Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0J013808.262ON62462427590.0
NCAS0B038508.262ON58840711701e-153
KAFR0B055408.262ON51940410331e-133
TDEL0F038908.262ON4763659151e-116
SAKL0H17028g8.262ON5503668082e-99
ZYRO0C01650g8.262ON5864167962e-97
YDR110W (FOB1)8.262ON5663657691e-93
Kwal_56.237998.262ON4884097622e-93
Smik_4.3568.262ON5763657534e-91
KLTH0G13684g8.262ON5084147476e-91
Suva_2.2708.262ON6323657558e-91
Skud_4.3718.262ON5803977474e-90
Kpol_543.388.262ON4423957216e-88
Ecym_43088.262ON5293796851e-81
KNAG0H032408.262ON5194116519e-77
KLLA0F19140g8.262ON5274026483e-76
CAGL0B01771g8.262ON5363936413e-75
Kpol_392.68.262ON4573836275e-74
AGR086C8.262ON5343576301e-73
TPHA0A018108.262ON4573735034e-56
TBLA0E044308.262ON4813794451e-47
TPHA0J007408.262ON4083844277e-46
TBLA0F030708.262ON4453663982e-41
KLTH0F03476g1.131ON776157780.96
NCAS0A06040na 1ON588177751.8
TPHA0N006005.191ON188888752.2
NDAI0B06160singletonON140373733.2
KLLA0F21758g5.383ON157251733.4
Suva_13.3302.373ON36536724.0
KNAG0C053105.383ON152197724.9
TBLA0A033105.383ON158951725.4
NDAI0G00550singletonON41280706.7
ZYRO0G04730g1.497ON130270708.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0J01380
         (624 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...  1067   0.0  
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   455   e-153
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   402   e-133
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   357   e-116
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   315   2e-99
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   311   2e-97
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   300   1e-93
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   298   2e-93
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   294   4e-91
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   292   6e-91
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   295   8e-91
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   292   4e-90
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   282   6e-88
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   268   1e-81
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   255   9e-77
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   254   3e-76
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   251   3e-75
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   246   5e-74
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   247   1e-73
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   198   4e-56
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   176   1e-47
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   169   7e-46
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   157   2e-41
KLTH0F03476g Chr6 complement(302182..304512) [2331 bp, 776 aa] {...    35   0.96 
NCAS0A06040 Chr1 complement(1193225..1194991) [1767 bp, 588 aa] ...    33   1.8  
TPHA0N00600 Chr14 (128725..134391) [5667 bp, 1888 aa] {ON} Anc_5...    33   2.2  
NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON}            33   3.2  
KLLA0F21758g Chr6 complement(2023805..2028523) [4719 bp, 1572 aa...    33   3.4  
Suva_13.330 Chr13 (542402..543499) [1098 bp, 365 aa] {ON} YMR152...    32   4.0  
KNAG0C05310 Chr3 complement(1034251..1038816) [4566 bp, 1521 aa]...    32   4.9  
TBLA0A03310 Chr1 (787743..792512) [4770 bp, 1589 aa] {ON} Anc_5....    32   5.4  
NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {O...    32   6.7  
ZYRO0G04730g Chr7 complement(374995..378903) [3909 bp, 1302 aa] ...    32   8.8  

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score = 1067 bits (2759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/624 (85%), Positives = 532/624 (85%)

Query: 1   MTETRTPSNSLRDRATLFVXXXXXXXXXXXXXXLHENSIQKXXXXXXXXXXXXXXXXXKG 60
           MTETRTPSNSLRDRATLFV              LHENSIQK                 KG
Sbjct: 1   MTETRTPSNSLRDRATLFVNEEGDDDNDEEQQQLHENSIQKNGIEGSNSEEEGAATSNKG 60

Query: 61  SMTRPRSEVXXXXXXXXXXXRDPKRRHYGSYLIPNVGESYMDYVDPEVDVDLLKRGEVTF 120
           SMTRPRSEV           RDPKRRHYGSYLIPNVGESYMDYVDPEVDVDLLKRGEVTF
Sbjct: 61  SMTRPRSEVNGDDDDGNEDERDPKRRHYGSYLIPNVGESYMDYVDPEVDVDLLKRGEVTF 120

Query: 121 LNFQRSIHGQLDEVVYELIRTKSLTEETLAANFPHFHAPTRCALFKRRYVADNEGRVRDQ 180
           LNFQRSIHGQLDEVVYELIRTKSLTEETLAANFPHFHAPTRCALFKRRYVADNEGRVRDQ
Sbjct: 121 LNFQRSIHGQLDEVVYELIRTKSLTEETLAANFPHFHAPTRCALFKRRYVADNEGRVRDQ 180

Query: 181 LRGNRIVCDPVLLYEMMMTCHLMNDHAQYRRCHVALSSIYANITRDFLYKAVQFCSVCNP 240
           LRGNRIVCDPVLLYEMMMTCHLMNDHAQYRRCHVALSSIYANITRDFLYKAVQFCSVCNP
Sbjct: 181 LRGNRIVCDPVLLYEMMMTCHLMNDHAQYRRCHVALSSIYANITRDFLYKAVQFCSVCNP 240

Query: 241 SKLVGPLLKFKHVNYYKGMLPLERVHIEIFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEP 300
           SKLVGPLLKFKHVNYYKGMLPLERVHIEIFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEP
Sbjct: 241 SKLVGPLLKFKHVNYYKGMLPLERVHIEIFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEP 300

Query: 301 LKNTKFKNLVSAIAKLLFNLPRIPIFIETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAK 360
           LKNTKFKNLVSAIAKLLFNLPRIPIFIETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAK
Sbjct: 301 LKNTKFKNLVSAIAKLLFNLPRIPIFIETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAK 360

Query: 361 RFHTRGVKQMKILLEGHRKECLNDWTMCLKYGPHNYNTKHNDRACGVPVDLLTCNVKDVT 420
           RFHTRGVKQMKILLEGHRKECLNDWTMCLKYGPHNYNTKHNDRACGVPVDLLTCNVKDVT
Sbjct: 361 RFHTRGVKQMKILLEGHRKECLNDWTMCLKYGPHNYNTKHNDRACGVPVDLLTCNVKDVT 420

Query: 421 HKSIEKYEQIIRTLPKDNIVQIGNGSIYLEEKVKDPNIDNYDAMLGEEYDSEQEDNNNKN 480
           HKSIEKYEQIIRTLPKDNIVQIGNGSIYLEEKVKDPNIDNYDAMLGEEYDSEQEDNNNKN
Sbjct: 421 HKSIEKYEQIIRTLPKDNIVQIGNGSIYLEEKVKDPNIDNYDAMLGEEYDSEQEDNNNKN 480

Query: 481 TDQDLAYEHPDYEYDEEQLKRRPVYGIXXXXXXXXXXXXIMNDNHVXXXXXXXXXXXXXX 540
           TDQDLAYEHPDYEYDEEQLKRRPVYGI            IMNDNHV              
Sbjct: 481 TDQDLAYEHPDYEYDEEQLKRRPVYGISSSTDKEKESESIMNDNHVEENIEEEEEDQIQI 540

Query: 541 XXXXXXXXXXXXXXXXXXXXXXXXTEQKYLDKRDKSNDISYDVSRDESGEIQGPSTSYYN 600
                                   TEQKYLDKRDKSNDISYDVSRDESGEIQGPSTSYYN
Sbjct: 541 DSNPEDNADSNNNDDAEEEKDEKETEQKYLDKRDKSNDISYDVSRDESGEIQGPSTSYYN 600

Query: 601 ERVENDSLAVVGDDDDNIKYSVEL 624
           ERVENDSLAVVGDDDDNIKYSVEL
Sbjct: 601 ERVENDSLAVVGDDDDNIKYSVEL 624

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  455 bits (1170), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 213/407 (52%), Positives = 292/407 (71%), Gaps = 5/407 (1%)

Query: 84  KRRHYGSYLIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKS 143
           KR     YLIPN+GE Y DYVD ++D+  ++RGE  F  FQ++I+GQL+E  YELI+T S
Sbjct: 75  KRLKLKGYLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNS 134

Query: 144 LTEETLAAN---FPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTC 200
           LT+ETL+A       F A +R     RRY  D +G VRD+LR NR+VC+PV +Y+M+MT 
Sbjct: 135 LTQETLSATALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTW 194

Query: 201 HLMNDHAQYRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGML 260
           HL+NDH + R+CH  L  +Y+NITR F+ +  QFCSVCNPSK   P  K+KH+N++KG+L
Sbjct: 195 HLINDHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLL 254

Query: 261 PLERVHIEIFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNL 320
           PLERV +E+FEPF G+K+ GKY  ++Y RDYRSR+I + PL+N+KF +LV  I+K++F++
Sbjct: 255 PLERVQVEVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSM 314

Query: 321 PRIPIFIETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKE 380
            RIPIF ET ++  QD FDIFE IVEKYQIN+GLG K   +  T G+ Q++ LL  H++E
Sbjct: 315 IRIPIFFETTTIENQDFFDIFEKIVEKYQINIGLGTKLGGKRLTNGLPQIRKLLGPHKEE 374

Query: 381 CLNDWTMCLKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIV 440
           CL DW MCLKYGPH +N K NDRACGVP DLLT ++ D+  KS +K EQI++ LP +NIV
Sbjct: 375 CLADWIMCLKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIV 434

Query: 441 QIGNGSIYLEEK-VKDPNIDNYDAMLGEEYDSEQEDNNNKNTDQDLA 486
           +IG G IYLE++  +DP  + Y+A   +E D+E    + +  ++D+ 
Sbjct: 435 KIGRGCIYLEDRNPEDPEAE-YEANTDDESDTEDNVEHRQEDEEDIG 480

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  402 bits (1033), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 197/404 (48%), Positives = 270/404 (66%), Gaps = 9/404 (2%)

Query: 90  SYLIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETL 149
           SY++P +GESY  Y D  ++++LLKRGE     FQ+SI+G L E  Y+LIRT SLT ETL
Sbjct: 46  SYIVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETL 105

Query: 150 AANFPHFH---APTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDH 206
           A+  P +    A  R    KRRY  DN G + D LR ++IVC+PV +++M+M CHLMN+H
Sbjct: 106 ASTNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNH 165

Query: 207 AQYRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVH 266
              ++ H +LS+ Y+NITRD   KA++FCSVCNP + +G L KFKH N Y  ++PLERVH
Sbjct: 166 GFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVH 225

Query: 267 IEIFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIF 326
           IEIFEPF  +KIE KYSH++YCRDY SRYI + PLKNTKFK+LV  +A L  +  R PIF
Sbjct: 226 IEIFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIF 285

Query: 327 IETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWT 386
           IET SL+ QD FDI E I  +Y + +GLG      FH  G++QMK  LE HR+ECL  W 
Sbjct: 286 IETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWN 345

Query: 387 MCLKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQIGNGS 446
           +CLKYG +++N +HNDRA GVP DLL+  +++ + K  EK  QI+     ++++++ NG 
Sbjct: 346 LCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRVDNGL 405

Query: 447 IYLEEKVKDPNIDNYDAMLGEEYDSEQEDNNNKNTDQDLAYEHP 490
           I+LE  V +P+ + +D    E YD  Q + +    ++D+    P
Sbjct: 406 IFLE--VDEPHDEPHD----EPYDEFQFEGDQSIDEEDMGAVMP 443

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  357 bits (915), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 170/365 (46%), Positives = 250/365 (68%), Gaps = 4/365 (1%)

Query: 91  YLIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETLA 150
           +L P++GESY +Y +  ++++LL+RGE   L +Q SI+GQ+   +YELIRT SLT ETLA
Sbjct: 39  FLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLA 98

Query: 151 ANFPHF---HAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHA 207
           +N   +    A ++     RRY A+N G VRD+ +G++IVC+P+ +++++M  HLMNDH 
Sbjct: 99  SNSDKWDKDSAESKYMFLMRRYYAEN-GIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHM 157

Query: 208 QYRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHI 267
            YR  +  L+ IY+NITRDF+  AV++CS CNP     PL K++H N +KG+LPLERVHI
Sbjct: 158 TYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHI 217

Query: 268 EIFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFI 327
           EIFE F+ + I  K+++V+YCRDY +R++ L PLKNTKFK+LVSA+  LL  +  +PIF+
Sbjct: 218 EIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIFM 277

Query: 328 ETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWTM 387
           E+ +L+ QD FDI E +  KY + +GLG  ++ +FH  G+K+MK LL   + +C++DW M
Sbjct: 278 ESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWNM 337

Query: 388 CLKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQIGNGSI 447
           CL+YGP++ N +HN  A G+P DLL  +          K E II  LP  N+V +  G +
Sbjct: 338 CLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVHVNKGLL 397

Query: 448 YLEEK 452
           YLE++
Sbjct: 398 YLEDE 402

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  315 bits (808), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 162/366 (44%), Positives = 235/366 (64%), Gaps = 7/366 (1%)

Query: 91  YLIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETLA 150
           Y+ P +GES + Y   +++V+LL+RG   F+ +  S+ GQL +  YELI+T +LT ETL 
Sbjct: 26  YVTPKLGESQVTY-STDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLL 84

Query: 151 A---NFPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHA 207
           A        +A  +    KRRY  D++  VRD  R + IVC+P L+YE++++ HL+N+H 
Sbjct: 85  AVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNNHL 144

Query: 208 QYRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHI 267
            +R+ H  L S Y+NITRDF+    ++CS CNP + V P  KFKH N Y+G+LPLER+H+
Sbjct: 145 HWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERIHV 204

Query: 268 EIFEPFNGKK-IEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIF 326
           EIF+PF   + IE KYSHV+YCRDY SR++ L PL    F+ LV  + + L +LPR+PIF
Sbjct: 205 EIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLPIF 264

Query: 327 IETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWT 386
           +ET +L+ QD FD+ E I  KYQ+ +GLG+  +  F+  G+++MK LL+ ++K+C  DW 
Sbjct: 265 LETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKDWG 324

Query: 387 MCLKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQIGN-- 444
           MCLKYG ++ NT +N R  G   DLL   V     K   K E+II  L   N+V + +  
Sbjct: 325 MCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFAHNVVTLKDTG 384

Query: 445 GSIYLE 450
           G +Y+E
Sbjct: 385 GMVYVE 390

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  311 bits (796), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 159/416 (38%), Positives = 246/416 (59%), Gaps = 27/416 (6%)

Query: 84  KRRHYGSYLIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKS 143
           K+   G +++P + + ++  +   ++++LL++G    L FQ ++ GQL + +YELIR+ +
Sbjct: 31  KKSRNGEFIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDT 90

Query: 144 LTEETLAANFPHFHAPTRCA-------LFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEM 196
           L+     AN    H     +       L  R +V++  G V D+ R +RIVC+P  ++ +
Sbjct: 91  LS----IANLERCHKWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHL 146

Query: 197 MMTCHLMNDHAQYRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYY 256
           +M  HL N+H      H  L   YANITRD++  A+ +CS CNP     P  K +H N Y
Sbjct: 147 VMCSHLQNNHVTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRHKNVY 206

Query: 257 KGMLPLERVHIEIFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKL 316
             +LPLERVHIE+FEPF+G+KI+G++SH++Y RDY SRY+ + PL+N K K+++ A++  
Sbjct: 207 WELLPLERVHIEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSF 266

Query: 317 LFNLPRIPIFIETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEG 376
           L  LPRIPIF+E+ +++ +  FD+   I E Y + +GLG+K ++RFH  G+K MK LL  
Sbjct: 267 LLGLPRIPIFLESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGS 326

Query: 377 HRKECLNDWTMCLKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPK 436
           H++ECL DW +CLKYGP + N   N  + G P DLL  +V D   K ++K   +I   P 
Sbjct: 327 HKEECLQDWNLCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVILDTPS 386

Query: 437 DNIVQIGNGSIYLE---------EKVKDPNIDNYDAMLGEEYDSEQEDNNNKNTDQ 483
             +V +G G ++LE         E VK+ NI + D       D E+ +N+N N  Q
Sbjct: 387 QQVVHLGEGVLFLENNKEEHKTVEAVKE-NITHSDP------DEERAENDNTNDTQ 435

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  300 bits (769), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 151/365 (41%), Positives = 228/365 (62%), Gaps = 5/365 (1%)

Query: 92  LIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETL-- 149
           ++P++GESY +YVD  ++++LL+RGE     F  S+  QL + +YELI+TKSLT +TL  
Sbjct: 47  ILPSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQ 106

Query: 150 -AANFPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQ 208
            +  +    A  +    +R+Y  D+EG VRD    ++I C+P  +Y+M+M  HLMN H +
Sbjct: 107 ISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLR 166

Query: 209 YRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHIE 268
            +  H  L S +ANI+   +    QFCS CN    + PL ++K  + Y  +LP+ER+HIE
Sbjct: 167 GKTLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 226

Query: 269 IFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFIE 328
           +FEPFNG+ IEGKYS+V+ CRDYRS ++ L PLK+TKFK+L+  ++ L     R+PIF+ 
Sbjct: 227 VFEPFNGEAIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVT 286

Query: 329 TVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWTMC 388
           + +L+  D +DI E I  KY + +GLG+K++ RFHT G+  ++  L  ++KECL DW  C
Sbjct: 287 SSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKC 346

Query: 389 LKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQI--GNGS 446
           L+YGP+ +N + N R    PV +L   V     K   K E++I      N+ ++  G G 
Sbjct: 347 LRYGPYRFNRRRNKRTKRKPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGL 406

Query: 447 IYLEE 451
           IYLE+
Sbjct: 407 IYLED 411

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  298 bits (762), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 157/409 (38%), Positives = 238/409 (58%), Gaps = 16/409 (3%)

Query: 82  DPKRRHYGSYLIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRT 141
           D +R+    + +P VGE+   Y +   D +LL RG + F+ +Q S+ GQL +  ++L+R+
Sbjct: 10  DGRRKDGVKFRMPKVGETLEKYGNGLND-ELLARGRLDFIKYQESVKGQLTQEQFDLVRS 68

Query: 142 KSLTEETLAANFPHFHA---PTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMM 198
            +LT E L +     H+    T+  L KRR+  D +G VRD    + +VC+P  L++++M
Sbjct: 69  SALTAENLMSTSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIM 128

Query: 199 TCHLMNDHAQYRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKG 258
             HL N H  +RR H  L   YAN TR F    V++CS CNP +++ P  KF+H N Y G
Sbjct: 129 CGHLKNGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSG 188

Query: 259 MLPLERVHIEIFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLF 318
           +LPLERVH+EI  PF  K IEG YSHV+Y RDY SR++ ++PL + +   +  A    L 
Sbjct: 189 LLPLERVHVEIIAPFP-KLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLL 247

Query: 319 NLPRIPIFIETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHR 378
           +LPR+PIF+ET +L  QD F++ E I  +Y +++GLGM  +  F   GV++++ LL+ + 
Sbjct: 248 SLPRVPIFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNE 307

Query: 379 KECLNDWTMCLKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDN 438
           + CL  W MCLK+G  N+N  +N R  G+P +LL   V D   +   K E++I  L   N
Sbjct: 308 EPCLKSWHMCLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASN 367

Query: 439 IVQIGN-----GSIYLEEKVKDPNIDNYDAMLGEEYDSEQEDNNNKNTD 482
           +V++ N     G IYLE++       +   M  EEY S + +  N+  D
Sbjct: 368 VVELRNEGRRRGMIYLEDE------SSAFKMPDEEYISAENETENEGFD 410

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  294 bits (753), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 147/365 (40%), Positives = 226/365 (61%), Gaps = 5/365 (1%)

Query: 92  LIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETL-- 149
           ++P++GESY +YVD  ++++LL+RGE     F  S+  QL + +YELI+TKSLT +TL  
Sbjct: 49  ILPSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQ 108

Query: 150 -AANFPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQ 208
            +  +    A  +    +R+Y  D+EG VRD    ++I C+P  +Y+M+M  HL+N H +
Sbjct: 109 ISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLR 168

Query: 209 YRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHIE 268
            +  H  L S +ANI+   +    QFCS CN    + PL ++K  + Y  +LP+ER+HIE
Sbjct: 169 GKTLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 228

Query: 269 IFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFIE 328
           +FEPF+G+ IEGKYS+V+ CRDYRS ++ L PLK+TKFK+L+  I+ L  +  R+PIF+ 
Sbjct: 229 VFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVT 288

Query: 329 TVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWTMC 388
           + +L+  D +DI E I  KY + +GLG+K++ RFHT G+  +   L  +++ECL DW  C
Sbjct: 289 SSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKC 348

Query: 389 LKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQI--GNGS 446
           L+YGP+ +N + N R    P  +L   +     K   K E++I      N+ +   G G 
Sbjct: 349 LRYGPYRFNRRRNKRTKRKPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKGL 408

Query: 447 IYLEE 451
           IYLE+
Sbjct: 409 IYLED 413

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  292 bits (747), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 162/414 (39%), Positives = 240/414 (57%), Gaps = 18/414 (4%)

Query: 82  DPKRRHYGSYLIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRT 141
           D +RR    + +P VGE    Y +  ++++LL+RG + F+ +Q S+ GQL +  ++L+R+
Sbjct: 10  DKRRRDKVEFDMPAVGEPIEKYHNG-LNLELLERGRLDFIKYQESVKGQLTQDQFDLVRS 68

Query: 142 KSLTEETLAANFPHFHA---PTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMM 198
            SLTE+ L       HA    T+  L KRRY  D +G VRD    + +VC+P L+++++M
Sbjct: 69  CSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEPELMFDLIM 128

Query: 199 TCHLMNDHAQYRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKG 258
             HL N H  +RR H  L   YAN TR F    V++CS CNP + + P  KF+H N Y G
Sbjct: 129 CGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKFRHTNIYSG 188

Query: 259 MLPLERVHIEIFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLF 318
           +LPLERVH+EI  PF+ + IEG YSHV++ RDY SR++ ++PLK    +++   +   L 
Sbjct: 189 LLPLERVHVEIISPFS-EAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITKGLLATLL 247

Query: 319 NLPRIPIFIETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHR 378
            LPRIPIFIET +++ QD F+  E +  +Y + +GLGM  +  F   GV++++ LL+ + 
Sbjct: 248 LLPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQSSTFQKNGVERLRYLLQRNE 307

Query: 379 KECLNDWTMCLKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDN 438
           ++CL  W MCLKYG  N+N  +N R  GVP +LL   V D   +   K E +I  L   N
Sbjct: 308 EQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDYGRQFELKREDLIEKLFARN 367

Query: 439 IVQIG-----NGSIYLEEKVKDPNIDNYDAMLGEEYDSEQEDNNNKNTDQDLAY 487
           +V+I       G IYLE++       +   M  EEY S +  N     D DL +
Sbjct: 368 VVEIKVSGRRRGIIYLEDET------SAFKMPDEEYISAE--NETDMNDDDLGF 413

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  295 bits (755), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 149/365 (40%), Positives = 224/365 (61%), Gaps = 5/365 (1%)

Query: 92  LIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETL-- 149
           ++P +GESY +YVD  ++++LL+RGE     F  S+  QL + +YELI+TKSLT ETL  
Sbjct: 100 ILPLMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTAETLQQ 159

Query: 150 -AANFPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQ 208
            +  +    A  +    +R+Y  DNEG VRD+   ++I C+P  +Y+M+M  HLMN H +
Sbjct: 160 ISDKYDGVAAENKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLR 219

Query: 209 YRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHIE 268
            +  H  L S +AN +   +    QFCS CN    + PL ++K  + Y  +LP+ER+HIE
Sbjct: 220 GKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 279

Query: 269 IFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFIE 328
           +FEP+ GK IEGKY +V+ CRDYRS ++ L PLK+TKFK+L+  ++ L  +  RIPIF+ 
Sbjct: 280 VFEPYGGKAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVT 339

Query: 329 TVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWTMC 388
           + +L+  D +DI E I  KY + +GLG+K++ RFHT G+  ++  L  +++ECL DW  C
Sbjct: 340 SSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKC 399

Query: 389 LKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQI--GNGS 446
           L+YGP+ +N + N R    P  +L   V     K   K E++I      N+  +  G G 
Sbjct: 400 LRYGPYRFNRRRNKRTKRKPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGL 459

Query: 447 IYLEE 451
           IYLE+
Sbjct: 460 IYLED 464

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  292 bits (747), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 155/397 (39%), Positives = 234/397 (58%), Gaps = 8/397 (2%)

Query: 60  GSMTRPRSEVXXXXXXXXXXXRDPKRRHYGSYLIPNVGESYMDYVDPEVDVDLLKRGEVT 119
           GS+TR +S             R+P +      ++P++GESY  YVD  ++++LL+RGE  
Sbjct: 21  GSVTR-KSSPQMRKTTSPRESREPLKDRL--LILPSMGESYTAYVDSYLNLELLERGERE 77

Query: 120 FLNFQRSIHGQLDEVVYELIRTKSLTEETL---AANFPHFHAPTRCALFKRRYVADNEGR 176
              F  S+  QL + +YELI+TKSLT +TL   +  +    A  +    +R+Y  DNEG 
Sbjct: 78  TPIFLESLTRQLTQQIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDNEGN 137

Query: 177 VRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQYRRCHVALSSIYANITRDFLYKAVQFCS 236
           VRD    ++I C+P  +Y+M+M  HLMN H + +  H  L S +AN +   +    QFCS
Sbjct: 138 VRDGRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCS 197

Query: 237 VCNPSKLVGPLLKFKHVNYYKGMLPLERVHIEIFEPFNGKKIEGKYSHVIYCRDYRSRYI 296
            CN    + PL ++K  + Y  +LP+ER+HIE+FEPF G  IEGKY +V+ CRDYRS ++
Sbjct: 198 KCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIEGKYPYVLLCRDYRSSFM 257

Query: 297 MLEPLKNTKFKNLVSAIAKLLFNLPRIPIFIETVSLNTQDAFDIFEAIVEKYQINVGLGM 356
            L PLK+TKFK+L+  I+ L  +  R+PIF+ + +L+  D +DI E I  KY + +GLG+
Sbjct: 258 WLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGLCIGLGL 317

Query: 357 KTAKRFHTRGVKQMKILLEGHRKECLNDWTMCLKYGPHNYNTKHNDRACGVPVDLLTCNV 416
           K++ RFHT G+  ++  L  +++ECL DW  CL+YGP+ +N + N R    P  +L   V
Sbjct: 318 KSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYRFNRRRNKRTKRKPAQVLLSEV 377

Query: 417 KDVTHKSIEKYEQIIRTLPKDNIVQI--GNGSIYLEE 451
                K   K E++I      N+ ++  G G IYLE+
Sbjct: 378 PGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLED 414

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  282 bits (721), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 152/395 (38%), Positives = 228/395 (57%), Gaps = 10/395 (2%)

Query: 94  PNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETLA--A 151
           P VG +  +Y+D    V  L+ G      +  SI G L + VYELIR   L  +TL+   
Sbjct: 46  PKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLSEKT 105

Query: 152 NFPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQYRR 211
            +   +A  +C   KRRY    +G V D  R N+IV +P L Y+ +++ H++N H  Y+ 
Sbjct: 106 RWSRINANAKCLYLKRRYKLTKKGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQG 165

Query: 212 CHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHIEIFE 271
            H  L +IY+N++RD++   + FCS CNP K++  L K  H+N Y+  LPLERV ++IFE
Sbjct: 166 IHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIFE 225

Query: 272 PFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFIETVS 331
           PF  +KI+ +YSH+IY RDYRSR++ + PLKNTKFK L S I  LL +LPRIPI+I+T +
Sbjct: 226 PFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDTTT 285

Query: 332 LNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWTMCLKY 391
           +  +D   I + I EKY+I++G+G      F++ G+ ++K LL  ++ +CL DW MCLK 
Sbjct: 286 IERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCLKL 345

Query: 392 GPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQIGN--GSIYL 449
           G + YN K    A GVP +L    ++        K  +II +LP  N  +     G +Y 
Sbjct: 346 GSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYKTSTNKGLVYA 405

Query: 450 EEKV------KDPNIDNYDAMLGEEYDSEQEDNNN 478
           ++++      K  N++N D    E  D+  E + N
Sbjct: 406 QDEILTTSKNKSSNMENGDDTFLEYDDTFIEGSTN 440

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  268 bits (685), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 142/379 (37%), Positives = 221/379 (58%), Gaps = 16/379 (4%)

Query: 106 PEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETLAANFPHFHAPT---RC 162
           PE+D D L  G    +    ++ GQL + +YELI + +L+ +TL        A T   + 
Sbjct: 49  PELDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKF 108

Query: 163 ALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQYRRCHVALSSIYAN 222
            L KRRY +  +G V D  R +  V +P L+++++M  HL+N H  +R+ H  L ++YAN
Sbjct: 109 VLLKRRY-SILQGNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYAN 167

Query: 223 ITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHIEIFEPFN---GKKIE 279
           +TRDF      +CS CN  + +   L++KH N Y  ++PLER H+EIF PF+    +KIE
Sbjct: 168 VTRDFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIE 227

Query: 280 GKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFIETVSLNTQDAFD 339
            KYSHV+YCRDY SR++ + PL+   F++LV A+ +LL ++ R+PIF+ET +L+ QD FD
Sbjct: 228 DKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFD 287

Query: 340 IFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWTMCLKYGPHNYNTK 399
           + E I  KY++ +GLG+ +   F   GV ++K L   H+++C+ +W MCL+      N  
Sbjct: 288 VCEYIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQN 347

Query: 400 HNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQI--GNGSIYLEEKVKDPN 457
           ++DR  G+P DLL   + ++ HK   K  +II  L   ++VQ     G IYLE+      
Sbjct: 348 YSDRVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLED------ 401

Query: 458 IDNYDAMLGEEYDSEQEDN 476
            DN   ++ E+    + DN
Sbjct: 402 -DNSAFVVDEDEHGPENDN 419

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  255 bits (651), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 143/411 (34%), Positives = 223/411 (54%), Gaps = 15/411 (3%)

Query: 92  LIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETLAA 151
           L+P +G+ + +Y D ++D++  KRGE     +  +  G++ + +Y L +   +T+E +A 
Sbjct: 35  LVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIAR 94

Query: 152 NFPHFHA---PTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQ 208
            +P   +     +     RRY  D  G +RD    NRIV DP+  ++++M+CHLMN H  
Sbjct: 95  LYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLG 154

Query: 209 YRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHIE 268
             R +  L   YAN     + + +++CSVCNPS  + P ++ K   + K  LPLER+ IE
Sbjct: 155 SERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTPKVQPKPYLFEKA-LPLERITIE 213

Query: 269 IFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFIE 328
           I EPF  +K+EGKYS+++  +D+  R+  LEPLKNTKFKN+V  +AK++ + PR+PI++E
Sbjct: 214 IIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVE 273

Query: 329 TVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWTMC 388
           + +L+  D FDIFE IV KY I +GLG  T +    +   ++   L  H  ECL D+  C
Sbjct: 274 SNTLDWSDLFDIFEMIVTKYGIKIGLGC-TTRSSAAQATARINRDLNDHHDECLFDFNNC 332

Query: 389 LKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQIGNGSIY 448
           LKYGP  YN          P D+++ +   +  K   K   I++  P   ++  G G++Y
Sbjct: 333 LKYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILKHSPSSCVMNRGMGTLY 392

Query: 449 LEEKVKDPNIDNYDAM------LGEEYDSEQEDNNNKNTDQDLAYEHPDYE 493
           LE     PN    DA       L    D+E E+ +N   +     E  D E
Sbjct: 393 LE----SPNGIQEDAAASSADELSSAKDAEDEERDNSTREGSGNGEESDTE 439

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  254 bits (648), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 148/402 (36%), Positives = 220/402 (54%), Gaps = 21/402 (5%)

Query: 107 EVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETL---AANFPHFHAPTRCA 163
           E+D D+L  G +       ++ GQL + +Y+L+ + +LT+E L   +    +     +  
Sbjct: 72  ELDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKENLLRASDKVTNSTVENKFV 131

Query: 164 LFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQYRRCHVALSSIYANI 223
           L KRRY    E  + D  R + +V +P  L++++M+ H++N H   +  +  LS+ YAN+
Sbjct: 132 LLKRRYYV-QENLLHDVKRKDLVVYEPNELFDLIMSVHVLNSHVSSKGIYNELSTFYANV 190

Query: 224 TRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHIEIFEPFNGK------- 276
           T+ F      FCS CN S       KFKH N +  ++PL R H+EIF PF+         
Sbjct: 191 TQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGRCHVEIFAPFDSAYQGNDNT 250

Query: 277 ---KIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFIETVSLN 333
              KIEGKY  V+YCRDY SRY+ LEPLK+    +L+  + KLLF++ R+PIFI+T +L+
Sbjct: 251 DELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKLLFSMIRMPIFIDTCTLD 310

Query: 334 TQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWTMCLKYGP 393
            QD FD+ E I   Y+I +GLGM ++  F   G+K+MK L   H++ECL+DW MCLK   
Sbjct: 311 RQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQHKEECLHDWNMCLKLVV 370

Query: 394 HNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQ-IIRTLPKDNIVQI--GNGSIYLE 450
              N  ++DR  GVP DLL C+ +   HK     ++ +I  L   ++VQ     G IYLE
Sbjct: 371 SRLNQNYSDRVRGVPSDLL-CSTQQDLHKKFRTLQRNVISRLLGHHVVQFEEAGGMIYLE 429

Query: 451 EKVKDPN--IDNYDAMLGEEYDSEQEDNNNKNTDQDLAYEHP 490
           ++   PN  +   D     E+DSE  D    + D     E P
Sbjct: 430 DE-NSPNLLLSGDDNSEESEHDSEIFDELASSRDGTPISEQP 470

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  251 bits (641), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 145/393 (36%), Positives = 215/393 (54%), Gaps = 37/393 (9%)

Query: 88  YGSYLIPNVGESYMDYV---DPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSL 144
           Y  +++P + E+Y DY+   D  +DVD LKRGE     F   + G+L +  Y L+   +L
Sbjct: 57  YNKFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNL 116

Query: 145 TEETL--AAN-FPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCH 201
           T ET+  A N +P   A T+ +   +R+  D EG +RD    N IV +P  L+ +++T H
Sbjct: 117 TMETVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAH 176

Query: 202 LMNDHAQYRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLP 261
           L N H +       L  +YAN TRDF+  A+ +C+ CNP + + P+ K +H N  + +LP
Sbjct: 177 LKNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLP 236

Query: 262 LERVHIEIFEPFNGK--------------KIEGKYSHVIYCRDYRSRYIMLEPLKNTKFK 307
           LERVHIE+F PF  +              KIEGKYSHV YCRD+R+RY+   PLKN KFK
Sbjct: 237 LERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFK 296

Query: 308 NLVSAIAKLLFN-LPRIPIFIETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRG 366
            LV  IA      L   PIF+E+ +++  D  +IFE +  KY + +GLG     +FH +G
Sbjct: 297 TLVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQG 356

Query: 367 VKQMKILLEGHRKECLNDWTMCLKYGPHNYNTKHNDRACGVPVDLLTCNV-----KDVTH 421
           +K+ K  L   + EC +DW MCLK G ++ N +  +R  G   ++L   +     +D+  
Sbjct: 357 IKRFKTHLHRAKSECADDWLMCLKQGTYSAN-RVIERQLGKASNILFTELMGQFERDMRK 415

Query: 422 KSIEKYEQI----IRTLPKDNIVQIGNGSIYLE 450
           K ++  EQ     I+T PK        G I++E
Sbjct: 416 KKLKYIEQSFSENIKTYPK------SGGCIFIE 442

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  246 bits (627), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 139/383 (36%), Positives = 211/383 (55%), Gaps = 8/383 (2%)

Query: 85  RRHYGSYLIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSL 144
           R H    ++P +        +  ++ +L  RG      FQ +I+G L + +Y+LI T  L
Sbjct: 54  RSHLKELVLPEIKNLDELISESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKL 113

Query: 145 TEETLA---ANFPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCH 201
           T + ++     + +        L  R YV+D    VRD+   ++I+C P  + E+++  H
Sbjct: 114 TPKKVSREKVKWANKSNEKYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTH 173

Query: 202 LMNDHAQYRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLP 261
           L+N+HA ++  H  L   YANI+R     ++ +CS CNPS+ V PL K K    Y+G+LP
Sbjct: 174 LINEHAAHKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLP 233

Query: 262 LERVHIEIFEPFNGKK-IEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNL 320
            ER+HIEIF+PF  +K IEG YSH++Y RDY SRY+ L PLK T FK L   +    F +
Sbjct: 234 FERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTI 293

Query: 321 PRIPIFIETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKE 380
            + PI+IE+ ++N  D   + + I  KY + +G+G+  +  FH  G++ MK LL  H  E
Sbjct: 294 TKTPIYIESSTINRNDLIAMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDE 353

Query: 381 CLNDWTMCLKYGPHNYNTKHNDRACGVPVD-LLTCNVKDVTHKSIEKYEQII-RTLPKDN 438
           CL DW MCLKYG + +N   N +  G+P++ LL   + + + K   K   +I  T P + 
Sbjct: 354 CLGDWGMCLKYGKNLHNNLKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNM 413

Query: 439 IV-QIGNGSIYLEEKVKD-PNID 459
           IV   G   IYLE+ +   P ID
Sbjct: 414 IVLDNGKSEIYLEDNLTSTPVID 436

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  247 bits (630), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 130/357 (36%), Positives = 212/357 (59%), Gaps = 9/357 (2%)

Query: 104 VDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETLAANFPHFHAPT--- 160
           +D  ++ + + RG        +++ GQL + +Y+LI + +L+ + L          T   
Sbjct: 41  LDGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVEN 100

Query: 161 RCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQYRRCHVALSSIY 220
           +  L KRRYVA   G V D+ R +  V +P  L++M+M+ HL+NDH  +R+ +  +  +Y
Sbjct: 101 KYVLLKRRYVAKG-GIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLY 159

Query: 221 ANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHIEIFEPFNGK---K 277
           AN+TR+       +CS CN  + V    ++KH N ++ ++PLER H+E+F PF+ +   K
Sbjct: 160 ANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEK 219

Query: 278 IEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFIETVSLNTQDA 337
           I+GKYSH +YCRDY SR+I L PL+   F+ L+ A+A+LL  + R+PIF+ET +L+ QD 
Sbjct: 220 IQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDM 279

Query: 338 FDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWTMCLKYGPHNYN 397
           FDI E I  +Y+  +GLG+ +   F   G+K++K LL  +++EC +DW MCL+      N
Sbjct: 280 FDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVN 339

Query: 398 TKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQI--GNGSIYLEEK 452
             + DR  G+P DLL   + +++ K  +K ++II  L   ++V      G IYLE++
Sbjct: 340 QTYADRVRGIPSDLLCNEIPNISMKFKQKQKKIIDQLYAHHVVHFKEAGGMIYLEDE 396

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  198 bits (503), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 113/373 (30%), Positives = 201/373 (53%), Gaps = 10/373 (2%)

Query: 91  YLIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETLA 150
           Y+IP +G+ Y   + P +D  LL++GE+   N   S    L + +Y+L++   LT + +A
Sbjct: 31  YIIPRIGQKYDSLITPLLDKQLLQKGEIAVAN---SKTNYLSKELYDLVKNDDLTRKNVA 87

Query: 151 A--NFPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQ 208
              N    +A TR    K RY  D++  V D+ + N+IV DP   + M+MT HL+NDH  
Sbjct: 88  VALNLDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLT 147

Query: 209 YRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHIE 268
               +  LS  +AN++  F+  ++++CS+CN +K      K   ++    +L  ER+ ++
Sbjct: 148 RGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYERLILD 207

Query: 269 IFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFIE 328
           +  PF  KKI+ +Y+H++   D+ ++++   PLKN K + ++S + + +  LP  P+FI 
Sbjct: 208 VVAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKPVFIS 267

Query: 329 TVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWTMC 388
           + +L+  D F++   +  +Y I++GLG +  ++ +++     +I L  H+ ECL  W MC
Sbjct: 268 SFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKNPYVTRI-LNSHKTECLKSWFMC 326

Query: 389 LKY-GPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQIGNGS- 446
           LK+      N+K + R       L +  + D   K  E+ + II  LP +N + I  GS 
Sbjct: 327 LKWLADRQSNSKFDIRPPNKNYGLFS-GMTDFLKKYEERSKMIIGRLPSENFINIDEGSH 385

Query: 447 -IYLEEKVKDPNI 458
            IY E++    N+
Sbjct: 386 FIYSEDEFSFDNL 398

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  176 bits (445), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 108/379 (28%), Positives = 198/379 (52%), Gaps = 22/379 (5%)

Query: 95  NVGESYMDYVDPE---VDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETL-- 149
           ++G SY DY+D +   V+++LL++G      +       L +   +++ T +L+ E +  
Sbjct: 34  DLGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIK 93

Query: 150 --AANFPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHA 207
                  H  A  +     RRY  + +  + D+ +  RI+C+P  +Y++++  HL   H+
Sbjct: 94  YDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHL-KLHS 152

Query: 208 QYRRCHVALSSIYANITRDFLYKAVQFCSVCNPS-----KLVGPLLKFKHVN---YYKGM 259
            Y      L   ++N+ R ++    ++CS C P      KL    + FK++      + +
Sbjct: 153 SYAVSE-RLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPL 211

Query: 260 LPLERVHIEIFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFN 319
            P+ER+HIEIF PF+  KIE KY  ++Y RDY +RYI    LK  K K++ + + +   +
Sbjct: 212 FPMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLS 271

Query: 320 LP-RIPIFIETVSLNTQDAFDIFEAIVEKYQINVGLGMKTA-KRFHTRGVKQMKILLEGH 377
           +   +PIF+++ +++  D FDI E I  +Y I++GLG       FH  G++  K L+  +
Sbjct: 272 IATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLN 331

Query: 378 RKECLNDWTMCLKYGPHNYNTKHNDRACGVPVDLLTC-NVKDVTHKSIEKYEQIIRTLPK 436
           + +CL  W+  L +G   +N K N R    P+D++ C N+     K  ++  +II+    
Sbjct: 332 KSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTIT 391

Query: 437 DNIVQIGNGS--IYLEEKV 453
           DN V++GN +  I++E++ 
Sbjct: 392 DNYVKLGNVASIIFIEDEA 410

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  169 bits (427), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 110/384 (28%), Positives = 191/384 (49%), Gaps = 25/384 (6%)

Query: 93  IPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETLA-A 151
           IP +   Y   +  ++D++ +  G    L  +      L + +Y LIR K+   ET   A
Sbjct: 24  IPELDILYKIELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEEA 83

Query: 152 NFPHFH--------APTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLM 203
              H+         A  +  L + RY  +  G++ D+    +++  P  +Y+++M CH +
Sbjct: 84  MKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHFL 143

Query: 204 NDHAQYRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGM---- 259
           NDH    + H +L   Y+NI+R  +  ++Q CS CNP         +KH+ Y +      
Sbjct: 144 NDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKS------TYKHIEYTRHFSCDK 197

Query: 260 -LPLERVHIEIFEPF-NGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLL 317
               E++H+EIF+PF +      K+SHVIY RDY +RY+ L PL+    K L + +A  L
Sbjct: 198 NFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHL 257

Query: 318 FNLPRIPIFIETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGH 377
               RIPI+IE+++L+  +   I + I +   + +G+G      F   G+  MK L   +
Sbjct: 258 LLSLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQN 317

Query: 378 RKECLNDWTMCLKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQ--IIRTLP 435
           R+ C N+W   +    ++YNT +N    G+P++L+        +K+ +K  Q  I+ TL 
Sbjct: 318 REYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETL-ADNKTYKKKRQRTILLTLS 376

Query: 436 KDNIVQIGNGSIYLEEKVKDPNID 459
           K+ I+ + NG   L ++  + +ID
Sbjct: 377 KNTIL-LKNGKSALYKESTENSID 399

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  157 bits (398), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 106/366 (28%), Positives = 190/366 (51%), Gaps = 11/366 (3%)

Query: 91  YLIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETLA 150
           +  P +G+    Y D  +D D+LKRGE   + F+ ++   +   +Y  +R +SL E+   
Sbjct: 28  FFCPPIGDDDEIYYDSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAP 87

Query: 151 ANFPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQYR 210
                    ++    + RY  +++G + +  + N+++C+P  +Y++ M  H MN+H +  
Sbjct: 88  IPASLKIKTSKKMYLQIRYSKNSDGDLIET-KTNKLLCEPKYIYKLTMKAHFMNNHMRSN 146

Query: 211 RCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLK-FKHVNYYKGMLPLERVHIEI 269
           + +  LS  Y NI    +   +Q+CS CN +  +  +   +   N Y   LPLER+ I+I
Sbjct: 147 KLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERLQIDI 206

Query: 270 FEPFNGK--KIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFI 327
            +PFN    KI  KYSH++  RDY SRY  + PLK+   KN+ + + K L  LPR PIF+
Sbjct: 207 TKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTPIFL 266

Query: 328 ETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKR--FHTRGVKQMKIL--LEGHRKECLN 383
            ++ +       I   I+ +Y+I + +G+   K   F  +G+ ++  L  L+ ++++C +
Sbjct: 267 HSIGIPESQLIKILTKILLEYKIKIRIGIGGIKGRMFLRKGISRLVYLLNLKENKEKCKS 326

Query: 384 DWTMCLKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIE-KYEQIIRTLPKDNIVQI 442
           DW  C++      N +  DR  G   + L    K   +K  E K + ++  L ++N+++I
Sbjct: 327 DWYQCIRNTTFKENRRF-DRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEENVLKI 385

Query: 443 GN-GSI 447
           G  GSI
Sbjct: 386 GECGSI 391

>KLTH0F03476g Chr6 complement(302182..304512) [2331 bp, 776 aa] {ON}
           similar to uniprot|P39531 Saccharomyces cerevisiae
           YJL204C RCY1 ReCYcling 1
          Length = 776

 Score = 34.7 bits (78), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 65/157 (41%), Gaps = 33/157 (21%)

Query: 85  RRHYGSYLIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSI---HGQLDEVVYELIRT 141
           R  +  YL P +    M+Y+D  V  +  ++ E+T LNFQ+       + +E +Y  +R 
Sbjct: 325 REFFNLYLEPKI----MNYLDTTVQ-EFGQKIELTLLNFQKETTLKEQEQNEQIYSDLRD 379

Query: 142 KSLTEETLAANFPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCH 201
           K+  ++ L     +F        F + +   N  R  ++ R            +M    +
Sbjct: 380 KASKQQQLIDQKNNFLTS-----FTKIFKITNNNRTAEEER-----------LQMAYNLN 423

Query: 202 LMNDHAQYRRCHVALSSIYANITRDFLYKAVQFCSVC 238
           +MN++ Q  +  V+L         D  YK VQ C  C
Sbjct: 424 VMNNNLQNIQVLVSL---------DLCYKVVQDCKFC 451

>NCAS0A06040 Chr1 complement(1193225..1194991) [1767 bp, 588 aa]
           {ON} 
          Length = 588

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 67/177 (37%), Gaps = 19/177 (10%)

Query: 162 CALFKRRYVA-DNEGRVRDQLRGN---RIVCDPVLLYEMMMTCHLMND---------HAQ 208
           C     RYV  D +   R   +G+   ++ C P L+   ++  H   D         H  
Sbjct: 108 CDYITARYVVIDEKIYARKASKGDESPKMWCPPSLMTFFIIRYHRRQDIDESERKARHRG 167

Query: 209 YRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHIE 268
               H A+    + ITR  +      C  CN +K V P++     N  K  +P E + I+
Sbjct: 168 VAATHDAIGEKMSGITRQLIQDVTYDCLKCNVTKGV-PIIYVPDDN-PKAEVPFENLLID 225

Query: 269 IFE----PFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLP 321
           I +         K   K S +++  D  + Y  L  L +T    +      LL++ P
Sbjct: 226 IIDLKDRSCRCPKDNKKKSQILHIMDQYTEYTWLYILDDTHHDAIAMIFEVLLYHFP 282

>TPHA0N00600 Chr14 (128725..134391) [5667 bp, 1888 aa] {ON} Anc_5.191
            YLR024C
          Length = 1888

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 42/88 (47%), Gaps = 11/88 (12%)

Query: 233  QFCSVCNPSKLVGPLLKFKHVNYYKG-------MLPLERVHIEIFEPFNGKKIEGKYSHV 285
            ++ ++C+PS L   L KF  +N++          L L R+ I     F+   I+  Y  V
Sbjct: 1588 EYVTLCHPSVLSQELTKFDKINFHIHHIIINSLALFLRRLAIIFMAFFSTWNID--YKGV 1645

Query: 286  IYCRDYRSRY--IMLEPLKNTKFKNLVS 311
            I C DY++R   I+L   K  K +  +S
Sbjct: 1646 IDCGDYKAREIDILLSQFKLNKLETFLS 1673

>NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON} 
          Length = 1403

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 10/73 (13%)

Query: 235 CSVCNPSKLVGPLLKFKHV-----NYYKGMLPLERVHIEIFEPFNGKKIEGKYSHVIYCR 289
           C  C    L G + K KH+      Y K   P E +H ++F P +G  I     + I   
Sbjct: 348 CKDC----LAGKITKHKHIVGSRLKYQKSYEPFEYIHTDLFGPVSGVDITSP-KYFISFT 402

Query: 290 DYRSRYIMLEPLK 302
           D  +R+  + PLK
Sbjct: 403 DENTRFRWVFPLK 415

>KLLA0F21758g Chr6 complement(2023805..2028523) [4719 bp, 1572 aa]
            {ON} similar to uniprot|Q05471 Saccharomyces cerevisiae
            YDR334W SWR1 Swi2/Snf2-related ATPase
          Length = 1572

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 10/51 (19%)

Query: 276  KKIEGKYSHVIYCR----------DYRSRYIMLEPLKNTKFKNLVSAIAKL 316
            K++ GKY H+IYCR          D+ SR    E L +  F ++++ + +L
Sbjct: 1008 KQMPGKYEHIIYCRLSKRQRFLYDDFMSRAQTKETLASGNFMSIINCLMQL 1058

>Suva_13.330 Chr13 (542402..543499) [1098 bp, 365 aa] {ON} YMR152W
           (REAL)
          Length = 365

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%)

Query: 275 GKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLV 310
           G K+ G YSH+   R   S Y++L+P KN    ++V
Sbjct: 92  GDKVNGMYSHIYGERGSLSHYLILDPAKNAPITHMV 127

>KNAG0C05310 Chr3 complement(1034251..1038816) [4566 bp, 1521 aa] {ON}
            Anc_5.383 YDR334W
          Length = 1521

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 14/97 (14%)

Query: 276  KKIEGKYSHVIYCR-DYRSRYIMLEPLKNTKFK-NLVSA----IAKLLFNLPRI---PIF 326
            K++ GKY H+++CR   R RY+  + +  ++ K NL S     I   L  L ++   P  
Sbjct: 953  KQMPGKYEHIVFCRLSKRQRYLYDDFMSRSQTKANLASGNFMTIVNCLMQLRKVCNHPDL 1012

Query: 327  IETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFH 363
             E   + T  +FD   +++ KY   +     T  +FH
Sbjct: 1013 FEVRPILT--SFDCGPSVLSKYAATL---KATNSKFH 1044

>TBLA0A03310 Chr1 (787743..792512) [4770 bp, 1589 aa] {ON} Anc_5.383
            YDR334W
          Length = 1589

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 10/51 (19%)

Query: 276  KKIEGKYSHVIYCR----------DYRSRYIMLEPLKNTKFKNLVSAIAKL 316
            K++ GKY H++YCR          D+ SR    E L +  F ++V+ + +L
Sbjct: 1047 KQMPGKYEHIVYCRLSKRQRYLYDDFMSRTKTKETLASGNFMSIVNCLMQL 1097

>NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 6/80 (7%)

Query: 243 LVGPLLKFKHV-----NYYKGMLPLERVHIEIFEPFNGKKIEGKYSHVIYCRDYRSRYIM 297
           L G L K KH+      Y K   P E +H ++F P +G  I     + I   D  +R+  
Sbjct: 267 LAGKLTKHKHIVGSRLKYQKYYEPFEYIHTDLFGPVSGVDITSP-KYFISFTDENTRFRW 325

Query: 298 LEPLKNTKFKNLVSAIAKLL 317
           + PLK     +++    +L+
Sbjct: 326 VFPLKKKDADHILPIFQQLV 345

>ZYRO0G04730g Chr7 complement(374995..378903) [3909 bp, 1302 aa]
           {ON} similar to uniprot|Q04693 Saccharomyces cerevisiae
           YML049C RSE1 RNA splicing and ER to Golgi transport
           involved in secretion and RNA splicing
          Length = 1302

 Score = 31.6 bits (70), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 4/70 (5%)

Query: 401 NDRACGVPVDLLTCN----VKDVTHKSIEKYEQIIRTLPKDNIVQIGNGSIYLEEKVKDP 456
           N RA    +   + N    V   TH  +  +E IIR  PKD  ++   G  +++   K P
Sbjct: 913 NMRAITAAITKFSSNTYYLVVSTTHNQLYTFELIIRRAPKDKSIRDCVGEFHMKLLHKTP 972

Query: 457 NIDNYDAMLG 466
             D   AM+G
Sbjct: 973 TEDKVHAMVG 982

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,861,073
Number of extensions: 2846325
Number of successful extensions: 14178
Number of sequences better than 10.0: 81
Number of HSP's gapped: 14584
Number of HSP's successfully gapped: 81
Length of query: 624
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 508
Effective length of database: 40,180,143
Effective search space: 20411512644
Effective search space used: 20411512644
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)