFTA-- 61

Query: 65  VVNELGCTRDQVKGIGFDATCSLVVVDKVTN----RGVAVGPDFNDSNQDIILWMDHRAL 120
            + EL      VK  G  ATCS+V + + +     R + +  +  ++   II W DH A 
Sbjct: 62  -LEELHVNSYIVKICGVSATCSMVFLQRDSPADHLRPLTIIHEETNNTDSIIFWKDHTAQ 120

Query: 121 KETKEINS-----------TNDECLKYVGGQMSI--EMELPKIKWLKRHMSKDVFAR--- 164
            E + +N+             ++ L  +G +     EM +PK+  L   + +  +     
Sbjct: 121 PEAQRLNNKLRTANEGLSGKENKILSTLGSRSGFIGEMAIPKLSRLINLIKEGFYETPHI 180

Query: 165 CEFYDLADYLTFKATGRKTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYND 224
            E YDL  Y+      +   +   +  K  +  +G++G   GW           +L++  
Sbjct: 181 LEVYDLHVYIAQTLAQKYDWNTVHLQNKPNVNGIGIDGELQGW-----------DLSFYV 229

Query: 225 YAKLGGSVSGSHGRNFLTAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSG 284
           +A    S     G + +        +N+ +I      K C      ID YA W  T    
Sbjct: 230 WALPETSFPICIGPSKV--------INETSIVR---PKSC------IDCYASWFSTDACT 272

Query: 285 TVDLEQLFRVGMANAIGRLAAVAGTSTC-----------HIVLSKDPIFVPGVWGPYKDT 333
             D               L   AGTSTC           +    + P+ +   WGP+ + 
Sbjct: 273 KDD--------------TLFMAAGTSTCCLYAMPRSALEYFGEQQQPLSL--FWGPFTNV 316

Query: 334 ITKGYWCT-EGGQSCTGALLQHVLQTH---PSYKELEEISEKNGMNKFDYLNTRLAEMAK 389
           + K    + E G S TG LL+ +   H    S+   E I         +Y+  ++A + +
Sbjct: 317 LDKDKKSSFEIGFSETGILLEKLFNKHQITASWSVAESI---------NYVENQIA-IYE 366

Query: 390 RSNERSVLCLAKHIFFYGDLHGNRSPLADPSMKGAIVGLS--MDTSLDNLAKTYLAACEF 447
           R    S+    +   F   L  N+    D      + G     D++L  + K Y+A  E+
Sbjct: 367 RKKSHSIYLEPEIYLFLKYLTLNKPSGRDTPDTPDLFGNDGVTDSTLGLIFK-YIAILEY 425

Query: 448 IAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSLLMKLL 485
           +A Q   +I         I+ + +SG Q +N  L+ L+
Sbjct: 426 LAYQVSNLILQFQKEKIIINHLVLSGSQAQNKRLLDLI 463

>NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}
           Anc_4.9 YHL032C
          Length = 810

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 88/199 (44%), Gaps = 33/199 (16%)

Query: 403 IFFYGDLHGNRSPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMC-- 460
           + F    +G  +P  DP  +  I+G+S  T+  ++A+   AA E +  Q R I++AM   
Sbjct: 610 VVFVPAFNGLFAPYWDPDTRATIMGISQSTTASHIAR---AAIEGVCFQVRAILKAMSGD 666

Query: 461 --DAGHE---ISAIYMSGGQCRNSLLMKLLADCSGLSVIIPEY-IDSAVVFGAAILGASA 514
             + G+E   +  + + GG  ++  +M++ AD  G  + +    I      GAAI    A
Sbjct: 667 KIEDGYEKGTVVTLSVDGGMSKSDEVMQIQADILGPCIKLRRSPIVECTALGAAIAANMA 726

Query: 515 SKLYQLNGSESDTVINTEN-ILWSTMNKMTKVGSYIMPVPKDHPDRI--LLDAKYKIF-- 569
            K             N E+ +LW  +N   K   ++M       D I  L+    KIF  
Sbjct: 727 YK-------------NVEDRVLWKDLNDAKK---WVMYNGYSKDDNIPQLMHPSLKIFRG 770

Query: 570 -LDMADRQKRYRAIVDAVE 587
            LD  DR+K ++    AV+
Sbjct: 771 KLDDEDRRKHWKLWQTAVK 789

>NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4.9
           YHL032C
          Length = 703

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 88/197 (44%), Gaps = 27/197 (13%)

Query: 403 IFFYGDLHGNRSPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAM--- 459
           + F    +G  +P  DP  +  I+G+S  T+  ++A+   AA E +  Q R I++AM   
Sbjct: 503 VVFVPAFNGLFAPYWDPDTRATIMGISQSTTASHIAR---AAIEGVCFQVRAILKAMGSD 559

Query: 460 ---CDAGHE---ISAIYMSGGQCRNSLLMKLLADCSGLSVIIPEY-IDSAVVFGAAILGA 512
               D+ +E   ++ + + GG  +++ +M++ AD  G  + +    I      GAAI   
Sbjct: 560 EVYGDSAYEKKNLATLAVDGGMSKSNEVMQIQADILGPCIKLRRSPIVECTALGAAIAAN 619

Query: 513 SASKLYQLNGSESDTVINTENILWSTMNKMTKVGSYIMPVPKDHPDRILLD--AKYKIFL 570
            A K               E ILW  +N + K   Y      +    I+ D  A +K  +
Sbjct: 620 MAYKK------------EAERILWKDLNDVKKWIMYNGYDKDEGMPTIMHDNLAVFKSSI 667

Query: 571 DMADRQKRYRAIVDAVE 587
           D A+R+K ++    AV+
Sbjct: 668 DDAERRKHWKLWQVAVK 684

>TPHA0K02280 Chr11 (490104..492107) [2004 bp, 667 aa] {ON} Anc_4.9
           YHL032C
          Length = 667

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 82/201 (40%), Gaps = 41/201 (20%)

Query: 325 GVWGPY--KDTITKGYWCTEGGQSCTGALLQHVLQTHPSYKELEEISEKNGMNKFDYLNT 382
           G W PY   +  +K ++  EG  +  GA++Q +      +   E++              
Sbjct: 408 GYWFPYLENEEHSKPHFALEGSVAVAGAVVQWLRDNLRLFPRAEDVGP------------ 455

Query: 383 RLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPSMKGAIVGLSMDTSLDNLAKTYL 442
            LA   K S           + F     G  +P  DP+ + +I+G+S  T+  ++A+   
Sbjct: 456 -LASQVKDSG---------GVVFVPAFSGLFAPYWDPNARASIMGMSQYTTAAHIAR--- 502

Query: 443 AACEFIAQQNRQIIEAM-CDAGHE------------ISAIYMSGGQCRNSLLMKLLADCS 489
           AA E +  Q R I++AM  D   E            +S + + GG  R+  +M++ A+  
Sbjct: 503 AAVEGVCFQARAILKAMSSDVLQESGDFEDTYEKSALSTLAVDGGMSRSDEVMQIQANIL 562

Query: 490 GLSVIIPEYIDSA-VVFGAAI 509
           G  V +     S     GAAI
Sbjct: 563 GPCVKVRRSPTSECTALGAAI 583

>YHL032C Chr8 complement(36379..38508) [2130 bp, 709 aa] {ON}
           GUT1Glycerol kinase, converts glycerol to
           glycerol-3-phosphate; glucose repression of expression
           is mediated by Adr1p and Ino2p-Ino4p; derepression of
           expression on non-fermentable carbon sources is mediated
           by Opi1p and Rsf1p
          Length = 709

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 85/204 (41%), Gaps = 29/204 (14%)

Query: 403 IFFYGDLHGNRSPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQ------------ 450
           + F     G  +P  DP  +  I+G+S  T+  ++A+  +    F A+            
Sbjct: 495 VVFVPAFSGLFAPYWDPDARATIMGMSQFTTASHIARAAVEGVCFQARAILKAMSSDAFG 554

Query: 451 ---QNRQIIEAMCDAGHE---ISAIYMSGGQCRNSLLMKLLADCSGLSVIIPEYIDSA-V 503
              ++R  +E + D  +E   +S + + GG  R++ +M++ AD  G  V +     +   
Sbjct: 555 EGSKDRDFLEEISDVTYEKSPLSVLAVDGGMSRSNEVMQIQADILGPCVKVRRSPTAECT 614

Query: 504 VFGAAILGASASKLYQLNGSESDTVINTENILWSTMNKMTKVGSYIMPVPKDHPDRILLD 563
             GAAI    A K         D     + + ++ M K  ++       P+ HP+  +  
Sbjct: 615 ALGAAIAANMAFKDVNERPLWKDLHDVKKWVFYNGMEKNEQIS------PEAHPNLKIFR 668

Query: 564 AKYKIFLDMADRQKRYRAIVDAVE 587
           ++     D A+R+K ++    AVE
Sbjct: 669 SES----DDAERRKHWKYWEVAVE 688

>TDEL0G01820 Chr7 (364972..367068) [2097 bp, 698 aa] {ON} Anc_4.9
           YHL032C
          Length = 698

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 87/210 (41%), Gaps = 43/210 (20%)

Query: 403 IFFYGDLHGNRSPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMC-- 460
           + F     G  +P  DP  +  I+G+S  T+  ++A+   AA E +  Q R I++AM   
Sbjct: 483 VVFVPAFSGLFAPYWDPEARATIMGMSQFTTASHIAR---AAVEGVCFQARAILKAMSSD 539

Query: 461 -------DAGHEISA----------IYMSGGQCRNSLLMKLLADCSGLSVII---PEYID 500
                  D   E+SA          + + GG  R+  +M++ A+  G  V +   P +  
Sbjct: 540 ALGTKDRDFLEEVSAGTYEKSLLSTLAVDGGMSRSDEVMQIQANILGPCVKVRRSPTH-- 597

Query: 501 SAVVFGAAILGASASKLYQLNGSESDTVINTENILWSTMNKMTKVGSYIMPVPKDHPDRI 560
                GAAI    A K  +            + ++W  +  + K   Y   V KD    +
Sbjct: 598 ECTALGAAIAAEMAFKDPK------------DRLMWKDLKDVKKYIFY-NGVEKDEECPL 644

Query: 561 LLDAKYKIFLDMA---DRQKRYRAIVDAVE 587
            L    KIF   +   +R+K++R   +AV+
Sbjct: 645 ELQPDLKIFTSTSNNTERRKKWRIWEEAVK 674

>Skud_8.12 Chr8 complement(24374..26506) [2133 bp, 710 aa] {ON}
           YHL032C (REAL)
          Length = 710

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 85/204 (41%), Gaps = 29/204 (14%)

Query: 403 IFFYGDLHGNRSPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQ------------ 450
           + F     G  +P  DP  +  I+G+S  T+  ++A+  +    F A+            
Sbjct: 495 VVFVPAFSGLFAPYWDPDARATIMGMSQFTTASHIARAAVEGVCFQARAILKAMSSDAFG 554

Query: 451 ---QNRQIIEAMCDAGHE---ISAIYMSGGQCRNSLLMKLLADCSGLSVIIPEYIDSA-V 503
              ++R  +E + D  +E   +S + + GG  R++ +M++ AD  G  V +     +   
Sbjct: 555 EGSKDRDFLEEISDVTYEKSPLSVLAVDGGMSRSNEVMQIQADILGPCVKVRRSPTAECT 614

Query: 504 VFGAAILGASASKLYQLNGSESDTVINTENILWSTMNKMTKVGSYIMPVPKDHPDRILLD 563
             GAAI    A K  +      D     + + ++ + K  ++       P+ HP   +  
Sbjct: 615 ALGAAIAANMAFKDPKSRPLWKDLHDVKKWVFYNGIEKNEQIS------PEVHPSLRIFR 668

Query: 564 AKYKIFLDMADRQKRYRAIVDAVE 587
           ++     D A+R+K ++    AVE
Sbjct: 669 SQS----DDAERRKHWKYWEVAVE 688

>KLLA0E00595g Chr5 complement(49243..51228) [1986 bp, 661 aa] {ON}
           similar to uniprot|P32190 Saccharomyces cerevisiae
           YHL032C GUT1 Glycerol kinase converts glycerol to
           glycerol- 3-phosphate glucose repression of expression
           is mediated by Adr1p and Ino2p-Ino4p derepression of
           expression on non- fermentable carbon sources is
           mediated by Opi1p and Rsf1p
          Length = 661

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 22/112 (19%)

Query: 403 IFFYGDLHGNRSPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAM--- 459
           + F     G  +P  DP  +  I+G+S  T+  ++A+   AA E +  Q R I++AM   
Sbjct: 456 VVFVPAFSGLFAPYWDPDARATIMGMSQYTTASHIAR---AAVEGVCFQARAILKAMSSD 512

Query: 460 -------------CDAGHE---ISAIYMSGGQCRNSLLMKLLADCSGLSVII 495
                         D  +E   +S + + GG  R+  +M++ AD  G  V +
Sbjct: 513 AFGSEDKDFLEEVVDETYEKTLLSTLAVDGGMSRSDEVMQIQADILGPCVKV 564

>Suva_8.19 Chr8 complement(37989..40187) [2199 bp, 732 aa] {ON}
           YHL032C (REAL)
          Length = 732

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 57/133 (42%), Gaps = 19/133 (14%)

Query: 403 IFFYGDLHGNRSPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQ------------ 450
           + F     G  +P  DP  +  I+G+S  T+  ++A+  +    F A+            
Sbjct: 518 VVFVPAFSGLFAPYWDPDARATIMGMSQFTTASHIARAAVEGVCFQARAILRAMSSDAFG 577

Query: 451 ---QNRQIIEAMCDAGHE---ISAIYMSGGQCRNSLLMKLLADCSGLSVIIPEYIDSA-V 503
              ++R  +E + D  +E   +S + + GG  R++ +M++ AD  G  V +     +   
Sbjct: 578 EGSKDRDFLEEISDVTYEKTPLSVLAVDGGMSRSNEVMQIQADILGPCVKVRRSPTAECT 637

Query: 504 VFGAAILGASASK 516
             GAAI    A K
Sbjct: 638 ALGAAIAANMAFK 650

>CAGL0E03916g Chr5 (371422..373440) [2019 bp, 672 aa] {ON} similar
           to uniprot|P32190 Saccharomyces cerevisiae YHL032c GUT1
           glycerol kinase
          Length = 672

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 50/115 (43%), Gaps = 25/115 (21%)

Query: 403 IFFYGDLHGNRSPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMC-D 461
           + F     G  +P  DP  +G I+G+S  T+  ++A+   AA E +  Q R I+ AM  D
Sbjct: 461 VVFVPAFSGLFAPYWDPEARGTIMGMSQYTTASHIAR---AAVEAVCFQARAILLAMSND 517

Query: 462 AGHE---------------------ISAIYMSGGQCRNSLLMKLLADCSGLSVII 495
           A  E                     +S + + GG  R+  +M++ AD  G  V +
Sbjct: 518 AMGEAEKDSTFKTEISEEGSYQKSLLSTLAVDGGMSRSDEVMQIQADILGPCVKV 572

>SAKL0H25938g Chr8 (2281415..2283472) [2058 bp, 685 aa] {ON} similar
           to uniprot|P32190 Saccharomyces cerevisiae YHL032C GUT1
           Glycerol kinase converts glycerol to glycerol-
           3-phosphate glucose repression of expression is mediated
           by Adr1p and Ino2p-Ino4p derepression of expression on
           non- fermentable carbon sources is mediated by Opi1p and
           Rsf1p
          Length = 685

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 48/235 (20%), Positives = 86/235 (36%), Gaps = 69/235 (29%)

Query: 297 ANAIGRLAAVAGTSTC---------------HIVLSKDPIFVPGVWGPY--KDTITKGYW 339
           A+ +G+LA   G++ C                ++     +   G W PY   +   K ++
Sbjct: 371 ASLVGQLAFKPGSAKCTYGTGCFLLYNTGSKKLISKHGALTTFGYWFPYLENEEHAKPHF 430

Query: 340 CTEGGQSCTGALLQHVLQTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCL 399
             EG  +  GA++Q                         +L   L  + K  +   + C 
Sbjct: 431 ALEGSVAVAGAVVQ-------------------------WLRDNLRLIPKAEDVGPLACR 465

Query: 400 AKH---IFFYGDLHGNRSPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQII 456
                 + F     G  +P  DP  +  I+G+S  T+  ++A+   AA E +  Q R I+
Sbjct: 466 VPDSGGVVFVPAFSGLFAPYWDPDARATIMGMSQYTTASHIAR---AAVEGVCFQARAIL 522

Query: 457 EAMC------------------DAGHE---ISAIYMSGGQCRNSLLMKLLADCSG 490
           +AM                   D  +E   +S + + GG  R+  +M++ AD  G
Sbjct: 523 KAMSSDAFGEGEKDRDFLEEIEDETYERTALSTLAVDGGMSRSDEVMQIQADILG 577

>Smik_8.9 Chr8 complement(20054..22180) [2127 bp, 708 aa] {ON}
           YHL032C (REAL)
          Length = 708

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 58/136 (42%), Gaps = 25/136 (18%)

Query: 403 IFFYGDLHGNRSPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAM-CD 461
           + F     G  +P  DP  +  I+G+S  T+  ++A+   AA E +  Q R I++AM  D
Sbjct: 495 VVFVPAFSGLFAPYWDPDARATIMGMSQFTTASHIAR---AAVEGVCFQARAILKAMSSD 551

Query: 462 AGHE--------------------ISAIYMSGGQCRNSLLMKLLADCSGLSVIIPEYIDS 501
           A  E                    +S + + GG  R++ +M++ AD  G  V +     +
Sbjct: 552 AFGEGSKDVDFLEEISGVTYEKSPLSVLAVDGGMSRSNEVMQIQADILGPCVKVRRSPTA 611

Query: 502 A-VVFGAAILGASASK 516
                GAAI    A K
Sbjct: 612 ECTALGAAIAANMAFK 627

>KLLA0A09977g Chr1 (876594..878201) [1608 bp, 535 aa] {ON} similar
           to uniprot|P00729 Saccharomyces cerevisiae YMR297W PRC1
           Vacuolar carboxypeptidase Y (proteinase C) involved in
           protein degradation in the vacuole and required for full
           protein degradation during sporulation
          Length = 535

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 33/75 (44%), Gaps = 4/75 (5%)

Query: 238 RNFLTAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTV----DLEQLFR 293
           RNFL AG+++ P +    E LE     ++ +G  D    WLG      +    D E+  +
Sbjct: 417 RNFLFAGDWMKPYHKHVTELLEQDLPVLIYAGDKDFICNWLGNQAWTNLLPYKDAEEFAK 476

Query: 294 VGMANAIGRLAAVAG 308
             + N +  +   AG
Sbjct: 477 QPVKNWVTSVGKKAG 491

>CAGL0M13651g Chr13 (1341331..1342857) [1527 bp, 508 aa] {ON}
           similar to uniprot|P00729 Saccharomyces cerevisiae
           YMR297w PRC1 carboxypeptidase Y
          Length = 508

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 238 RNFLTAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRVGMA 297
           RNFL  G+++ P + Q IE LE     ++ +G  D    W+G   + T +L+  +  G A
Sbjct: 392 RNFLFNGDWMKPYHKQVIEILEKGLPVLIYAGDKDFICNWMGNR-AWTDELQWKYSSGFA 450

>TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4.150
            YGR014W
          Length = 1825

 Score = 32.7 bits (73), Expect = 3.0,   Method: Composition-based stats.
 Identities = 35/152 (23%), Positives = 60/152 (39%), Gaps = 24/152 (15%)

Query: 382  TRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPSMKGAIVGLSMDTSLDNLAKTY 441
            +++ E + RS + S+L  ++H F      GN +   DPS         +++     +  Y
Sbjct: 1194 SKIIESSTRSYQTSILTSSQHTFSTTQTSGNSTQTQDPS--------EVNSKEHTSSTNY 1245

Query: 442  LAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSLLMKLLADCSGLSVIIPEYIDS 501
            +        Q   +I +     H  S    SG   R SL  +L         I+PE+  S
Sbjct: 1246 ITTSSISKPQTSILISSE----HTFSTTKTSGNSTRTSLPSEL---------ILPEHTSS 1292

Query: 502  AVVFGAAILGASASKLYQLNGSESDTVINTEN 533
                  AI  ++  + Y    S S T I++E+
Sbjct: 1293 T---NQAIESSTKPQTYSSLISPSFTSISSES 1321

>ADR128C Chr4 complement(934445..937048) [2604 bp, 867 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL073W
           (LHS1)
          Length = 867

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 465 EISAIYMSGGQCRNSLLMKLLADCSGLSVIIPEY-IDSAVVFGAAILGASASKLYQ 519
           ++ A+ ++GG  R   +   LA C G ++I      D A V G AI GA  SK+++
Sbjct: 370 QLDAVILTGGSSRVPSVQDRLAKCVGEALISKSVNADEAAVNGVAIRGAQLSKIFR 425

>Smik_4.687 Chr4 (1219205..1221751) [2547 bp, 848 aa] {ON} YDR416W
           (REAL)
          Length = 848

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 40/98 (40%), Gaps = 24/98 (24%)

Query: 312 CHI----VLSKDP--IFVPG----VWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHPS 361
           CHI    +L  DP  +  PG    +W  Y D     YW T    +      Q +   +P 
Sbjct: 419 CHIYSEAILKIDPRKVTTPGSFGRLWCLYGDL----YWNTNATSTARELWAQSLKVPYPY 474

Query: 362 YKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCL 399
            K+LEEI          YLN    E++K   ER+V  L
Sbjct: 475 IKDLEEI----------YLNWAERELSKEGVERAVSVL 502

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,320,140
Number of extensions: 2571129
Number of successful extensions: 6537
Number of sequences better than 10.0: 51
Number of HSP's gapped: 6579
Number of HSP's successfully gapped: 65
Length of query: 588
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 473
Effective length of database: 40,294,809
Effective search space: 19059444657
Effective search space used: 19059444657
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)