Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0J013908.261ON58358328650.0
NCAS0B038608.261ON58358718670.0
YLR088W (GAA1)8.261ON61460817530.0
Smik_12.1478.261ON61360817310.0
Skud_12.1568.261ON61260517110.0
TDEL0F038808.261ON57958517070.0
Suva_10.1728.261ON61460816780.0
TBLA0F030808.261ON58358616620.0
Kpol_543.378.261ON57858316430.0
SAKL0H17050g8.261ON58458216400.0
ZYRO0C01672g8.261ON56958516070.0
CAGL0L12232g8.261ON59159316060.0
KNAG0H032508.261ON58557415930.0
AGR087C8.261ON57758415820.0
KAFR0B055508.261ON55555415760.0
KLTH0G13706g8.261ON58457615780.0
Ecym_43098.261ON57757215550.0
Kwal_56.238048.261ON57857215470.0
KLLA0F19118g8.261ON57857315320.0
TPHA0A018208.261ON58158514820.0
KNAG0I010208.298ON52980732.8
KAFR0A067305.587ON120172715.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0J01390
         (583 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {...  1108   0.0  
NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {O...   723   0.0  
YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subun...   679   0.0  
Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088...   671   0.0  
Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088...   663   0.0  
TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.2...   662   0.0  
Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088...   650   0.0  
TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {O...   644   0.0  
Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON} (82589..8...   637   0.0  
SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]...   636   0.0  
ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {...   623   0.0  
CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON} sim...   623   0.0  
KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {O...   618   0.0  
AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON} S...   613   0.0  
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...   611   0.0  
KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]...   612   0.0  
Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}...   603   0.0  
Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {...   600   0.0  
KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} simi...   594   0.0  
TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {O...   575   0.0  
KNAG0I01020 Chr9 (196336..197925) [1590 bp, 529 aa] {ON} Anc_8.2...    33   2.8  
KAFR0A06730 Chr1 (1362270..1365875) [3606 bp, 1201 aa] {ON} Anc_...    32   5.2  

>NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score = 1108 bits (2865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/583 (93%), Positives = 547/583 (93%)

Query: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60
           MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP
Sbjct: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRDNEVLY 120
           SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRDNEVLY
Sbjct: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRDNEVLY 120

Query: 121 GVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSENP 180
           GVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSENP
Sbjct: 121 GVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSENP 180

Query: 181 DSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNIG 240
           DSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNIG
Sbjct: 181 DSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNIG 240

Query: 241 IYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRIQ 300
           IYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRIQ
Sbjct: 241 IYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRIQ 300

Query: 301 SITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           SITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS
Sbjct: 301 SITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 AVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQXXXXXXXXXX 420
           AVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQ          
Sbjct: 361 AVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQLFLILPIPSL 420

Query: 421 XXXXXXXXXXXXXXXQNKKLFKPAVSNRLRSFAFXXXXXXXXXXXMVNFPLSFMIGLMAF 480
                          QNKKLFKPAVSNRLRSFAF           MVNFPLSFMIGLMAF
Sbjct: 421 LLLINIVISISSIIIQNKKLFKPAVSNRLRSFAFLHLSLILTSLLMVNFPLSFMIGLMAF 480

Query: 481 PMTKVRSITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRLISA 540
           PMTKVRSITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRLISA
Sbjct: 481 PMTKVRSITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRLISA 540

Query: 541 WKDMRCWTWFVLCLGWLPSWIMVAISVIENEREPTSHDVKKNE 583
           WKDMRCWTWFVLCLGWLPSWIMVAISVIENEREPTSHDVKKNE
Sbjct: 541 WKDMRCWTWFVLCLGWLPSWIMVAISVIENEREPTSHDVKKNE 583

>NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/587 (59%), Positives = 448/587 (76%), Gaps = 8/587 (1%)

Query: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60
           MGL ERVQR +++RGLIPK+++ LP IS + + + I++I ILP +GQYRNTYISENALMP
Sbjct: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIVIIGILPFEGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRDN-EVL 119
           SQAYSYFRE+EWNIVRGYR+++V + N+++ ERN IM  WL +FG KT IY+N +  + L
Sbjct: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120

Query: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179
           YGVFHAPRGDGTE++VLA+PWFN DGEFN NGAA+GVALARYFSRWPVWSKNIIVVF+EN
Sbjct: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180

Query: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239
           P +ALRSWVEAY+TSLDLTGGSIEAAIVLD  GE D FDY+E+YYDGLNGELPNLD+VNI
Sbjct: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240

Query: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299
           G++ AEHEGM+VSLHGTPFD+IKE+  ++RLKIL++SI++SA SG+ KT+GNEAFSGWRI
Sbjct: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300

Query: 300 QSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           QS+TL+ +G +GP D+T FGRVPEAMFRSINNLLEKFHQSFFFYL+LAPR FVSISSYLP
Sbjct: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360

Query: 360 SAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQXXXXXXXXX 419
           S V +S+ F +A ++SY NNP + LPFFS YTL+  + W V+LV  FI++          
Sbjct: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420

Query: 420 XXXXXXXXXXXXXXXXQNKKLFKPAVSNRLRSFAFXXXXXXXXXXXMVNFPLSFMIGLMA 479
                           +     K  +S RLRS AF           MVNFPL+F +GL++
Sbjct: 421 ILLAVNIIICLYPAILKGNAFMKDLLSYRLRSTAFLFMSLLLTSLLMVNFPLAFGMGLLS 480

Query: 480 FPMTKVRSITANTA--PQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRL 537
           FPMT+V++IT++T    + +++N +LL++SNPFIA  +++ +  N       GL V  RL
Sbjct: 481 FPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNE----FSGLDVFERL 536

Query: 538 ISAWKDMRCWTWFVLCLGWLPSWIMVAISVIENER-EPTSHDVKKNE 583
           +SA +++ CWTW VLC+GW   W++VAIS ++  +    S D KK +
Sbjct: 537 VSASRELGCWTWLVLCVGWWTPWLLVAISALDTVKLSNDSEDFKKQQ 583

>YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subunit
           of the GPI (glycosylphosphatidylinositol):protein
           transamidase complex, removes the GPI-anchoring signal
           and attaches GPI to proteins in the ER
          Length = 614

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/608 (55%), Positives = 418/608 (68%), Gaps = 42/608 (6%)

Query: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60
           M LLE++ R IV  GL+P+I+A LP IS++      + IAILPMDGQYR TYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NEVL 119
           SQAYSYFRE+EWNI+RGYR+++  M N TS ERN +M SWL EFG KT IYEN    E L
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179
           YGV HAPRGDGTEA+VLAVPWFN D EFN  GAA+GV+LAR+FSRWPVWSKNIIVVFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239
           P +ALRSWVEAY+TSLDLTGGSIEAA+VLD     D+F+Y+E+ YDGLNGELPNLDLVNI
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299
            I I EHEGM+VSLHG P DQ+  NN+W+RLKIL   I+  A SG+ K HGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300

Query: 300 QSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           QS+TLK  GNSG  DIT FGR+PEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP
Sbjct: 301 QSVTLKAHGNSGH-DITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 360 SAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQXXXXXXXXX 419
           SAV LS+AF I+ ++++INN    +  FS Y L+  +VW V+LV  F+++Q         
Sbjct: 360 SAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSG 419

Query: 420 XXXXXXXXXXXXXXXXQNKKLFKPAVSNRLRSFAFXXXXXXXXXXXMVNFPLSFMIGLMA 479
                             K      +S RL++ AF           M+NF ++ +IG +A
Sbjct: 420 LLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLA 479

Query: 480 FPMTKVRSI---------------------------------TANTAPQ---IKLENIIL 503
           FPMT V++I                                 T    PQ    KL+N++L
Sbjct: 480 FPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNLVL 539

Query: 504 LMISNPFIALIIYNNVSSNSGLQGLQGLRVINRLISAWKDMRCWTWFVLCLGWLPSWIMV 563
           L+++NPFI++ ++     +       G  +IN+L+SAW D++CW+WFVLC+GWLP W+++
Sbjct: 540 LILTNPFISITLFGLFFDDE----FHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLI 595

Query: 564 AISVIENE 571
             S  E++
Sbjct: 596 LASSFESK 603

>Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088W
           (REAL)
          Length = 613

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/608 (55%), Positives = 420/608 (69%), Gaps = 41/608 (6%)

Query: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60
           M LLE++ R IV  GL+P+I+A LP +S++      + IAILPMDGQYR TYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NEVL 119
           SQAYSYFRE+EWNI+RGYR+++  M N TS ERN IM SWL EFG KT IYEN    E L
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120

Query: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179
           YGV HAPRGDGTEA+VLAVPWFN D +FN  GAA+GV+LAR+FSRWPVWSKNII+VFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180

Query: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239
           P +ALRSWVEAY+TSLDLTGGSIEAA+V+D     D+F+Y+E+ YDGLNGELPNLDLVN+
Sbjct: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240

Query: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299
            I I EHEGM+VSLHG P DQ+  NNYW+RLK+L   I+  A +G+   HGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300

Query: 300 QSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           QS+TLK  GNSG  DIT FGR+PEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP
Sbjct: 301 QSVTLKAHGNSGH-DITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 360 SAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQXXXXXXXXX 419
           SAV LSVAF I+ ++++INN   ++  FS Y L+  +VW ++LV  F+++Q         
Sbjct: 360 SAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAG 419

Query: 420 XXXXXXXXXXXXXXXXQNKKLFKPAVSNRLRSFAFXXXXXXXXXXXMVNFPLSFMIGLMA 479
                             K      +S RL++ AF           M+NF ++ +IG +A
Sbjct: 420 LLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTLA 479

Query: 480 FPMTKVRS---------------ITANTAPQIKLENI--------------------ILL 504
           FPMT V++               I+  T P+ + E I                    +LL
Sbjct: 480 FPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQELKNLLLL 539

Query: 505 MISNPFIALIIYNNVSSNSGLQGLQGLRVINRLISAWKDMRCWTWFVLCLGWLPSWIMVA 564
           +++NPFI++ I+ +   +      QG  VIN+L+SAW D++CW+WFVLC+GWLP W++V 
Sbjct: 540 VLTNPFISITIFGSFFDDE----FQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVL 595

Query: 565 ISVIENER 572
            S  E++R
Sbjct: 596 ASSFESKR 603

>Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088W
           (REAL)
          Length = 612

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/605 (54%), Positives = 415/605 (68%), Gaps = 40/605 (6%)

Query: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60
           M LLE++ R IV  GL+P+I+A LP IS +      + IAILPMDGQYR TYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NEVL 119
           SQAYSYFRE+EWN++RGYR+++  MEN TS ERN  M SWL EFG KT IYE++   E L
Sbjct: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120

Query: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179
           YGV HAPRGDGTEA+VLA+PWFN D EFN  GAA+GV+LAR+FSRWPVWSKNIIVVFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239
           P +ALRSWVEAY+TSLDLTGGSIEAA+VLD     D+F+Y+E+ YDGLNGELPNLDLVNI
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299
            I I EHEGM+VSLHG P+DQ+  N++W+RLKIL   I+  A SG+   HGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 300 QSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           QS+TLK  G+ G  DIT FGR+PEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP
Sbjct: 301 QSVTLKAHGHGGH-DITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 360 SAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQXXXXXXXXX 419
           SAV  SVAF I+ ++++INN   ++  FS Y L+  +VW ++LV  FI++Q         
Sbjct: 360 SAVAFSVAFAISSLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVG 419

Query: 420 XXXXXXXXXXXXXXXXQNKKLFKPAVSNRLRSFAFXXXXXXXXXXXMVNFPLSFMIGLMA 479
                             K      +S RL++ AF           M+NF ++ +IG +A
Sbjct: 420 LLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSLA 479

Query: 480 FPMTKVRSITANTAPQ----------IKLEN------------------------IILLM 505
           FPMT +R+I    + +          +K E+                        ++LL+
Sbjct: 480 FPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEKAKKRQQLKNLLLLV 539

Query: 506 ISNPFIALIIYNNVSSNSGLQGLQGLRVINRLISAWKDMRCWTWFVLCLGWLPSWIMVAI 565
           ++NPFI++ ++  V  N       G  ++N+LISAW D++CW WFVLC+GWLP W+++  
Sbjct: 540 LTNPFISITLFALVFDNE----FHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILA 595

Query: 566 SVIEN 570
           S  E+
Sbjct: 596 SSFES 600

>TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.261
           YLR088W
          Length = 579

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/585 (54%), Positives = 419/585 (71%), Gaps = 10/585 (1%)

Query: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60
           M L+ ++ R ++  GL+PKI+A LP +S++F  +S+  +A+LP++G+YR TYISENAL+P
Sbjct: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60

Query: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYEN-RDNEVL 119
           SQAYSYFRETEWN +RGYR ++  + NSTSRERN+ +  WL EFGVKT IY++ +  + L
Sbjct: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120

Query: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179
           YGV HA RGDGTEA++LA PW N DG  N +G ++G+AL R+FSRWPVWSKNIIVV SEN
Sbjct: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180

Query: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239
           P  ++RSWVEAY+TSLDLTGGSIEAA+VLD PG NDYFD++E++YDGLNGE PNLDLVNI
Sbjct: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240

Query: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299
            I I EHEGM+VSLHG   D+I +N++W+RL I++  I+++A SGL K +GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300

Query: 300 QSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           Q++TLK  G  G  D+T FGR+PEAMFRSINNLLEKFHQSFFFY+LLAPR FVSISSYLP
Sbjct: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360

Query: 360 SAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQXXXXXXXXX 419
            AV LS++F +A +D+ INN    LP  S Y L+   +W ++L+ CF +AQ         
Sbjct: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420

Query: 420 XXXXXXXXXXXXXXXXQNKKLFKPAVSNRLRSFAFXXXXXXXXXXXMVNFPLSFMIGLMA 479
                           + KK+ +P ++ RL+S AF           MVNF L+F +GL A
Sbjct: 421 ILISFSALISFLPLLLK-KKIAEP-LAYRLKSVAFLFFSLVLTSLLMVNFFLAFAMGLTA 478

Query: 480 FPMTKVRSITANT-APQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRLI 538
           FPMT VR+ + N  + +IKL+N ILL++SNPFIA  I+           L G  V     
Sbjct: 479 FPMTLVRTSSLNNYSLRIKLKNSILLLLSNPFIASYIFCQCFE----PDLPGFTVFTEFA 534

Query: 539 SAWKDMRCWTWFVLCLGWLPSWIMVAISVIENEREPTSHDVKKNE 583
           +AWK++ CWTWFV+C+GWLPSW+MVA+S +    +P   D +K +
Sbjct: 535 TAWKELGCWTWFVICIGWLPSWLMVALSTLNT--QPAQLDDRKKK 577

>Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088W
           (REAL)
          Length = 614

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/608 (53%), Positives = 416/608 (68%), Gaps = 42/608 (6%)

Query: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60
           M LLE++ R +V  GL+P+++A LP IS +      + IAILPMDGQYR TYISENALMP
Sbjct: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NEVL 119
           SQAYSYFRETEWNI+RGYR+++    N TS ERN +M SWL EFG KT IYEN    E L
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179
           YGV HAPRGDGTEA+VLA+PWFN + EFN  GA++GV+LAR+FSRWPVWSKNIIVVFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239
           P +ALRSWVEAY+TSLDLTGGSIEAA+VLD     D+F+Y+EV YDGLNGELPNLDLVN+
Sbjct: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240

Query: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299
            I I EHEGM+VSLHG P++Q+ +N++++RLKIL   I+  A SG+   HGNEAFSGWRI
Sbjct: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 300 QSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           QS+TLK  G+ G  DIT FGR+PEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP
Sbjct: 301 QSVTLKAHGHGGH-DITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 360 SAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQXXXXXXXXX 419
           SAV LSVAF ++ ++++INN   ++  FS Y L+  +VW + +V  F+++Q         
Sbjct: 360 SAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAG 419

Query: 420 XXXXXXXXXXXXXXXXQNKKLFKPAVSNRLRSFAFXXXXXXXXXXXMVNFPLSFMIGLMA 479
                             K      +S RL++ AF           M+NF ++ +IG +A
Sbjct: 420 LLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLA 479

Query: 480 FPMTKVRSITANTAPQ----------IKLE--------------------------NIIL 503
           FPMT +++I      +          IK E                          N++L
Sbjct: 480 FPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTLEKNQQRQKLKNLLL 539

Query: 504 LMISNPFIALIIYNNVSSNSGLQGLQGLRVINRLISAWKDMRCWTWFVLCLGWLPSWIMV 563
           L+++NPFI++ ++  +  +      QG  +IN+L+SAW D++CW+WF+LCLGWLP W+++
Sbjct: 540 LILTNPFISITVFGLLFDDE----FQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLI 595

Query: 564 AISVIENE 571
             S  E++
Sbjct: 596 LASSFESK 603

>TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/586 (52%), Positives = 413/586 (70%), Gaps = 7/586 (1%)

Query: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60
           M LL  + R ++  GL+PKIM +LP +SI   AI I++  +LPMDGQYR+TYISENALMP
Sbjct: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60

Query: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NEVL 119
           SQAYSYFRE+EWNI+RGYR E+    +  SR+RN +M  WL EFG KT +Y N +  + L
Sbjct: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120

Query: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179
           YG+F+APRGDGTEAIVLA+PW+N DGEFNT GAA+G+AL+R+FSRWP+WSKNIIVVFSEN
Sbjct: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180

Query: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239
           PD ALRSWV+AY+ SLDLTGGSIEAAIV+D P  +D+FDY+E+YY G+NGELPNLDL+NI
Sbjct: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240

Query: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299
            I I EHEGM+VSLHG P + + +NNY++RL+ L+   + +  SG+   HGNEAFSG+RI
Sbjct: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300

Query: 300 QSITLKTK--GNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357
           Q+ITLK K   ++   DIT FGR+ EA FRS+NNLLEKFHQSFFFYL+LAP+ FVSISSY
Sbjct: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360

Query: 358 LPSAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQXXXXXXX 417
           LPSAV  SVAF I+ + SYINN    LP FS Y L+  +++T+++   F +A+       
Sbjct: 361 LPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420

Query: 418 XXXXXXXXXXXXXXXXXXQNKKLFKPAVSNRLRSFAFXXXXXXXXXXXMVNFPLSFMIGL 477
                              N+      +S RL+S AF           ++NF L+F IG+
Sbjct: 421 PRLLVLGSVFLSVLPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIGI 480

Query: 478 MAFPMTKVRSITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRL 537
           + F MT V++IT +++ ++++ N + L++SNPF +++++  +      + + G+++    
Sbjct: 481 LGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFD----KDIYGIKIFYEF 536

Query: 538 ISAWKDMRCWTWFVLCLGWLPSWIMVAISVIENEREPTSHDVKKNE 583
           I +W  + CWTWF++C+GWLP WI+V+IS I+      S D  K +
Sbjct: 537 IHSWNTLNCWTWFIICVGWLPPWILVSISSIQTNTVMQSPDYGKKQ 582

>Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON}
           (82589..84325) [1737 nt, 579 aa]
          Length = 578

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/583 (53%), Positives = 414/583 (71%), Gaps = 7/583 (1%)

Query: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60
           M +LE +QR ++  GL+PK +A LPK+S++ V++S++++  LPMDGQ+R TYISENALMP
Sbjct: 1   MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSVMLMLYLPMDGQFRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NEVL 119
           SQAYSYFRETEWNI+RGYR E+  + + +S ERN IM SWL EFG+KT +Y+N++  + L
Sbjct: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120

Query: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179
           YGVF+APRGDGTE++VLAVPW+N + EFN +GAA+GV+LAR+ SRWPVWSKNIIVVFSEN
Sbjct: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180

Query: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239
           P  ALRSWVEAY+TSLDLTGGSIEAA+VLD PG +DYF+Y+EV+Y+G NG LPNLDLVNI
Sbjct: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240

Query: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299
            I IAEHEG++VSLHG   D++   +YW+RLK++    ++ A +G+ + +GNEAFSGWRI
Sbjct: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300

Query: 300 QSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           Q++TLK +G++   D+T FGRV EAMFRSINNLLEKFHQSFFFY LLAPR FVSI SYLP
Sbjct: 301 QALTLKARGDTNH-DVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLP 359

Query: 360 SAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQXXXXXXXXX 419
           +AV+LS++F +A +DS++NN   ++   S Y L+  I W V+++ CF L           
Sbjct: 360 AAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPL 419

Query: 420 XXXXXXXXXXXXXXXXQNKKLFKPAVSNRLRSFAFXXXXXXXXXXXMVNFPLSFMIGLMA 479
                                    ++ RL++ +F           +VNFPL+F +GL A
Sbjct: 420 LLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLFA 479

Query: 480 FPMTKVRSITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRLIS 539
           +PMT V  +      ++K  N ILL ISNPFIA  ++  +  +     L G+  I  L+ 
Sbjct: 480 YPMTLVM-LNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESK----LDGIEAIYGLVD 534

Query: 540 AWKDMRCWTWFVLCLGWLPSWIMVAISVIENEREPTSHDVKKN 582
           AW  +  WTWF+ C+GW PSWI+VAIS ++ E+  T  + KK+
Sbjct: 535 AWNKLGSWTWFIFCIGWFPSWILVAISALKVEQVQTEPNSKKH 577

>SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/582 (52%), Positives = 410/582 (70%), Gaps = 9/582 (1%)

Query: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAI-LPMDGQYRNTYISENALM 59
           M L+E++ R  +  GL+PK +A LP +SI    + +  +A+ +P DGQ+R TYISENALM
Sbjct: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60

Query: 60  PSQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NEV 118
           PSQAYSYFRETEWN++RGYR ++   + S++ ERN+ + SWL +FG KT IY N +  E 
Sbjct: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120

Query: 119 LYGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSE 178
           LYG+ HAPRGDGTEA+VLA PW+N + ++NT G A+ V+L+R+FSRWPVWSKNII+V SE
Sbjct: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180

Query: 179 NPDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVN 238
           +P +ALRSWVEAY+TSLDLTGGSIEAA+V+D PG ND+F Y+E+++DGLNGELPNLDLVN
Sbjct: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240

Query: 239 IGIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWR 298
           + ++I EHEGM+VSLHG   +++ +N++++R+K ++  +++ A SG+ K+HGNE FSGWR
Sbjct: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300

Query: 299 IQSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           I S+TLK  G  GP DIT FGR+PEA+FRS+NNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360

Query: 359 PSAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQXXXXXXXX 418
           P+AV LSV+F +A +++ +NN   +LP  S Y +   + + V L   FI AQ        
Sbjct: 361 PAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420

Query: 419 XXXXXXXXXXXXXXXXXQNKKLFKPAVSNRLRSFAFXXXXXXXXXXXMVNFPLSFMIGLM 478
                               K+  P  S RL+SFA+           +VNF L+F +G +
Sbjct: 421 ELLLSLNVLLLLMPIIFTRVKIRTP-FSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCL 479

Query: 479 AFPMTKVRSITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRLI 538
           AFPMT VR+ + N   + +L+N +LL+ISNPFIA+ ++           LQG++V   L 
Sbjct: 480 AFPMTLVRTTSGNL--RARLKNCVLLLISNPFIAIWLFAICVDRE----LQGVQVFYGLT 533

Query: 539 SAWKDMRCWTWFVLCLGWLPSWIMVAISVIENEREPTSHDVK 580
           SAWKD+ CWTWFV+C+GWLPSW++VA S I++       D K
Sbjct: 534 SAWKDLGCWTWFVICIGWLPSWLLVAYSGIDSVSIVVPQDEK 575

>ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 569

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/585 (52%), Positives = 399/585 (68%), Gaps = 19/585 (3%)

Query: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60
           M L+E++QR +V  GL+PKI+A LP +S+I   IS L +A LP++GQ+R TYISENALMP
Sbjct: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NEVL 119
           SQAYSYFRE+EWNI+RGYR+++ H    ++ ERN+ M  WL EFG KT IY N +  + L
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120

Query: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179
           YG+ HA RGDGTEAI+LAVPW+N +G+ N  GA++G++L+R+FSRWPVWSKNII+VFSEN
Sbjct: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180

Query: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239
           P+ ALRSWV+AY+TSLDLTGGSIEAAIVLD PG NDYFDY E+ Y GLNGELPNLDLVNI
Sbjct: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240

Query: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299
            + I EHEG+ VSLHG   + I + +YW+RLKIL+  I   AF+GL    GNEAFSGWRI
Sbjct: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300

Query: 300 QSITLKTKGNSGP-LDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           QS+T+K  G  G   DIT FGR+PEAMFRSINNLLEKFHQS+FFY+L+APR FVSISSYL
Sbjct: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360

Query: 359 PSAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQXXXXXXXX 418
           P+ V+L+  F +A ++S + N    L F+S+Y L   + W V+++  F+ +Q        
Sbjct: 361 PATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420

Query: 419 XXXXXXXXXXXXXXXXXQNKKLFKPAVSNRLRSFAFXXXXXXXXXXXMVNFPLSFMIGLM 478
                                     +S+RL+ +AF           MVNF L+F++G++
Sbjct: 421 ILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGIL 480

Query: 479 AFPMTKVRSITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRLI 538
           AFPMT V      T   +  +   LL+ISNP ++  I                +++ +LI
Sbjct: 481 AFPMTAV-----GTQRSLTFKKYALLIISNPLVSFFIVKPHP-----------QLLQKLI 524

Query: 539 SAWKDMRCWTWFVLCLGWLPSWIMVAISVIENER-EPTSHDVKKN 582
           SAW+D+ CWTWFVLCLGWLPSW ++A+S   +   +P +   K+ 
Sbjct: 525 SAWQDLGCWTWFVLCLGWLPSWTLIALSACSSTNLDPVATSKKEQ 569

>CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088w required for attachment of GPI anchor onto
           proteins
          Length = 591

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/593 (52%), Positives = 425/593 (71%), Gaps = 13/593 (2%)

Query: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60
           M LL++V R +  RG I K++ QLP++S + V ++I+++AILP+DGQYR TYISENALMP
Sbjct: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNLLVVVAIVLLAILPLDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NEVL 119
           SQAYSYFRETEWNI+RGYR+++  +E+S+  +RN+++  WL E G+KT +YE+    + L
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120

Query: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179
           YGV HA RGDGTEA+VLA+PW NVD +FN  GAA+GV+L+++F RWPVWSKNIIVVFSE+
Sbjct: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180

Query: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239
             +ALR+WV+AY+TSLDLT GSIEAA+VLD P ++D+F+Y+E+ YDGLNGELPNLDLVNI
Sbjct: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299
            + I EHEGM+VSLHG P +++   +Y+ RLKI+   I++ A SG+ + HGNEAFSGWRI
Sbjct: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300

Query: 300 QSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           QS+TL+  GN G LDITCFGR+PEAMFRS+NNLLEKFHQS+FFYLLLAPR FVSIS+YLP
Sbjct: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360

Query: 360 SAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQXXXXX--XX 417
           SAVI+SVAF +  +DS INN   ++PF S  TL+P I+ + ++   F++++         
Sbjct: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420

Query: 418 XXXXXXXXXXXXXXXXXXQNKKLFKPAVSNRLRSFAFXXXXXXXXXXXMVNFPLSFMIGL 477
                             +N  +   AV+ RL+S              MVNF L+FMIGL
Sbjct: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKSIGSIYYSLILTSLLMVNFALTFMIGL 480

Query: 478 MAFPMTKVRSIT----ANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRV 533
           +AFP+TK+  I+    A+ + +  L+N  +L I+NPFI+L ++   + ++   G   + +
Sbjct: 481 LAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLF-TATMDTDFNGSFSV-I 538

Query: 534 INRLISAWKDMRCWTWFVLCLGWLPSWIMVAISVIEN----EREPTSHDVKKN 582
            NR+I++W  + CWTWF++CLGWLP W++  IS I +    ER     D K+N
Sbjct: 539 YNRMITSWDTLGCWTWFIICLGWLPYWLISVISSIPSQPIVERTSILDDKKEN 591

>KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {ON}
           Anc_8.261 YLR088W
          Length = 585

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/574 (54%), Positives = 404/574 (70%), Gaps = 14/574 (2%)

Query: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60
           MGL E +QR  V  GL+PK++A LP +S +   +S++MI I+PM+GQYRNTYISENALMP
Sbjct: 1   MGLFETLQRKAVKLGLLPKLLAALPLLSALTAVVSVVMILIIPMNGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNIVRGYRNEL--VHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NE 117
           SQAYSYFRETEWNI+RGYR E+  ++    ++ +R  I+  WLNEFG KT +Y N +  +
Sbjct: 61  SQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMGD 120

Query: 118 VLYGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFS 177
            LYGV HAPRGDGTEA+VL  PW N +GEFN  G+A+ +AL+RYFSRWPVWSKNIIVVFS
Sbjct: 121 TLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVFS 180

Query: 178 ENPDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLV 237
           +NP  ALRSWVEAY+TSLDLTGGSIEAA++LD P  NDYF+Y E++++GLNGELPNLDLV
Sbjct: 181 DNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDLV 240

Query: 238 NIGIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGW 297
           N+ ++I +HEGM+VSLHG P  ++++NNYW+RLK+L   ++ S  +G+ K HGNE FSGW
Sbjct: 241 NVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSGW 300

Query: 298 RIQSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357
           RIQ++TLK +G  G +DIT FGR+PEAMFRSINNLLEKFHQSFFFY LL+P  FVSISSY
Sbjct: 301 RIQAVTLKARG-EGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISSY 359

Query: 358 LPSAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQ---XXXX 414
           LPSAV+LS+ F IA +D+ +NN ++A      YTL+ A+   ++L+  F++A        
Sbjct: 360 LPSAVLLSITFAIAAVDATVNN-AYASALHITYTLLAALASVISLLVSFLVAHWFLYSTT 418

Query: 415 XXXXXXXXXXXXXXXXXXXXXQNKKLFKPAVSNRLRSFAFXXXXXXXXXXXMVNFPLSFM 474
                                 N  L +P V  R+R+  +           M+NFPL+F 
Sbjct: 419 SPLYLILGSVVLAVSPLVMSRSNNALREP-VCYRMRTLGYIYYSLILTSLLMLNFPLAFS 477

Query: 475 IGLMAFPMTKVRSITANTAPQ--IKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLR 532
           IGL  +PMT V+ +   +  Q  +KL N +LL+ISNPF+A  +   V  NS    L    
Sbjct: 478 IGLFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPFVATWLICTVVENSEFPNLD--- 534

Query: 533 VINRLISAWKDMRCWTWFVLCLGWLPSWIMVAIS 566
           V   L SAWKD+ CWTWFVLCLGWLP+W++V  S
Sbjct: 535 VFAALFSAWKDLNCWTWFVLCLGWLPTWLLVTFS 568

>AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR088W
           (GAA1)
          Length = 577

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/584 (51%), Positives = 412/584 (70%), Gaps = 10/584 (1%)

Query: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAI-LPMDGQYRNTYISENALM 59
           M +LE++ R +V  GL+PKI+  L KIS +   +S+  + + LPM+GQYR TYISENALM
Sbjct: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIY-ENRDNEV 118
           PSQAYSYFRE+EWNI+RGYR+E+  M   T+ ERN+I+ SW+ E+G K  +Y ++R  E 
Sbjct: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120

Query: 119 LYGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSE 178
           LY V HA RGDGTEA+VLA PW  V+G++NT G A+ VA+ RYFSRWPVWSKNII+V SE
Sbjct: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180

Query: 179 NPDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVN 238
           +P ++LRSWV+AY+T LDLTGGSIEAAIVLD PG NDYF ++E+ Y+GLNG +PNLDL+N
Sbjct: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240

Query: 239 IGIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWR 298
           + ++I EHEGM+V+LHGTP++++  + Y++R+++L+  I+  A SG+ +T GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300

Query: 299 IQSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           IQS+TLK +G +G  DIT FGRVPEAMFRS+NNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360

Query: 359 PSAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQXXXXXXXX 418
           P+AV LS++F +   DS +NN   +LP  S Y +   + ++V L+   I A+        
Sbjct: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWALLAFSVALLVSAITAEVFFYLPAP 420

Query: 419 XXXXXXXXXXXXXXXXXQNKKLFKPAVSNRLRSFAFXXXXXXXXXXXMVNFPLSFMIGLM 478
                               K+ KP  S+R ++ A+           ++NF L+FM+GL+
Sbjct: 421 ALLLAFNVVVSFMPFALVKYKIQKP-FSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLL 479

Query: 479 AFPMTKVRSITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRLI 538
           AFPMT VR+ T + + + K++N +LL++SNPFI++ ++ ++        L G  V   LI
Sbjct: 480 AFPMTFVRT-TVHASVRQKMKNSLLLLLSNPFISICVFVHLFEPE----LTGFSVFYSLI 534

Query: 539 SAWKDMRCWTWFVLCLGWLPSWIMVAISVIENEREPTSHDVKKN 582
            AW D+ CWTW+VLCLGW P+WIMVA S I++   P +   KK+
Sbjct: 535 DAWNDLGCWTWYVLCLGWYPAWIMVAYSSIDS--VPIAAPAKKS 576

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/554 (55%), Positives = 401/554 (72%), Gaps = 14/554 (2%)

Query: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60
           MGL+ERV+R +   GL+PK+   LP  S I   IS++ IAILP+DGQYRNTYISENALMP
Sbjct: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKIIALISLISIAILPIDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRDNEVLY 120
           SQAYSYFRETEWNI+RGYR ++ +M +    ERN IME+WLN+ G KT   +  +N  +Y
Sbjct: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKT---DTHNNSTIY 117

Query: 121 GVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSENP 180
           G+FH+PRGDGTEAIVLA+PW N +G+FNT GAA+GV+LAR+F RWP+WSKNIIVVFSE+ 
Sbjct: 118 GIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSEDT 177

Query: 181 DSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNIG 240
            ++LRSWVEAY+TSLDLTGGSIEAA++LD   E+D+FDY+E++YDGLNGELPNLDLVNI 
Sbjct: 178 GASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNIA 237

Query: 241 IYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRIQ 300
           + I EHEGM+VSLHG P ++++E + W+R K+L+ SI+ S+ +G+ K HGNEAFSGWRIQ
Sbjct: 238 VSITEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKDSSLAGIKKPHGNEAFSGWRIQ 297

Query: 301 SITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           ++TLK  G  G +DIT FGR+PEAMFRSINNLLEKFHQSFF+YLLLAPR FVSISSYLP+
Sbjct: 298 ALTLKACGEGG-IDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLPA 356

Query: 361 AVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVW--TVTLVACFILAQXXXXXXXX 418
           AV LS+AF  + +  ++N+   ++PF S+YTL   IVW  ++T   CF +          
Sbjct: 357 AVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPVM 416

Query: 419 XXXXXXXXXXXXXXXXXQNKKLFKPAVSNRLRSFAFXXXXXXXXXXXMVNFPLSFMIGLM 478
                                  K  V++R+++FAF           M+NFPL+  IG++
Sbjct: 417 LMFICILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGVL 476

Query: 479 AFPMTKVRSITANTAPQIK--LENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINR 536
           AFPMT V+   +NT P     L+N +LL++SNP+I++  ++N+  +     L GL  ++R
Sbjct: 477 AFPMTLVK--ISNTLPTSSQALKNSMLLLVSNPYISICAFSNIFDSE----LTGLATLDR 530

Query: 537 LISAWKDMRCWTWF 550
           LI AW DM CWTWF
Sbjct: 531 LIPAWNDMNCWTWF 544

>KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/576 (50%), Positives = 407/576 (70%), Gaps = 10/576 (1%)

Query: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISIL-MIAILPMDGQYRNTYISENALM 59
           M L+E++QR I+  GL+P+I+  LPK+SI+   + I  +  +LP++GQYR+TYISENALM
Sbjct: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENR-DNEV 118
           PSQAYSYFRETEWNI+RGYR ++  +E  +S+ERN+++ SW  EFG KT  YE+      
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120

Query: 119 LYGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSE 178
           +YGV HAPRGDGTEA+VLA PW+N DGE+N  GAA+  AL+R+FSRWPVWSKNII+VFS+
Sbjct: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180

Query: 179 NPDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVN 238
           +P+++LRSWV AY+TSLDLTGGSIE+A+VLD PG ND+F Y+E+YY GLNGELPNLDLVN
Sbjct: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 239 IGIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWR 298
           + ++I EHEGM+VSL+G   +++++ NY++++K ++  ++  A SG+   +GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMMVGVKKMALSGVQSCYGNEAFSGWR 300

Query: 299 IQSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           IQ+I L+ +G  GP DIT FGR+PEA FRS+NNLLEKFHQSFFFYLLLAPR FVSI+SYL
Sbjct: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 359 PSAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQXXXXXXXX 418
           P+AV  SV+F++A +D  + + +   P FS + L   I +TV L+  F L+         
Sbjct: 361 PAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSAVIGFTVALLLSFALSILFSHWQYS 420

Query: 419 XXXXXXXXXXXXXXXXXQNKKLFKPAVSNRLRSFAFXXXXXXXXXXXMVNFPLSFMIGLM 478
                              + + + + S + +S AF           ++NF L+F IGL+
Sbjct: 421 SLLISCNAVIAVLPAIFGRQGI-EASHSYQFKSVAFLYLSVVLTSLLVINFALAFGIGLL 479

Query: 479 AFPMTKVRSITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRLI 538
           AFP+  V+   A    + +++N ILL++SNPFI+ +++ N         L GL++ +RL+
Sbjct: 480 AFPLILVK---APMTSRQRVKNTILLILSNPFISTLLFVNTFEPQ----LSGLQLFHRLV 532

Query: 539 SAWKDMRCWTWFVLCLGWLPSWIMVAISVIENEREP 574
            AW+ + CWTW V+C+GWLPSW++VA S I    +P
Sbjct: 533 QAWQKLGCWTWSVVCIGWLPSWLLVACSGIPMPYQP 568

>Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}
           similar to Ashbya gossypii AGR087C
          Length = 577

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/572 (51%), Positives = 387/572 (67%), Gaps = 8/572 (1%)

Query: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAI-LPMDGQYRNTYISENALM 59
           M +LE++ R IV  GL+P+I+A LPKISI    +SI  + + LP++GQYR TYISENALM
Sbjct: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQI-YENRDNEV 118
           PSQAYSYFRE+EWNI+RGYR EL ++++    ERN I+ SW+ E+G KT I   N+  E 
Sbjct: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120

Query: 119 LYGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSE 178
           LYG+ H  RGDGTEA+VLA PW   DG +N  GAA+ ++LARYF+RWPVWSKNIIVV S 
Sbjct: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180

Query: 179 NPDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVN 238
           +P ++LR+WV+AY+T LDLTGGSIE+A+VLD PG NDYF Y+E+ Y+GLNG LPNLDL+N
Sbjct: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIGYNGLNGGLPNLDLIN 240

Query: 239 IGIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWR 298
             ++I+EHEGM+VSLHG PF ++ ++ Y  RLK L++ I+    +G+  T G+EAF+GWR
Sbjct: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300

Query: 299 IQSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           IQS+TLK  G  GP D+T FGRVPEA+FRS+NNLLEKFHQSFFFYLLL+PR FVSI SYL
Sbjct: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYL 360

Query: 359 PSAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQXXXXXXXX 418
           P+A+ LS +F IA  DS +NN    LP  S Y +     + V L+  F+ A+        
Sbjct: 361 PAAIALSASFAIASADSILNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420

Query: 419 XXXXXXXXXXXXXXXXXQNKKLFKPAVSNRLRSFAFXXXXXXXXXXXMVNFPLSFMIGLM 478
                               K+ KP  S R ++FA            +VNF L+  +G++
Sbjct: 421 SLLLAFNVALSFISFTVIKYKIQKP-FSYRFKAFAHLYFSIVLTSLLVVNFALALAVGVL 479

Query: 479 AFPMTKVRSITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRLI 538
           AFPM+  ++ T N   Q KL N +LLM SNPFIA  I   +        L G  + + LI
Sbjct: 480 AFPMSLTKT-TTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQ----LAGTSLFHSLI 534

Query: 539 SAWKDMRCWTWFVLCLGWLPSWIMVAISVIEN 570
            AW  + CWTW+VLC+GW PSWI+VA S I++
Sbjct: 535 DAWTQLGCWTWYVLCIGWYPSWILVAYSSIDS 566

>Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {ON}
           YLR088W (GAA1) - Possible component of GPI:protein
           transamidase [contig 173] FULL
          Length = 578

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/572 (52%), Positives = 409/572 (71%), Gaps = 18/572 (3%)

Query: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAIL-PMDGQYRNTYISENALM 59
           M L+ER+QR ++  GL+P+I+  LPK+S++   I I  + +L P++GQYR+TYISENALM
Sbjct: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NEV 118
           PSQAYSYFRETEWNI+RGYR ++  +EN +S ERN+I+ SWL EFGVKT +YE+      
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120

Query: 119 LYGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSE 178
           LYGV HAPRGDGTEA+VL+ PWFN DGEFN  G A+ VALARYFSRWPVWSKNIIVVFS+
Sbjct: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180

Query: 179 NPDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVN 238
           +P ++LRSWV+AY+TSLDLTGGSIE+A+VLD PG ND+F Y+E+YY GLNGELPNLDLVN
Sbjct: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 239 IGIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWR 298
           + I++ EHEGM+VSL+G P D+++  +Y+ R+K +V  I+  A SG+ + +GNEAFSGWR
Sbjct: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300

Query: 299 IQSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           IQ++ L+ +G+ GP DIT FGRVPEA+FRS+NNLLEKFHQSFFFYLLLAPR FVSI+SYL
Sbjct: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 359 PSAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIV----WTVTLVACFILAQXXXX 414
           P+AV  SV+F++A +D+ +   +      S   ++P I     +TV L+  F ++     
Sbjct: 361 PAAVAFSVSFIVAALDNVLCQGAST----SQSGILPNIAAVVGFTVALLFSFTVS-VTFA 415

Query: 415 XXXXXXXXXXXXXXXXXXXXXQNKKLFKPAVSNRLRSFAFXXXXXXXXXXXMVNFPLSFM 474
                                 N+   + + ++RL++ A+           +VNF L+F 
Sbjct: 416 RFHHPVILISWSVMTALAPILLNRVRIQSSYAHRLKAVAYLYLSVVLTSLLVVNFALAFG 475

Query: 475 IGLMAFPMTKVRSITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVI 534
           IGL+AFP+  V++   +T P++  +N +LL++SNPFI+  ++           L GL+++
Sbjct: 476 IGLLAFPLILVKN---STTPRLLFKNSLLLLLSNPFISTCLFAYFFEPL----LPGLQIL 528

Query: 535 NRLISAWKDMRCWTWFVLCLGWLPSWIMVAIS 566
            +L+ AW +  CWTW V+C+GWLPSW+++A S
Sbjct: 529 EQLVQAWNEFGCWTWCVVCIGWLPSWLLIAYS 560

>KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} similar
           to uniprot|P39012 Saccharomyces cerevisiae YLR088W GAA1
           Subunit of the GPI:protein transamidase complex removes
           the GPI-anchoring signal and attaches GPI
           (glycosylphosphatidylinositol) to proteins in the ER
          Length = 578

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/573 (50%), Positives = 399/573 (69%), Gaps = 10/573 (1%)

Query: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISI-LMIAILPMDGQYRNTYISENALM 59
           M L+E++ R I+S GLIPK +++L ++S++   I +  ++ +LP DGQ+R TYISENAL+
Sbjct: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60

Query: 60  PSQAYSYFRETEWNIVRGYRNEL-VHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NE 117
           PSQAYSYFRE+EWNI+RGYR +L +    ST+ + N  +  WL EFGVKT IY++    E
Sbjct: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120

Query: 118 VLYGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFS 177
            LYG+FHAPRGDGTEA+V+A PW+N + E+NT GAA+ ++L R+FSRWPVWSKNII+V S
Sbjct: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180

Query: 178 ENPDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLV 237
           E+P ++LRSWV AY+TSLDLTGGSIE+AIVLD PG +D FDY+E++YDGLNGE PNLDLV
Sbjct: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240

Query: 238 NIGIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGW 297
           N+ ++IAEHEG++VSLHG PF ++  N+Y +RLK ++  I+ S  SG+   +GNEAFSGW
Sbjct: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300

Query: 298 RIQSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357
           RIQS+TLK KG  GP DIT FGRVPEA+ RS+NNLLEKFHQSFFFYLLLAPR F+SI +Y
Sbjct: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360

Query: 358 LPSAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQXXXXXXX 417
           L +AV +SVAFV A ++  +NN    LP  S Y +   + + ++LV  F  +Q       
Sbjct: 361 LATAVAVSVAFVFAALNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420

Query: 418 XXXXXXXXXXXXXXXXXXQNKKLFKPAVSNRLRSFAFXXXXXXXXXXXMVNFPLSFMIGL 477
                             + +   +   S R ++FA+           ++NF L+ ++GL
Sbjct: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480

Query: 478 MAFPMTKVRSITANTAPQIKLENIILLMISNPFIAL-IIYNNVSSNSGLQGLQGLRVINR 536
           +AFPMT+  +I  +   ++ ++N++LL+ISNPFIA   + N V        L G +V   
Sbjct: 481 LAFPMTRTTTIIESNL-RLSIKNLVLLIISNPFIATWAVVNFVEPR-----LSGFKVFYA 534

Query: 537 LISAWKDMRCWTWFVLCLGWLPSWIMVAISVIE 569
           LI A + + CWTW+++CLGW PSW++V  + I+
Sbjct: 535 LIEASQQLGCWTWYIICLGWYPSWLLVTYASID 567

>TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {ON}
           Anc_8.261 YLR088W
          Length = 581

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/585 (48%), Positives = 395/585 (67%), Gaps = 8/585 (1%)

Query: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60
           M L+E + R     GL+PK++ +L  +S I V ISI +I  LP+DGQYR TYISENAL+P
Sbjct: 1   MALIEVLHRRATKLGLLPKVIGKLSIVSNILVLISIGLILCLPLDGQYRRTYISENALLP 60

Query: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENR-DNEVL 119
           SQAYSYFRE+EWNI+RGYR  +  + +  +R RN+++ SWL +FG+K  +Y+N  D + L
Sbjct: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120

Query: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179
           YGV+++ RGDGTEAIVLAVPW+N D E N  GAA+G++L+RYFSRWP+WSKNII+V SEN
Sbjct: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180

Query: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239
           P  A++SWV+AY+ SLDLTGGS+EAAIVLD P +++YF+++E+Y++G+NGELPNLD+VN+
Sbjct: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240

Query: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299
            I + EHEG++VSL G    ++  ++Y+ RLK L+  +++SA SG  K +GNEAFSG RI
Sbjct: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300

Query: 300 QSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           Q++TLK  G  G  DIT FGR+PEA+FRS+NNLLEKFHQSFFFY L+APR FVSI SYLP
Sbjct: 301 QALTLKACGTEGH-DITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLP 359

Query: 360 SAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQXXXXXXXXX 419
           SAV LS++F I+   SYINN    +P   N +++  I++  ++   FI  Q         
Sbjct: 360 SAVCLSISFGISAAHSYINNQYITVPLSDNSSILALIIFFGSIAISFIFLQINETFLQPH 419

Query: 420 XXXXXXXXXXXXXXXXQNKKLF--KPAVSNRLRSFAFXXXXXXXXXXXMVNFPLSFMIGL 477
                             + L   +P +S RL+SFAF           ++NF L+F +GL
Sbjct: 420 LMILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMGL 479

Query: 478 MAFPMTKVRSITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRL 537
           +AFP+T  +S +     + K+ N   L ISNPFIA+ I+ ++  +     +    V + L
Sbjct: 480 LAFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDD----ITNFEVFSDL 535

Query: 538 ISAWKDMRCWTWFVLCLGWLPSWIMVAISVIENEREPTSHDVKKN 582
           IS++K M  WTW + C+GW  +W MV I+ ++  R     D KKN
Sbjct: 536 ISSFKYMGNWTWAITCIGWFTTWQMVYIANLDTPRSALDGDTKKN 580

>KNAG0I01020 Chr9 (196336..197925) [1590 bp, 529 aa] {ON}
          Anc_8.298 YDR131C
          Length = 529

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 43/80 (53%), Gaps = 5/80 (6%)

Query: 3  LLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMPSQ 62
          +L+++ R ++ R  + K + Q  KIS+ +V+  + + A+  +   Y+N +++E   MPS 
Sbjct: 1  MLDKLPREVIDR--VAKYLGQEDKISLTYVSKEVRLGAVPRL---YKNLFLNERYYMPSD 55

Query: 63 AYSYFRETEWNIVRGYRNEL 82
                   W++++   N++
Sbjct: 56 YDRSLGTRTWSVLKFTYNDM 75

>KAFR0A06730 Chr1 (1362270..1365875) [3606 bp, 1201 aa] {ON}
           Anc_5.587 YDR464W
          Length = 1201

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 474 MIGLMAFPMTKVR-SITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLR 532
           ++GL+  P+        A TAP IK+ENI+  ++   F  + +     S+S + G     
Sbjct: 863 VMGLINIPLKPTDLETKAKTAPTIKVENIVETLVKQQF-NVDVTAGADSDSKIDGKTASN 921

Query: 533 VINRLISAWKDM 544
           + N + S  KD+
Sbjct: 922 ISNIITSTIKDL 933

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,720,376
Number of extensions: 2423524
Number of successful extensions: 5602
Number of sequences better than 10.0: 28
Number of HSP's gapped: 5667
Number of HSP's successfully gapped: 31
Length of query: 583
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 468
Effective length of database: 40,294,809
Effective search space: 18857970612
Effective search space used: 18857970612
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 69 (31.2 bits)