Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0J01370singletonON1181184942e-65
NDAI0A083507.123bON262913197e-37
NDAI0G04990singletonON122863071e-36
NCAS0I006607.123bON252912961e-33
NDAI0A03890singletonON249892951e-33
NDAI0J02580singletonON120872825e-33
KAFR0K010407.161ON237842854e-32
Skud_5.1117.161ON214912783e-31
Skud_5.112na 1ON250912785e-31
Smik_5.1267.161ON241912769e-31
Skud_15.171na 2ON435872798e-30
Suva_5.997.161ON257912701e-29
NDAI0I03040singletonON121842592e-29
CAGL0H09592gsingletonON236882593e-28
KNAG0L008707.161ON230872583e-28
CAGL0H09614g7.161ON236882584e-28
Suva_15.186na 2ON481872675e-28
YER011W (TIR1)7.161ON254912543e-27
YOR009W (TIR4)na 2ON487922581e-26
Suva_15.1877.123bON251882472e-26
Smik_15.1847.123bON281912432e-25
Smik_15.183na 2ON469852474e-25
Skud_15.1727.123bON242912385e-25
NCAS0I006907.161ON185752321e-24
CAGL0F01463g7.123bON221812341e-24
CAGL0F01485gna 2ON337842382e-24
KNAG0L00920singletonON2551132333e-24
YOR010C (TIR2)7.123bON251912247e-23
KAFR0G02805singletonON206912148e-22
SAKL0F04356gsingletonON231921974e-19
KAFR0G027407.161ON195841902e-18
Smik_9.1837.123bON235861922e-18
TPHA0L00795singletonON212921903e-18
YIL011W (TIR3)7.123bON269911924e-18
TPHA0I02160singletonON223921895e-18
TPHA0I02190singletonON223921895e-18
NDAI0G03460singletonON120841828e-18
KNAG0G010307.123bON234871843e-17
NDAI0A07480na 3ON210801824e-17
NDAI0F02120singletonON59521682e-16
CAGL0L07502gna 3ON228851764e-16
TBLA0A011407.123bON235841757e-16
KAFR0G02820singletonON456871797e-16
YBR067C (TIP1)na 3ON210841739e-16
CAGL0C03872g7.123bON255811741e-15
Skud_9.1617.123bON263811742e-15
Smik_2.200na 3ON210881712e-15
TPHA0I02210singletonON248951689e-15
NCAS0I01540na 3ON214861661e-14
Suva_4.306na 3ON197801642e-14
Skud_2.190na 3ON209811642e-14
Suva_9.1937.123bON281831662e-14
TPHA0L008007.123bON287841663e-14
KAFR0I02140singletonON120871532e-13
TPHA0I021407.161ON244891583e-13
TBLA0G00500singletonON271861583e-13
KAFR0G02810singletonON349781584e-13
TBLA0J018107.161ON423891568e-13
NCAS0F008007.123bON247871531e-12
Ecym_12237.123bON181941492e-12
Ecym_44657.161ON242881512e-12
Smik_5.127na 1ON67481403e-12
TBLA0A01110singletonON243811494e-12
TBLA0J01865singletonON239851485e-12
NDAI0H012907.123bON259961495e-12
Suva_5.100na 1ON67491361e-11
KAFR0K01210na 2ON242831451e-11
KAFR0K012207.123bON252861391e-10
NDAI0E036507.161ON393861373e-10
TBLA0J01790singletonON222861354e-10
NDAI0H01300na 2ON233801354e-10
TPHA0C05010singletonON202821302e-09
KNAG0J00780na 3ON209901222e-08
TBLA0J01845singletonON270841205e-08
TBLA0J01800singletonON230761196e-08
NCAS0E021107.161ON737781181e-07
TBLA0A011207.161ON213821152e-07
Suva_5.21na 4ON124901113e-07
NCAS0B00460singletonON306881092e-06
NCAS0E02100singletonON224781073e-06
NDAI0A08910singletonON492851074e-06
NCAS0B00470singletonON148821044e-06
Skud_10.376na 5ON297811074e-06
Suva_10.48na 6ON123901034e-06
YFL020C (PAU5)na 7ON122851017e-06
Skud_5.41na 4ON120861018e-06
Smik_10.445na 5ON292821049e-06
YEL049W (PAU2)na 4ON120851001e-05
TBLA0H00500singletonON654881041e-05
Suva_12.247na 5ON299831031e-05
Smik_3.7singletonON12085991e-05
YJR150C (DAN1)na 5ON298871031e-05
Skud_1.71na 8ON12086991e-05
Skud_6.51na 7ON12086991e-05
TPHA0I02200singletonON266881022e-05
Smik_1.80na 8ON12085982e-05
YJL223C (PAU1)singletonON12085982e-05
YIL176C (PAU14)singletonON12085982e-05
YDR542W (PAU10)singletonON12085982e-05
YGR294W (PAU12)na 9ON12085982e-05
YAL068C (PAU8)singletonON12085972e-05
YGL261C (PAU11)singletonON12085972e-05
YBR301W (PAU24)singletonON12085972e-05
YHL046C (PAU13)singletonON12085972e-05
Suva_12.248na 10ON14683983e-05
Smik_12.39na 6ON12485973e-05
YLR037C (PAU23)na 11ON12485964e-05
YLL025W (PAU17)na 6ON12485964e-05
Suva_5.106singletonON12485964e-05
Suva_7.585na 9ON12485965e-05
Suva_14.413singletonON12185955e-05
KNAG0B06950singletonON53380995e-05
Smik_16.460singletonON12485956e-05
YLR461W (PAU4)na 12ON12080956e-05
Smik_5.10singletonON12485956e-05
Smik_5.360singletonON12485956e-05
Skud_5.2singletonON12485957e-05
Skud_12.556singletonON12485957e-05
Skud_3.170singletonON12485957e-05
Skud_3.174singletonON12085948e-05
Skud_14.3singletonON12085948e-05
Suva_6.39na 7ON12185948e-05
Suva_12.243singletonON27381978e-05
Suva_7.36na 13ON12380949e-05
YOL161C (PAU20)singletonON12080939e-05
Skud_12.104na 11ON12485931e-04
Smik_2.6na 14ON12480931e-04
Smik_14.411singletonON12480931e-04
Suva_1.96singletonON12185922e-04
Suva_1.88na 8ON12185922e-04
YNR076W (PAU6)singletonON12080922e-04
YLL064C (PAU18)singletonON12080922e-04
Smik_5.44na 4ON12080912e-04
Smik_17.5singletonON12080912e-04
Smik_19.2singletonON12080912e-04
Smik_10.12singletonON25588932e-04
ADR019C7.161ON21092933e-04
YCR104W (PAU3)singletonON12485903e-04
YMR325W (PAU19)singletonON12485903e-04
YKL224C (PAU16)singletonON12385903e-04
YPL282C (PAU22)singletonON16485913e-04
YOR394W (PAU21)singletonON16485913e-04
YIR041W (PAU15)singletonON12485894e-04
TPHA0I02150singletonON43887915e-04
Skud_10.379singletonON33783907e-04
Smik_12.560na 12ON6147847e-04
NDAI0A07890singletonON66581908e-04
Skud_7.45na 13ON12480860.001
TBLA0J01850singletonON46578880.001
KNAG0B06980singletonON66581860.003
KAFR0B07040singletonON27075850.004
KNAG0E01130singletonON13286800.009
Skud_74.1singletonOFF7147760.012
Skud_12.43na 6ON7047760.013
YJR151C (DAN4)na 10ON116183810.014
KNAG0M00110singletonON26086720.16
NCAS0B00350singletonON42979710.28
KNAG0I02500singletonON109688642.2
KNAG0I02620singletonON119688642.4
NCAS0A00140singletonON112842615.5
Kwal_33.14475singletonOFF16557599.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0J01370
         (118 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0J01370 Chr10 (316516..316872) [357 bp, 118 aa] {ON}              194   2e-65
NDAI0A08350 Chr1 (1919746..1920534) [789 bp, 262 aa] {ON}             127   7e-37
NDAI0G04990 Chr7 (1211201..1211569) [369 bp, 122 aa] {ON}             122   1e-36
NCAS0I00660 Chr9 complement(108938..109696) [759 bp, 252 aa] {ON}     118   1e-33
NDAI0A03890 Chr1 (875388..876137) [750 bp, 249 aa] {ON}               118   1e-33
NDAI0J02580 Chr10 (641847..642209) [363 bp, 120 aa] {ON}              113   5e-33
KAFR0K01040 Chr11 complement(214416..215129) [714 bp, 237 aa] {O...   114   4e-32
Skud_5.111 Chr5 (172527..173171) [645 bp, 214 aa] {ON} YER011W (...   111   3e-31
Skud_5.112 Chr5 (172527..173141,173173..173310) [753 bp, 250 aa]...   111   5e-31
Smik_5.126 Chr5 (179561..180286) [726 bp, 241 aa] {ON} YER011W (...   110   9e-31
Skud_15.171 Chr15 (305234..306541) [1308 bp, 435 aa] {ON} YOR009...   112   8e-30
Suva_5.99 Chr5 (150965..151738) [774 bp, 257 aa] {ON} YER011W (R...   108   1e-29
NDAI0I03040 Chr9 (721361..721726) [366 bp, 121 aa] {ON}               104   2e-29
CAGL0H09592g Chr8 (937859..938569) [711 bp, 236 aa] {ON} highly ...   104   3e-28
KNAG0L00870 Chr12 (163016..163708) [693 bp, 230 aa] {ON} Anc_7.1...   103   3e-28
CAGL0H09614g Chr8 complement(939286..939996) [711 bp, 236 aa] {O...   103   4e-28
Suva_15.186 Chr15 (318697..319620,319660..319847,319953..320286)...   107   5e-28
YER011W Chr5 (175248..176012) [765 bp, 254 aa] {ON}  TIR1Cell wa...   102   3e-27
YOR009W Chr15 (344335..345798) [1464 bp, 487 aa] {ON}  TIR4Cell ...   103   1e-26
Suva_15.187 Chr15 complement(320743..320885,320925..321128,32157...   100   2e-26
Smik_15.184 Chr15 complement(313478..314323) [846 bp, 281 aa] {O...    98   2e-25
Smik_15.183 Chr15 (311669..313078) [1410 bp, 469 aa] {ON} YOR009...   100   4e-25
Skud_15.172 Chr15 complement(306986..307714) [729 bp, 242 aa] {O...    96   5e-25
NCAS0I00690 Chr9 complement(119082..119639) [558 bp, 185 aa] {ON...    94   1e-24
CAGL0F01463g Chr6 (149905..150570) [666 bp, 221 aa] {ON} similar...    95   1e-24
CAGL0F01485g Chr6 complement(151321..152334) [1014 bp, 337 aa] {...    96   2e-24
KNAG0L00920 Chr12 (168872..169639) [768 bp, 255 aa] {ON}               94   3e-24
YOR010C Chr15 complement(346195..346950) [756 bp, 251 aa] {ON}  ...    91   7e-23
KAFR0G02805 Chr7 (584975..585595) [621 bp, 206 aa] {ON}                87   8e-22
SAKL0F04356g Chr6 (349995..350690) [696 bp, 231 aa] {ON} some si...    80   4e-19
KAFR0G02740 Chr7 (568777..569364) [588 bp, 195 aa] {ON}                78   2e-18
Smik_9.183 Chr9 (308426..309133) [708 bp, 235 aa] {ON} YIL011W (...    79   2e-18
TPHA0L00795 Chr12 complement(152381..153019) [639 bp, 212 aa] {ON}     78   3e-18
YIL011W Chr9 (333727..334536) [810 bp, 269 aa] {ON}  TIR3Cell wa...    79   4e-18
TPHA0I02160 Chr9 (479620..480291) [672 bp, 223 aa] {ON}                77   5e-18
TPHA0I02190 Chr9 complement(487838..488509) [672 bp, 223 aa] {ON}      77   5e-18
NDAI0G03460 Chr7 complement(827471..827833) [363 bp, 120 aa] {ON}      75   8e-18
KNAG0G01030 Chr7 complement(218285..218989) [705 bp, 234 aa] {ON}      75   3e-17
NDAI0A07480 Chr1 complement(1710323..1710955) [633 bp, 210 aa] {...    75   4e-17
NDAI0F02120 Chr6 complement(517338..517517) [180 bp, 59 aa] {ON}       69   2e-16
CAGL0L07502g Chr12 complement(828380..829066) [687 bp, 228 aa] {...    72   4e-16
TBLA0A01140 Chr1 (260819..261526) [708 bp, 235 aa] {ON}                72   7e-16
KAFR0G02820 Chr7 (589469..590839) [1371 bp, 456 aa] {ON} Anc_7.1...    74   7e-16
YBR067C Chr2 complement(372103..372735) [633 bp, 210 aa] {ON}  T...    71   9e-16
CAGL0C03872g Chr3 complement(379501..380268) [768 bp, 255 aa] {O...    72   1e-15
Skud_9.161 Chr9 (303651..304131,304162..304472) [792 bp, 263 aa]...    72   2e-15
Smik_2.200 Chr2 complement(353976..354085,354146..354668) [633 b...    70   2e-15
TPHA0I02210 Chr9 complement(491382..492128) [747 bp, 248 aa] {ON}      69   9e-15
NCAS0I01540 Chr9 (289458..290102) [645 bp, 214 aa] {ON}                69   1e-14
Suva_4.306 Chr4 complement(539034..539627) [594 bp, 197 aa] {ON}...    68   2e-14
Skud_2.190 Chr2 complement(340506..340648,340700..341186) [630 b...    68   2e-14
Suva_9.193 Chr9 (322160..323005) [846 bp, 281 aa] {ON} YIL011W (...    69   2e-14
TPHA0L00800 Chr12 (155102..155965) [864 bp, 287 aa] {ON}               69   3e-14
KAFR0I02140 Chr9 complement(439942..440304) [363 bp, 120 aa] {ON}      64   2e-13
TPHA0I02140 Chr9 (475414..476148) [735 bp, 244 aa] {ON} Anc_7.16...    65   3e-13
TBLA0G00500 Chr7 (103205..104020) [816 bp, 271 aa] {ON}                65   3e-13
KAFR0G02810 Chr7 (587244..588293) [1050 bp, 349 aa] {ON}               65   4e-13
TBLA0J01810 Chr10 (411692..412963) [1272 bp, 423 aa] {ON} Anc_7....    65   8e-13
NCAS0F00800 Chr6 (163727..164470) [744 bp, 247 aa] {ON}                64   1e-12
Ecym_1223 Chr1 (464202..464747) [546 bp, 181 aa] {ON} similar to...    62   2e-12
Ecym_4465 Chr4 (946303..947031) [729 bp, 242 aa] {ON} similar to...    63   2e-12
Smik_5.127 Chr5 (179561..179761) [201 bp, 67 aa] {ON} YOR009W (R...    59   3e-12
TBLA0A01110 Chr1 (255570..256301) [732 bp, 243 aa] {ON}                62   4e-12
TBLA0J01865 Chr10 (437434..438153) [720 bp, 239 aa] {ON}               62   5e-12
NDAI0H01290 Chr8 (314469..315248) [780 bp, 259 aa] {ON}                62   5e-12
Suva_5.100 Chr5 (150965..151165) [201 bp, 67 aa] {ON} YER011W (R...    57   1e-11
KAFR0K01210 Chr11 complement(248291..249019) [729 bp, 242 aa] {O...    60   1e-11
KAFR0K01220 Chr11 complement(250023..250781) [759 bp, 252 aa] {O...    58   1e-10
NDAI0E03650 Chr5 (788320..789501) [1182 bp, 393 aa] {ON}               57   3e-10
TBLA0J01790 Chr10 complement(402292..402960) [669 bp, 222 aa] {O...    57   4e-10
NDAI0H01300 Chr8 (317052..317753) [702 bp, 233 aa] {ON}                57   4e-10
TPHA0C05010 Chr3 complement(1081648..1082256) [609 bp, 202 aa] {...    55   2e-09
KNAG0J00780 Chr10 (134070..134699) [630 bp, 209 aa] {ON}  YBR067C      52   2e-08
TBLA0J01845 Chr10 complement(424079..424891) [813 bp, 270 aa] {ON}     51   5e-08
TBLA0J01800 Chr10 complement(408277..408969) [693 bp, 230 aa] {O...    50   6e-08
NCAS0E02110 Chr5 (403722..405935) [2214 bp, 737 aa] {ON} Anc_7.161     50   1e-07
TBLA0A01120 Chr1 (257989..258630) [642 bp, 213 aa] {ON} Anc_7.16...    49   2e-07
Suva_5.21 Chr5 (39195..39569) [375 bp, 124 aa] {ON} YEL049W (REAL)     47   3e-07
NCAS0B00460 Chr2 (65100..66020) [921 bp, 306 aa] {ON}                  47   2e-06
NCAS0E02100 Chr5 complement(401247..401921) [675 bp, 224 aa] {ON...    46   3e-06
NDAI0A08910 Chr1 (2052786..2054264) [1479 bp, 492 aa] {ON}             46   4e-06
NCAS0B00470 Chr2 (67250..67696) [447 bp, 148 aa] {ON}                  45   4e-06
Skud_10.376 Chr10 complement(666881..667774) [894 bp, 297 aa] {O...    46   4e-06
Suva_10.48 Chr10 (99563..99934) [372 bp, 123 aa] {ON} YEL049W (R...    44   4e-06
YFL020C Chr6 complement(99231..99599) [369 bp, 122 aa] {ON}  PAU...    44   7e-06
Skud_5.41 Chr5 (61810..62172) [363 bp, 120 aa] {ON} YIR041W (REAL)     44   8e-06
Smik_10.445 Chr10 complement(698010..698888) [879 bp, 292 aa] {O...    45   9e-06
YEL049W Chr5 (63728..64090) [363 bp, 120 aa] {ON}  PAU2Member of...    43   1e-05
TBLA0H00500 Chr8 complement(96289..98253) [1965 bp, 654 aa] {ON}       45   1e-05
Suva_12.247 Chr12 complement(397418..397551,398161..398323,39839...    44   1e-05
Smik_3.7 Chr3 complement(7472..7834) [363 bp, 120 aa] {ON} YGL26...    43   1e-05
YJR150C Chr10 complement(708811..709707) [897 bp, 298 aa] {ON}  ...    44   1e-05
Skud_1.71 Chr1 (139279..139641) [363 bp, 120 aa] {ON} YGR294W (R...    43   1e-05
Skud_6.51 Chr6 complement(101902..102264) [363 bp, 120 aa] {ON} ...    43   1e-05
TPHA0I02200 Chr9 (490236..491036) [801 bp, 266 aa] {ON}                44   2e-05
Smik_1.80 Chr1 complement(154201..154563) [363 bp, 120 aa] {ON} ...    42   2e-05
YJL223C Chr10 complement(8776..9138) [363 bp, 120 aa] {ON}  PAU1...    42   2e-05
YIL176C Chr9 complement(8793..9155) [363 bp, 120 aa] {ON}  PAU14...    42   2e-05
YDR542W Chr4 (1523249..1523611) [363 bp, 120 aa] {ON}  PAU10Prot...    42   2e-05
YGR294W Chr7 (1080306..1080668) [363 bp, 120 aa] {ON}  PAU12Prot...    42   2e-05
YAL068C Chr1 complement(1807..2169) [363 bp, 120 aa] {ON}  PAU8P...    42   2e-05
YGL261C Chr7 complement(6290..6652) [363 bp, 120 aa] {ON}  PAU11...    42   2e-05
YBR301W Chr2 (809057..809419) [363 bp, 120 aa] {ON}  PAU24Cell w...    42   2e-05
YHL046C Chr8 complement(11923..12285) [363 bp, 120 aa] {ON}  PAU...    42   2e-05
Suva_12.248 Chr12 complement(401059..401499) [441 bp, 146 aa] {O...    42   3e-05
Smik_12.39 Chr12 (80692..81066) [375 bp, 124 aa] {ON} YLL025W (R...    42   3e-05
YLR037C Chr12 complement(222685..223059) [375 bp, 124 aa] {ON}  ...    42   4e-05
YLL025W Chr12 (94747..95121) [375 bp, 124 aa] {ON}  PAU17Protein...    42   4e-05
Suva_5.106 Chr5 complement(162509..162883) [375 bp, 124 aa] {ON}...    42   4e-05
Suva_7.585 Chr7 (1022458..1022832) [375 bp, 124 aa] {ON} YFL020C...    42   5e-05
Suva_14.413 Chr14 (711723..712088) [366 bp, 121 aa] {ON} YAL068C...    41   5e-05
KNAG0B06950 Chr2 (1382599..1384200) [1602 bp, 533 aa] {ON}             43   5e-05
Smik_16.460 Chr16 (792614..792988) [375 bp, 124 aa] {ON} YFL020C...    41   6e-05
YLR461W Chr12 (1062919..1063281) [363 bp, 120 aa] {ON}  PAU4Memb...    41   6e-05
Smik_5.10 Chr5 complement(11236..11610) [375 bp, 124 aa] {ON} YF...    41   6e-05
Smik_5.360 Chr5 (558125..558499) [375 bp, 124 aa] {ON} YIL176C (...    41   6e-05
Skud_5.2 Chr5 (3597..3971) [375 bp, 124 aa] {ON} YHL046C (REAL)        41   7e-05
Skud_12.556 Chr12 (996687..997061) [375 bp, 124 aa] {ON} YPL282C...    41   7e-05
Skud_3.170 Chr3 (274863..275237) [375 bp, 124 aa] {ON} YFL020C (...    41   7e-05
Skud_3.174 Chr3 (286829..287191) [363 bp, 120 aa] {ON} YIR041W (...    41   8e-05
Skud_14.3 Chr14 complement(4247..4609) [363 bp, 120 aa] {ON} YOR...    41   8e-05
Suva_6.39 Chr6 complement(72184..72549) [366 bp, 121 aa] {ON} YF...    41   8e-05
Suva_12.243 Chr12 complement(387278..388099) [822 bp, 273 aa] {O...    42   8e-05
Suva_7.36 Chr7 (70912..71283) [372 bp, 123 aa] {ON} YFL020C (REAL)     41   9e-05
YOL161C Chr15 complement(11549..11911) [363 bp, 120 aa] {ON}  PA...    40   9e-05
Skud_12.104 Chr12 complement(207545..207919) [375 bp, 124 aa] {O...    40   1e-04
Smik_2.6 Chr2 complement(7672..8046) [375 bp, 124 aa] {ON} YFL02...    40   1e-04
Smik_14.411 Chr14 (729137..729511) [375 bp, 124 aa] {ON} YFL020C...    40   1e-04
Suva_1.96 Chr1 complement(159596..159961) [366 bp, 121 aa] {ON} ...    40   2e-04
Suva_1.88 Chr1 complement(156025..156390) [366 bp, 121 aa] {ON} ...    40   2e-04
YNR076W Chr14 (781918..782280) [363 bp, 120 aa] {ON}  PAU6Member...    40   2e-04
YLL064C Chr12 complement(13083..13445) [363 bp, 120 aa] {ON}  PA...    40   2e-04
Smik_5.44 Chr5 (65812..66174) [363 bp, 120 aa] {ON} YNR076W (REAL)     40   2e-04
Smik_17.5 Chr17 complement(4181..4543) [363 bp, 120 aa] {ON} YNR...    40   2e-04
Smik_19.2 Chr19 complement(865..1227) [363 bp, 120 aa] {ON} YNR0...    40   2e-04
Smik_10.12 Chr10 (22480..23244) [765 bp, 255 aa] {ON} YJR151C (R...    40   2e-04
ADR019C Chr4 complement(739205..739837) [633 bp, 210 aa] {ON} Sy...    40   3e-04
YCR104W Chr3 (307801..308175) [375 bp, 124 aa] {ON}  PAU3Member ...    39   3e-04
YMR325W Chr13 (922641..923015) [375 bp, 124 aa] {ON}  PAU19Prote...    39   3e-04
YKL224C Chr11 complement(1810..2181) [372 bp, 123 aa] {ON}  PAU1...    39   3e-04
YPL282C Chr16 complement(7933..8427) [495 bp, 164 aa] {ON}  PAU2...    40   3e-04
YOR394W Chr15 (1082718..1083212) [495 bp, 164 aa] {ON}  PAU21Pro...    40   3e-04
YIR041W Chr9 (433929..434303) [375 bp, 124 aa] {ON}  PAU15Protei...    39   4e-04
TPHA0I02150 Chr9 complement(476635..477951) [1317 bp, 438 aa] {O...    40   5e-04
Skud_10.379 Chr10 complement(672005..673015) [1011 bp, 337 aa] {...    39   7e-04
Smik_12.560 Chr12 (989728..989910) [183 bp, 61 aa] {ON} YJL223C ...    37   7e-04
NDAI0A07890 Chr1 complement(1811865..1813862) [1998 bp, 665 aa] ...    39   8e-04
Skud_7.45 Chr7 (81233..81607) [375 bp, 124 aa] {ON} YFL020C (REAL)     38   0.001
TBLA0J01850 Chr10 (427405..428802) [1398 bp, 465 aa] {ON}              39   0.001
KNAG0B06980 Chr2 (1389595..1391592) [1998 bp, 665 aa] {ON}             38   0.003
KAFR0B07040 Chr2 complement(1464938..1465750) [813 bp, 270 aa] {...    37   0.004
KNAG0E01130 Chr5 complement(220233..220631) [399 bp, 132 aa] {ON}      35   0.009
Skud_74.1 Chr74 (3..218) [216 bp, 71 aa] {OFF} YPL282C (HSP)           34   0.012
Skud_12.43 Chr12 (86079..86291) [213 bp, 70 aa] {ON} YLL025W (REAL)    34   0.013
YJR151C Chr10 complement(712255..715740) [3486 bp, 1161 aa] {ON}...    36   0.014
KNAG0M00110 Chr13 complement(11044..11826) [783 bp, 260 aa] {ON}       32   0.16 
NCAS0B00350 Chr2 complement(43786..45075) [1290 bp, 429 aa] {ON}       32   0.28 
KNAG0I02500 Chr9 complement(483170..486460) [3291 bp, 1096 aa] {...    29   2.2  
KNAG0I02620 Chr9 (505371..508961) [3591 bp, 1196 aa] {ON}              29   2.4  
NCAS0A00140 Chr1 complement(7200..10586) [3387 bp, 1128 aa] {ON}       28   5.5  
Kwal_33.14475 s33 (689067..689564) [498 bp, 165 aa] {OFF} [conti...    27   9.5  

>NDAI0J01370 Chr10 (316516..316872) [357 bp, 118 aa] {ON} 
          Length = 118

 Score =  194 bits (494), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 101/118 (85%), Positives = 101/118 (85%)

Query: 1   MNTKFTXXXXXXXXXXXXXXXXXNTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLD 60
           MNTKFT                 NTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLD
Sbjct: 1   MNTKFTVLLAAIASASVASAAVANTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLD 60

Query: 61  TLPAGVLDVGKALFTASDDSYTTLYANVDFDGVSSLMTKLPWYQSRLEAPLQSIANSN 118
           TLPAGVLDVGKALFTASDDSYTTLYANVDFDGVSSLMTKLPWYQSRLEAPLQSIANSN
Sbjct: 61  TLPAGVLDVGKALFTASDDSYTTLYANVDFDGVSSLMTKLPWYQSRLEAPLQSIANSN 118

>NDAI0A08350 Chr1 (1919746..1920534) [789 bp, 262 aa] {ON} 
          Length = 262

 Score =  127 bits (319), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 60/91 (65%), Positives = 73/91 (80%)

Query: 24  NTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTT 83
            T T++AEL +LL+DV SNLNDY+ LA TP SG+SL  +PAGVLD+G AL +A+D SYTT
Sbjct: 36  QTETQVAELNLLLNDVGSNLNDYMTLATTPGSGISLADMPAGVLDIGMALASATDKSYTT 95

Query: 84  LYANVDFDGVSSLMTKLPWYQSRLEAPLQSI 114
           LY+ VDF GV S++TKLPWY SRLE PL SI
Sbjct: 96  LYSEVDFAGVESMITKLPWYSSRLEGPLNSI 126

>NDAI0G04990 Chr7 (1211201..1211569) [369 bp, 122 aa] {ON} 
          Length = 122

 Score =  122 bits (307), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 71/86 (82%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           E+ EL VLL+DVKSNLN+Y++LAFTP SGVSL  LPAGVLDVG A+  A+DDSYTTLY+ 
Sbjct: 31  EVTELNVLLNDVKSNLNEYISLAFTPGSGVSLFNLPAGVLDVGLAIAGATDDSYTTLYSK 90

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPLQS 113
           VDF GV  ++TKLPWY SR+E  ++S
Sbjct: 91  VDFAGVDKMITKLPWYSSRIEPAIES 116

>NCAS0I00660 Chr9 complement(108938..109696) [759 bp, 252 aa] {ON} 
          Length = 252

 Score =  118 bits (296), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 74/91 (81%)

Query: 24  NTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTT 83
            T+T++AEL VLL DV SNL DY++LA TP +G SL+ +P+GVL +G AL TA+DDSYT+
Sbjct: 18  QTSTQVAELSVLLQDVSSNLADYMSLATTPGTGFSLEDMPSGVLSIGMALATATDDSYTS 77

Query: 84  LYANVDFDGVSSLMTKLPWYQSRLEAPLQSI 114
           +Y+ VDF G+SS++T+LPWY SRL++ + SI
Sbjct: 78  MYSEVDFAGISSMLTELPWYTSRLKSQIDSI 108

>NDAI0A03890 Chr1 (875388..876137) [750 bp, 249 aa] {ON} 
          Length = 249

 Score =  118 bits (295), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 56/89 (62%), Positives = 70/89 (78%)

Query: 25  TTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTL 84
           T TEI EL VLL+DV S+L DY+ LA  PDSG++L  +PAG+LDVG AL +A+DDSYTTL
Sbjct: 21  TPTEITELNVLLNDVGSHLEDYMNLATNPDSGITLQNMPAGMLDVGMALASATDDSYTTL 80

Query: 85  YANVDFDGVSSLMTKLPWYQSRLEAPLQS 113
           Y+ VDF GV S++T+LPWY SRL   L+S
Sbjct: 81  YSEVDFAGVQSMITELPWYSSRLRPALES 109

>NDAI0J02580 Chr10 (641847..642209) [363 bp, 120 aa] {ON} 
          Length = 120

 Score =  113 bits (282), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 67/87 (77%)

Query: 27  TEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYA 86
           TEIAEL VL++DV S+L DY+ LA TP S  SL  +PAG+LD+G AL TA+D SYTTLY+
Sbjct: 27  TEIAELNVLMNDVSSHLTDYMVLALTPGSSFSLTDMPAGILDIGLALATATDKSYTTLYS 86

Query: 87  NVDFDGVSSLMTKLPWYQSRLEAPLQS 113
            VDF GV S++TKLPWY +RLE  + S
Sbjct: 87  EVDFAGVQSMITKLPWYSTRLEPEIIS 113

>KAFR0K01040 Chr11 complement(214416..215129) [714 bp, 237 aa] {ON}
           Anc_7.161 YER011W
          Length = 237

 Score =  114 bits (285), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 57/84 (67%), Positives = 67/84 (79%), Gaps = 1/84 (1%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           EIAEL  +L DV SNLNDY+AL+    SG+SL  LPAGVLD+G AL +A+D SYTTLY+ 
Sbjct: 22  EIAELNAILSDVGSNLNDYIALSTDSSSGISLTNLPAGVLDIGLALASATDSSYTTLYSE 81

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPL 111
           VDF GVSSL+TKLPWY SR+ APL
Sbjct: 82  VDFAGVSSLLTKLPWYSSRI-APL 104

>Skud_5.111 Chr5 (172527..173171) [645 bp, 214 aa] {ON} YER011W
           (REAL)
          Length = 214

 Score =  111 bits (278), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 49/91 (53%), Positives = 69/91 (75%)

Query: 24  NTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTT 83
            T  +I EL V+L+DVKSN+  Y++LA  P SG +L  +PAGVLD+G  L +A+DDSYTT
Sbjct: 19  QTQDQINELNVILNDVKSNMQQYISLASDPSSGFTLQNMPAGVLDIGMVLVSATDDSYTT 78

Query: 84  LYANVDFDGVSSLMTKLPWYQSRLEAPLQSI 114
           +++ VDF GVS ++T++PWY SRLE  L+S+
Sbjct: 79  MFSEVDFAGVSKMLTQVPWYSSRLEPALKSL 109

>Skud_5.112 Chr5 (172527..173141,173173..173310) [753 bp, 250 aa]
           {ON} YER011W (REAL)
          Length = 250

 Score =  111 bits (278), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 49/91 (53%), Positives = 69/91 (75%)

Query: 24  NTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTT 83
            T  +I EL V+L+DVKSN+  Y++LA  P SG +L  +PAGVLD+G  L +A+DDSYTT
Sbjct: 19  QTQDQINELNVILNDVKSNMQQYISLASDPSSGFTLQNMPAGVLDIGMVLVSATDDSYTT 78

Query: 84  LYANVDFDGVSSLMTKLPWYQSRLEAPLQSI 114
           +++ VDF GVS ++T++PWY SRLE  L+S+
Sbjct: 79  MFSEVDFAGVSKMLTQVPWYSSRLEPALKSL 109

>Smik_5.126 Chr5 (179561..180286) [726 bp, 241 aa] {ON} YER011W
           (REAL)
          Length = 241

 Score =  110 bits (276), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 50/91 (54%), Positives = 71/91 (78%)

Query: 24  NTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTT 83
            T  +I EL V+L+DVKSN+ +Y++LA  P+SG SL ++PAG+LD+G AL +A+DDSYTT
Sbjct: 19  QTQDQINELNVILNDVKSNIQEYISLASDPNSGFSLASMPAGILDLGMALASATDDSYTT 78

Query: 84  LYANVDFDGVSSLMTKLPWYQSRLEAPLQSI 114
            Y+ VDF GVS ++T++PWY SRL   L+S+
Sbjct: 79  FYSEVDFAGVSKMLTQVPWYSSRLAPALKSL 109

>Skud_15.171 Chr15 (305234..306541) [1308 bp, 435 aa] {ON} YOR009W
           (REAL)
          Length = 435

 Score =  112 bits (279), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 67/87 (77%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           +I EL V LDDVKSN+ DY+ L+FTP+SG SLD +PAG++D+   L TA+DDSYTTLY+ 
Sbjct: 23  QINELNVALDDVKSNIADYINLSFTPNSGFSLDLMPAGIMDIAAELVTATDDSYTTLYSE 82

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPLQSI 114
           VDF  V +++T +PWY SRL   L+++
Sbjct: 83  VDFAAVEAMLTMVPWYSSRLLPQLEAL 109

>Suva_5.99 Chr5 (150965..151738) [774 bp, 257 aa] {ON} YER011W
           (REAL)
          Length = 257

 Score =  108 bits (270), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 70/91 (76%)

Query: 24  NTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTT 83
            T  EI EL V+L+DVKS+L +Y++LA  P SG SL  +PAGVL++G AL +A+D+SYTT
Sbjct: 19  QTQEEIDELNVILNDVKSHLQEYMSLAQDPSSGFSLANMPAGVLNIGMALASATDNSYTT 78

Query: 84  LYANVDFDGVSSLMTKLPWYQSRLEAPLQSI 114
           LY+ VDF GV+ ++T +PWY SRLE  L+S+
Sbjct: 79  LYSAVDFAGVNKMLTMVPWYSSRLEPALKSM 109

>NDAI0I03040 Chr9 (721361..721726) [366 bp, 121 aa] {ON} 
          Length = 121

 Score =  104 bits (259), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%)

Query: 25  TTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTL 84
           +T+++ EL +LL+DV SNL DY+ LA TP S  S D +PAG++D+G AL  A+DDSYT+L
Sbjct: 26  STSDLMELNILLNDVSSNLKDYLTLAITPGSVFSKDNMPAGLIDLGVALANATDDSYTSL 85

Query: 85  YANVDFDGVSSLMTKLPWYQSRLE 108
           Y NVDF  V +L+TKLPWY SR+E
Sbjct: 86  YKNVDFKAVDTLVTKLPWYSSRIE 109

>CAGL0H09592g Chr8 (937859..938569) [711 bp, 236 aa] {ON} highly
           similar to uniprot|P10863 Saccharomyces cerevisiae
           YER011w TIR1 or uniprot|P33890 Saccharomyces cerevisiae
           YOR010c TIR2
          Length = 236

 Score =  104 bits (259), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 48/88 (54%), Positives = 65/88 (73%)

Query: 24  NTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTT 83
            T  ++ EL V+LDDVKSNL+ Y++L   P SG++L  LPAGVL++G AL +A+DDSYTT
Sbjct: 20  QTPQQLDELNVILDDVKSNLSSYMSLVQDPSSGITLANLPAGVLNLGMALASATDDSYTT 79

Query: 84  LYANVDFDGVSSLMTKLPWYQSRLEAPL 111
           LY ++DFDG+   ++KLPWY  RL   L
Sbjct: 80  LYKDIDFDGIVPFLSKLPWYSERLAGKL 107

>KNAG0L00870 Chr12 (163016..163708) [693 bp, 230 aa] {ON} Anc_7.161
           YER011W
          Length = 230

 Score =  103 bits (258), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 44/87 (50%), Positives = 65/87 (74%)

Query: 27  TEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYA 86
           T+IA+L V+L+DVK NLN+Y+ L   P SG+++  +P G+  +G AL TA+D SYT++Y 
Sbjct: 21  TQIAQLNVVLNDVKGNLNEYMNLLKDPSSGITMANMPNGIFQLGAALATATDKSYTSMYG 80

Query: 87  NVDFDGVSSLMTKLPWYQSRLEAPLQS 113
           ++DF G+S+ M KLPWY SRLE  L++
Sbjct: 81  DIDFAGISAFMPKLPWYSSRLEPALEA 107

>CAGL0H09614g Chr8 complement(939286..939996) [711 bp, 236 aa] {ON}
           highly similar to uniprot|P10863 Saccharomyces
           cerevisiae YER011w TIR1 or uniprot|P33890 Saccharomyces
           cerevisiae YOR010c TIR2
          Length = 236

 Score =  103 bits (258), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 48/88 (54%), Positives = 65/88 (73%)

Query: 24  NTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTT 83
            T  ++ EL V+LDDVKSNL+ Y++L   P SG++L  LPAGVL++G AL +A+DDSYTT
Sbjct: 20  QTPQQLDELNVILDDVKSNLSSYMSLVQDPSSGITLANLPAGVLNLGMALASATDDSYTT 79

Query: 84  LYANVDFDGVSSLMTKLPWYQSRLEAPL 111
           LY ++DFDG+   ++KLPWY  RL   L
Sbjct: 80  LYKDIDFDGIVPFLSKLPWYSERLAGKL 107

>Suva_15.186 Chr15 (318697..319620,319660..319847,319953..320286)
           [1446 bp, 481 aa] {ON} YOR010C (REAL)
          Length = 481

 Score =  107 bits (267), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 66/87 (75%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           EI EL V+L DVKSN+ DY+ L+  P SG SL  +PAGVLD+G  L +A+DDSYTTLY+N
Sbjct: 23  EIDELNVVLADVKSNIGDYILLSQDPTSGFSLADMPAGVLDIGFELASATDDSYTTLYSN 82

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPLQSI 114
           VDF  V++ +T LPWY SRLE  ++++
Sbjct: 83  VDFAAVATFLTMLPWYSSRLEPEIEAL 109

>YER011W Chr5 (175248..176012) [765 bp, 254 aa] {ON}  TIR1Cell wall
           mannoprotein of the Srp1p/Tip1p family of
           serine-alanine-rich proteins; expression is
           downregulated at acidic pH and induced by cold shock and
           anaerobiosis; abundance is increased in cells cultured
           without shaking
          Length = 254

 Score =  102 bits (254), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (76%)

Query: 24  NTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTT 83
            T  +I EL V+L+DVKS+L +Y++LA    SG SL ++PAGVLD+G AL +A+DDSYTT
Sbjct: 19  QTQDQINELNVILNDVKSHLQEYISLASDSSSGFSLSSMPAGVLDIGMALASATDDSYTT 78

Query: 84  LYANVDFDGVSSLMTKLPWYQSRLEAPLQSI 114
           LY+ VDF GVS ++T +PWY SRLE  L+S+
Sbjct: 79  LYSEVDFAGVSKMLTMVPWYSSRLEPALKSL 109

>YOR009W Chr15 (344335..345798) [1464 bp, 487 aa] {ON}  TIR4Cell
           wall mannoprotein of the Srp1p/Tip1p family of
           serine-alanine-rich proteins; expressed under anaerobic
           conditions and required for anaerobic growth;
           transcription is also induced by cold shock
          Length = 487

 Score =  103 bits (258), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 66/92 (71%), Gaps = 1/92 (1%)

Query: 24  NTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFT-ASDDSYT 82
            T  +I EL V+LDDVK+N+ DY+ L++TP+SG SLD +PAG++D+   L    SDDSYT
Sbjct: 19  QTQAQINELNVVLDDVKTNIADYITLSYTPNSGFSLDQMPAGIMDIAAQLVANPSDDSYT 78

Query: 83  TLYANVDFDGVSSLMTKLPWYQSRLEAPLQSI 114
           TLY+ VDF  V  ++T +PWY SRL   L+++
Sbjct: 79  TLYSEVDFSAVEHMLTMVPWYSSRLLPELEAM 110

>Suva_15.187 Chr15
           complement(320743..320885,320925..321128,321573..321646,
           321683..322017) [756 bp, 251 aa] {ON} YOR010C (REAL)
          Length = 251

 Score = 99.8 bits (247), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 67/88 (76%)

Query: 25  TTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTL 84
           T  EI EL V+L+DVKSNL +Y++LA    SG SL +LPAGVLDVG AL TA+DDSYTTL
Sbjct: 20  TEEEIDELNVILNDVKSNLAEYISLAEDSSSGFSLSSLPAGVLDVGMALATATDDSYTTL 79

Query: 85  YANVDFDGVSSLMTKLPWYQSRLEAPLQ 112
           Y+ +DF  +SS +T LPWY SRLE  ++
Sbjct: 80  YSEIDFSAISSFLTMLPWYSSRLEPEIE 107

>Smik_15.184 Chr15 complement(313478..314323) [846 bp, 281 aa] {ON}
           YOR010C (REAL)
          Length = 281

 Score = 98.2 bits (243), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 70/91 (76%)

Query: 24  NTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTT 83
            T  EI EL V+L+DVKSNL +Y++LA    SG SL +LP+GVLD+G AL +A+DDSYTT
Sbjct: 19  QTQEEIDELNVILNDVKSNLQEYISLASDSSSGFSLSSLPSGVLDIGLALASATDDSYTT 78

Query: 84  LYANVDFDGVSSLMTKLPWYQSRLEAPLQSI 114
           LY+ VDF  VS ++T++PWY SRLE  L+S+
Sbjct: 79  LYSEVDFAAVSKMLTQVPWYSSRLEPALKSL 109

>Smik_15.183 Chr15 (311669..313078) [1410 bp, 469 aa] {ON} YOR009W
           (REAL)
          Length = 469

 Score = 99.8 bits (247), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 61/85 (71%), Gaps = 1/85 (1%)

Query: 24  NTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFT-ASDDSYT 82
            T  +I EL V L+DVKSN+ DY+ L+ TP+SG SLD +PAG++D+   L    +DDSYT
Sbjct: 19  QTQKQINELNVALNDVKSNIADYIQLSQTPNSGFSLDKMPAGIMDIAAQLVQDPTDDSYT 78

Query: 83  TLYANVDFDGVSSLMTKLPWYQSRL 107
           TLY+ VDF  V S++T +PWY SRL
Sbjct: 79  TLYSEVDFAAVESMLTMVPWYSSRL 103

>Skud_15.172 Chr15 complement(306986..307714) [729 bp, 242 aa] {ON}
           YOR010C (REAL)
          Length = 242

 Score = 96.3 bits (238), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 69/91 (75%)

Query: 24  NTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTT 83
            T  EI EL V+L+DVKSNL +Y++LA    SG SL +LP+GVLD+G A+ +A+DDSYTT
Sbjct: 19  QTQEEIDELNVILNDVKSNLQEYISLASDSSSGFSLSSLPSGVLDIGMAIASATDDSYTT 78

Query: 84  LYANVDFDGVSSLMTKLPWYQSRLEAPLQSI 114
           LY+ VDF  VS ++T +PWY SRLE  L+S+
Sbjct: 79  LYSEVDFAAVSKMLTMVPWYSSRLEPALESL 109

>NCAS0I00690 Chr9 complement(119082..119639) [558 bp, 185 aa] {ON}
           YOR010C
          Length = 185

 Score = 94.0 bits (232), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 57/75 (76%)

Query: 42  NLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVDFDGVSSLMTKLP 101
           NL DY++LA TP +G +LD +PAGVL +G AL  A+D SYT++Y+ VD  GVSS++T+LP
Sbjct: 5   NLGDYMSLATTPGTGFTLDDMPAGVLSIGMALAGATDHSYTSMYSEVDMAGVSSMLTQLP 64

Query: 102 WYQSRLEAPLQSIAN 116
           WY SRL+A + SI  
Sbjct: 65  WYSSRLKAQIDSIVG 79

>CAGL0F01463g Chr6 (149905..150570) [666 bp, 221 aa] {ON} similar to
           uniprot|P10863 Saccharomyces cerevisiae YER011w TIR1 or
           uniprot|P33890 Saccharomyces cerevisiae YOR010c TIR2
          Length = 221

 Score = 94.7 bits (234), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 59/81 (72%)

Query: 27  TEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYA 86
           T++AEL  +L D  S+L+DY  L   P+SG++   LPAGVL +G A+ TA+D SYT+LY 
Sbjct: 23  TQLAELNAILQDFSSHLSDYTGLLANPNSGITAADLPAGVLQLGLAIQTATDKSYTSLYP 82

Query: 87  NVDFDGVSSLMTKLPWYQSRL 107
           +VDF G+ +L+ KLPWY SRL
Sbjct: 83  SVDFKGIEALLPKLPWYSSRL 103

>CAGL0F01485g Chr6 complement(151321..152334) [1014 bp, 337 aa] {ON}
           similar to uniprot|Q12218 Saccharomyces cerevisiae
           YOR009w or uniprot|P10863 Saccharomyces cerevisiae
           YER011w TIR1
          Length = 337

 Score = 96.3 bits (238), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 41/84 (48%), Positives = 65/84 (77%)

Query: 25  TTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTL 84
           T  ++AEL  +++D+K+NL DY+ LA  P+SG SL  +P+G++ +G A+ TA+DDSYT++
Sbjct: 22  TPMQLAELNAVMEDLKTNLQDYMNLAMDPNSGFSLADMPSGLIQLGMAVGTATDDSYTSM 81

Query: 85  YANVDFDGVSSLMTKLPWYQSRLE 108
           Y++VDF GV  ++T +PWY SRL+
Sbjct: 82  YSDVDFAGVDKMVTMVPWYSSRLK 105

>KNAG0L00920 Chr12 (168872..169639) [768 bp, 255 aa] {ON} 
          Length = 255

 Score = 94.4 bits (233), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 47/113 (41%), Positives = 72/113 (63%), Gaps = 5/113 (4%)

Query: 1   MNTKFTXXXXXXXXXXXXXXXXXNTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLD 60
           MNTK+T                  T  EI +L V+L+DV+ NL++Y+AL   P SG S+ 
Sbjct: 1   MNTKYTALLVSLAAVASA-----QTQEEITQLNVILNDVRDNLSEYMALLNDPSSGFSVA 55

Query: 61  TLPAGVLDVGKALFTASDDSYTTLYANVDFDGVSSLMTKLPWYQSRLEAPLQS 113
           ++P GVL +G AL TA++ ++T++Y++VDF G+SS + +LP Y SRLE  L++
Sbjct: 56  SMPQGVLQIGGALATATNSAFTSMYSDVDFAGLSSFLPRLPRYSSRLEPALRA 108

>YOR010C Chr15 complement(346195..346950) [756 bp, 251 aa] {ON}
           TIR2Putative cell wall mannoprotein of the Srp1p/Tip1p
           family of serine-alanine-rich proteins; transcription is
           induced by cold shock and anaerobiosis
          Length = 251

 Score = 90.9 bits (224), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 68/91 (74%)

Query: 24  NTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTT 83
            T  EI EL V+L+DVKSNL +Y++LA    SG SL +LP+GVLD+G AL +A+DDSYTT
Sbjct: 19  QTQEEIDELNVILNDVKSNLQEYISLAEDSSSGFSLSSLPSGVLDIGLALASATDDSYTT 78

Query: 84  LYANVDFDGVSSLMTKLPWYQSRLEAPLQSI 114
           LY+ VDF  VS ++T +PWY SRL   L+S+
Sbjct: 79  LYSEVDFAAVSKMLTMVPWYSSRLLPELESL 109

>KAFR0G02805 Chr7 (584975..585595) [621 bp, 206 aa] {ON}
          Length = 206

 Score = 87.0 bits (214), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 65/91 (71%), Gaps = 2/91 (2%)

Query: 24  NTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTT 83
            T  EIAEL+ LLDD+ +NL+ Y+AL  + +  +S   LP+GVL++  A+ +A+D SYTT
Sbjct: 18  QTLYEIAELEALLDDLDNNLSSYIALYTSGE--ISFSDLPSGVLELAMAMMSATDSSYTT 75

Query: 84  LYANVDFDGVSSLMTKLPWYQSRLEAPLQSI 114
           L+A+VD+ GV S++T L WY SRL   ++SI
Sbjct: 76  LFADVDYAGVESMITILSWYSSRLLPEIESI 106

>SAKL0F04356g Chr6 (349995..350690) [696 bp, 231 aa] {ON} some
           similarities with uniprot|P40552 Saccharomyces
           cerevisiae YIL011W TIR3 Cell wall mannoprotein of the
           Srp1p/Tip1p family of serine-alanine-rich proteins
           expressed under anaerobic conditions and required for
           anaerobic growth
          Length = 231

 Score = 80.5 bits (197), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 66/92 (71%), Gaps = 6/92 (6%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFT-PDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYA 86
           ++ E+++LL DV ++L+DY++LA+  PD      ++P+GVL V + + T +DDSYT+L++
Sbjct: 20  DVQEIQLLLSDVSNHLSDYISLAYNNPD-----FSIPSGVLGVYEQMTTYTDDSYTSLFS 74

Query: 87  NVDFDGVSSLMTKLPWYQSRLEAPLQSIANSN 118
            +D   VS+++T LPWY SR+E  L S+A++ 
Sbjct: 75  QIDMTAVSTIVTALPWYSSRIEPALASLASTQ 106

>KAFR0G02740 Chr7 (568777..569364) [588 bp, 195 aa] {ON} 
          Length = 195

 Score = 77.8 bits (190), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 62/84 (73%), Gaps = 2/84 (2%)

Query: 31  ELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVDF 90
           E + L++D+ SN+++Y+AL  + +  +S+  LP+GVL++  A+ +A+D SYTTL A+VD+
Sbjct: 26  EAEALINDLGSNVSEYMALISSGE--LSMSDLPSGVLNLAMAIMSATDSSYTTLLADVDY 83

Query: 91  DGVSSLMTKLPWYQSRLEAPLQSI 114
            GV S++TKL WY SRL   ++SI
Sbjct: 84  AGVDSMITKLSWYSSRLLPEIESI 107

>Smik_9.183 Chr9 (308426..309133) [708 bp, 235 aa] {ON} YIL011W
           (REAL)
          Length = 235

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 57/86 (66%), Gaps = 4/86 (4%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           EI E   +L+DVK+NL  Y++LA+  D   SL   P GVLDV + + TA+DDSYT+ +  
Sbjct: 27  EIVEFNAILEDVKANLQQYMSLAYN-DPNFSL---PTGVLDVYQHMTTATDDSYTSYFTE 82

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPLQS 113
           +DF  +S+ M ++PWY SRLE  + S
Sbjct: 83  MDFAQISTAMFRVPWYSSRLEPEIIS 108

>TPHA0L00795 Chr12 complement(152381..153019) [639 bp, 212 aa] {ON}
          Length = 212

 Score = 77.8 bits (190), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 42/92 (45%), Positives = 56/92 (60%), Gaps = 8/92 (8%)

Query: 25  TTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTL 84
           T  +I E+++LL DV +NLNDYV L    D       +P  + D+   + TA+DDSYTTL
Sbjct: 21  TEQQIQEMEILLTDVGANLNDYVGLVGQMD-------IPDALFDIYGEMLTATDDSYTTL 73

Query: 85  YANVDFDGVSSLMTKLPWYQSRLEAPLQSIAN 116
            A +D   +S++MT LPWY SRL  PL S  N
Sbjct: 74  LAQLDMSQISTMMTALPWYSSRL-LPLVSTFN 104

>YIL011W Chr9 (333727..334536) [810 bp, 269 aa] {ON}  TIR3Cell wall
           mannoprotein of the Srp1p/Tip1p family of
           serine-alanine-rich proteins; expressed under anaerobic
           conditions and required for anaerobic growth
          Length = 269

 Score = 78.6 bits (192), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 59/91 (64%), Gaps = 10/91 (10%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFT-PDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYA 86
           EI E   +L DVK+NL  Y++LA   PD      TLP+GVLDV + + TA+DDSYT+ + 
Sbjct: 28  EIVEFDAILADVKANLEQYMSLAMNNPDF-----TLPSGVLDVYQHMTTATDDSYTSYFT 82

Query: 87  NVDFDGVSSLMTKLPWYQSRLE----APLQS 113
            +DF  +++ M ++PWY SRLE    A LQS
Sbjct: 83  EMDFAQITTAMVQVPWYSSRLEPEIIAALQS 113

>TPHA0I02160 Chr9 (479620..480291) [672 bp, 223 aa] {ON} 
          Length = 223

 Score = 77.4 bits (189), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 42/92 (45%), Positives = 56/92 (60%), Gaps = 8/92 (8%)

Query: 25  TTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTL 84
           T  +I E+++LL DV +NLNDYV L    D       +P  + D+   + TA+DDSYTTL
Sbjct: 23  TEQQIQEMEILLTDVGANLNDYVGLVGQMD-------IPDALFDIYGEMLTATDDSYTTL 75

Query: 85  YANVDFDGVSSLMTKLPWYQSRLEAPLQSIAN 116
            A +D   +S++MT LPWY SRL  PL S  N
Sbjct: 76  LAQLDMSQISTMMTALPWYSSRL-LPLVSTFN 106

>TPHA0I02190 Chr9 complement(487838..488509) [672 bp, 223 aa] {ON} 
          Length = 223

 Score = 77.4 bits (189), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 42/92 (45%), Positives = 56/92 (60%), Gaps = 8/92 (8%)

Query: 25  TTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTL 84
           T  +I E+++LL DV +NLNDYV L    D       +P  + D+   + TA+DDSYTTL
Sbjct: 23  TEQQIQEMEILLTDVGANLNDYVGLVGQMD-------IPDALFDIYGEMLTATDDSYTTL 75

Query: 85  YANVDFDGVSSLMTKLPWYQSRLEAPLQSIAN 116
            A +D   +S++MT LPWY SRL  PL S  N
Sbjct: 76  LAQLDMSQISTMMTALPWYSSRL-LPLVSTFN 106

>NDAI0G03460 Chr7 complement(827471..827833) [363 bp, 120 aa] {ON} 
          Length = 120

 Score = 74.7 bits (182), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 52/84 (61%)

Query: 25  TTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTL 84
           T   I EL V+ +D+K++LNDY+ L F P +G SL  +  G+LD+  AL   ++ + + +
Sbjct: 28  THPHIVELTVIFEDIKTHLNDYIPLCFLPGTGFSLFNIQKGILDITIALSILTESAISAV 87

Query: 85  YANVDFDGVSSLMTKLPWYQSRLE 108
             ++D+  + + + KLPWY  RLE
Sbjct: 88  CRDIDYALIHACIIKLPWYAHRLE 111

>KNAG0G01030 Chr7 complement(218285..218989) [705 bp, 234 aa] {ON} 
          Length = 234

 Score = 75.5 bits (184), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 58/87 (66%), Gaps = 7/87 (8%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFT-PDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYA 86
           E+AE   +L DVK+NL  Y++LA   PD      TLP GVLDV   L T +D+SYT+L+ 
Sbjct: 24  EVAEFNAILVDVKANLMQYISLAENNPDF-----TLPDGVLDVYTQLTTYTDESYTSLFT 78

Query: 87  NVDFDGVSSLMTKLPWYQSRLEAPLQS 113
            +DFD V+++M ++PWY SRL  P+ S
Sbjct: 79  AIDFDQVTTVMHQVPWYSSRL-IPIMS 104

>NDAI0A07480 Chr1 complement(1710323..1710955) [633 bp, 210 aa] {ON}
           
          Length = 210

 Score = 74.7 bits (182), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 55/80 (68%), Gaps = 4/80 (5%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           + AEL+ +++D+ SNL+DY+ L    ++G S  T+P  VL V + + T +DDSYT+L+  
Sbjct: 25  QTAELQAIIEDINSNLSDYLGL----ETGNSGFTIPPAVLRVYQQVMTYTDDSYTSLFTA 80

Query: 88  VDFDGVSSLMTKLPWYQSRL 107
           +DFD ++  +T LPWY SRL
Sbjct: 81  LDFDAITETITNLPWYSSRL 100

>NDAI0F02120 Chr6 complement(517338..517517) [180 bp, 59 aa] {ON} 
          Length = 59

 Score = 69.3 bits (168), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 30/52 (57%), Positives = 40/52 (76%)

Query: 62  LPAGVLDVGKALFTASDDSYTTLYANVDFDGVSSLMTKLPWYQSRLEAPLQS 113
           +PA +LD+G AL T +D+SY TLY+ VDF GV S++TKLPWY +RLE  + S
Sbjct: 1   MPATILDIGLALATVTDNSYATLYSEVDFTGVQSMITKLPWYSTRLEPEILS 52

>CAGL0L07502g Chr12 complement(828380..829066) [687 bp, 228 aa] {ON}
           similar to uniprot|P33890 Saccharomyces cerevisiae
           YOR010c TIR2 or uniprot|P27654 Saccharomyces cerevisiae
           YBR067c TIP1
          Length = 228

 Score = 72.4 bits (176), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 57/85 (67%), Gaps = 3/85 (3%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           E+AE++VL++D+ SNL  Y++L   PDSG  +   P  +L + + + T +DDS++TL + 
Sbjct: 23  EVAEIQVLVNDINSNLAQYLSLETNPDSGFQI---PDNLLSLYRNVATYTDDSFSTLLSG 79

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPLQ 112
           V+FD ++S +  LPWY SRL   L+
Sbjct: 80  VNFDEITSTIVGLPWYSSRLLPALE 104

>TBLA0A01140 Chr1 (260819..261526) [708 bp, 235 aa] {ON} 
          Length = 235

 Score = 72.0 bits (175), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 53/84 (63%), Gaps = 7/84 (8%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           +++E++++L DV  NL DYV L  + D       +P  + D+     TA+DDSYT L A 
Sbjct: 25  QVSEMQIILSDVNDNLQDYVGLVGSMD-------IPQALFDLYAIKATATDDSYTKLMAQ 77

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPL 111
           +D + +S+++T LPWY SRLEA +
Sbjct: 78  LDMNQISAMLTVLPWYSSRLEAKV 101

>KAFR0G02820 Chr7 (589469..590839) [1371 bp, 456 aa] {ON} Anc_7.161
           YER011W
          Length = 456

 Score = 73.6 bits (179), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/87 (45%), Positives = 53/87 (60%), Gaps = 3/87 (3%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           +IAE+  LL+DV+SNL+ Y  L     S + L  LP GVL    A   A+D SYTTL  +
Sbjct: 25  QIAEIDALLEDVESNLSSYTGLVI---SHMGLSWLPDGVLSYAMAAMEATDSSYTTLIDD 81

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPLQSI 114
           +DF GV  L+T + WY SRL   ++SI
Sbjct: 82  IDFSGVDRLITSVSWYSSRLLPLIESI 108

>YBR067C Chr2 complement(372103..372735) [633 bp, 210 aa] {ON}
           TIP1Major cell wall mannoprotein with possible lipase
           activity; transcription is induced by heat- and
           cold-shock; member of the Srp1p/Tip1p family of
           serine-alanine-rich proteins
          Length = 210

 Score = 71.2 bits (173), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 57/84 (67%), Gaps = 4/84 (4%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           E AEL+ ++ D+ S+L+DY+ L    ++G S   +P+ VL V + + T +DD+YTTL++ 
Sbjct: 25  ETAELQAIIGDINSHLSDYLGL----ETGNSGFQIPSDVLSVYQQVMTYTDDAYTTLFSE 80

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPL 111
           +DFD ++  + KLPWY +RL + +
Sbjct: 81  LDFDAITKTIVKLPWYTTRLSSEI 104

>CAGL0C03872g Chr3 complement(379501..380268) [768 bp, 255 aa] {ON}
           similar to uniprot|P40552 Saccharomyces cerevisiae
           YIL011w TIR3
          Length = 255

 Score = 71.6 bits (174), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/81 (46%), Positives = 53/81 (65%), Gaps = 6/81 (7%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFT-PDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYA 86
           EI+E  V+L DV  +L DY++ A   P+      TLP  VLD+  A+ TA+DDSYTT+Y 
Sbjct: 26  EISEFNVILSDVMGHLTDYISYAENDPNF-----TLPDHVLDLYMAMTTATDDSYTTMYD 80

Query: 87  NVDFDGVSSLMTKLPWYQSRL 107
            ++F  V+  MT+LPWY SR+
Sbjct: 81  QINFSQVTDAMTRLPWYSSRI 101

>Skud_9.161 Chr9 (303651..304131,304162..304472) [792 bp, 263 aa]
           {ON} YIL011W (REAL)
          Length = 263

 Score = 71.6 bits (174), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 54/81 (66%), Gaps = 6/81 (7%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAF-TPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYA 86
           E+ E   +L DVK+NL  Y++LA   P+      +LP+GVLDV + + TA+DDSYT+ + 
Sbjct: 27  EVVEFDAILADVKANLEQYMSLAMDNPNF-----SLPSGVLDVYQHMTTATDDSYTSYFT 81

Query: 87  NVDFDGVSSLMTKLPWYQSRL 107
            +DF  +++ M ++PWY SRL
Sbjct: 82  EMDFAQITTAMVQVPWYSSRL 102

>Smik_2.200 Chr2 complement(353976..354085,354146..354668) [633 bp,
           210 aa] {ON} YBR067C (REAL)
          Length = 210

 Score = 70.5 bits (171), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 57/88 (64%), Gaps = 4/88 (4%)

Query: 24  NTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTT 83
            T  + AEL+ ++ D+ S+L+DY+ L    ++G S   +P+ VL V + + T SDD+YTT
Sbjct: 20  ETAAQTAELQAIISDINSHLSDYLGL----ETGNSGFQIPSDVLSVYQQVITYSDDAYTT 75

Query: 84  LYANVDFDGVSSLMTKLPWYQSRLEAPL 111
           L++ +DFD ++  +  LPWY +RL + +
Sbjct: 76  LFSELDFDAITKTIVALPWYTTRLSSEI 103

>TPHA0I02210 Chr9 complement(491382..492128) [747 bp, 248 aa] {ON} 
          Length = 248

 Score = 69.3 bits (168), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 58/95 (61%), Gaps = 6/95 (6%)

Query: 26  TTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKAL--FTASDDSYTT 83
           + ++ E +  LDDV++NL DY++ A    + V    LPAGVL+V   +  +   DD+YT+
Sbjct: 25  SIDVIEFQACLDDVQNNLMDYISYAENNANFV----LPAGVLEVYTQMTTYKKDDDAYTS 80

Query: 84  LYANVDFDGVSSLMTKLPWYQSRLEAPLQSIANSN 118
           L+  +DF  +  +MT+LPWY +RL   L S  +SN
Sbjct: 81  LFTQLDFSAIEDVMTQLPWYTTRLAVVLASYFSSN 115

>NCAS0I01540 Chr9 (289458..290102) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 68.6 bits (166), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 58/86 (67%), Gaps = 6/86 (6%)

Query: 24  NTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFT--ASDDSY 81
           +T  + AEL+ +++D+ S+L++Y+ L  T +SG  +   PA VL V + + T  A DDSY
Sbjct: 21  DTAQQTAELQAIIEDINSHLSEYLGLQ-TGNSGFQI---PADVLKVYQQVMTYKAGDDSY 76

Query: 82  TTLYANVDFDGVSSLMTKLPWYQSRL 107
           TTL++ ++FD ++  + KLPWY +RL
Sbjct: 77  TTLFSELNFDEITQTIVKLPWYSTRL 102

>Suva_4.306 Chr4 complement(539034..539627) [594 bp, 197 aa] {ON}
           YBR067C (REAL)
          Length = 197

 Score = 67.8 bits (164), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 54/80 (67%), Gaps = 4/80 (5%)

Query: 32  LKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVDFD 91
           L+ ++ D+ S+L+DY+ L  T +SG  +   PA VL V + + T +DD+YTTL++ +DFD
Sbjct: 28  LQAIIGDINSHLSDYLGLE-TGNSGFQI---PADVLSVYQQVMTYTDDAYTTLFSELDFD 83

Query: 92  GVSSLMTKLPWYQSRLEAPL 111
            ++  + KLPWY +RL + +
Sbjct: 84  AITKTIVKLPWYTTRLSSEI 103

>Skud_2.190 Chr2 complement(340506..340648,340700..341186) [630 bp,
           209 aa] {ON} YBR067C (REAL)
          Length = 209

 Score = 67.8 bits (164), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 55/81 (67%), Gaps = 4/81 (4%)

Query: 31  ELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVDF 90
           EL+ ++ D+ S+L+DY+ L  T +SG  +   PA VL V + + T +DD+YTTL++ +D+
Sbjct: 27  ELQAIIGDINSHLSDYLGLE-TGNSGFKI---PADVLSVYQQVMTYTDDAYTTLFSELDY 82

Query: 91  DGVSSLMTKLPWYQSRLEAPL 111
           D ++  + KLPWY +RL + +
Sbjct: 83  DAITKTIVKLPWYTTRLSSEI 103

>Suva_9.193 Chr9 (322160..323005) [846 bp, 281 aa] {ON} YIL011W
           (REAL)
          Length = 281

 Score = 68.6 bits (166), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 52/83 (62%), Gaps = 8/83 (9%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFT-PDSGVSLDTLPAGVLDVGKAL--FTASDDSYTTL 84
           EI E   +L DVK+NL  Y++LA   PD      TLP GVLDV + +  ++A DD YT+ 
Sbjct: 27  EIVEFDAILVDVKANLEQYMSLAMNNPDF-----TLPDGVLDVYQHMTTYSAGDDGYTSW 81

Query: 85  YANVDFDGVSSLMTKLPWYQSRL 107
           Y  +DF  +++ M ++PWY SRL
Sbjct: 82  YTELDFAQITTAMQQVPWYSSRL 104

>TPHA0L00800 Chr12 (155102..155965) [864 bp, 287 aa] {ON} 
          Length = 287

 Score = 68.6 bits (166), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 52/84 (61%), Gaps = 8/84 (9%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           ++ E+++LL DV +NL  Y  L       +    +P  + D+   + TA+DDSYTTL A 
Sbjct: 25  QVQEMEILLSDVNANLAQYAGL-------LGQVAIPDELFDIYFVMATATDDSYTTLLAQ 77

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPL 111
           +D + +SS+MT LPWY SRL+ PL
Sbjct: 78  LDMNEISSMMTALPWYSSRLQ-PL 100

>KAFR0I02140 Chr9 complement(439942..440304) [363 bp, 120 aa] {ON} 
          Length = 120

 Score = 63.5 bits (153), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 57/87 (65%), Gaps = 4/87 (4%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           E+AE++ LL+DV +NL+DYV+L       +S   LP GVL++  AL     ++++T   +
Sbjct: 25  EVAEVEGLLEDVSNNLSDYVSL--ITSGKLSFTDLPTGVLEI--ALAYMEGENWSTYLTD 80

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPLQSI 114
           VD+  V+S++T+L WY +RLE  + SI
Sbjct: 81  VDWSAVNSMLTELSWYSTRLEPEIASI 107

>TPHA0I02140 Chr9 (475414..476148) [735 bp, 244 aa] {ON} Anc_7.161
           YER011W
          Length = 244

 Score = 65.5 bits (158), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 57/89 (64%), Gaps = 5/89 (5%)

Query: 26  TTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLY 85
           + ++AE+++L++D+ SN  +Y++L           TLPA +L +     TA+D +YTTL+
Sbjct: 22  SAQLAEIQLLVNDITSNQQEYLSLIANGQ-----ITLPADLLALYGVYATATDSAYTTLF 76

Query: 86  ANVDFDGVSSLMTKLPWYQSRLEAPLQSI 114
             ++   V SL+T+LPWY SRLE+  +SI
Sbjct: 77  TQINPTEVQSLVTQLPWYSSRLESGFESI 105

>TBLA0G00500 Chr7 (103205..104020) [816 bp, 271 aa] {ON} 
          Length = 271

 Score = 65.5 bits (158), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 52/86 (60%), Gaps = 6/86 (6%)

Query: 29  IAELKVLLDDVKSNLNDYVAL-AFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           +  LKV +DD+ S++ +Y+++    PD      ++P G+L    A  TA DDSYTT ++N
Sbjct: 27  MVSLKVYMDDIGSHMKEYLSMQKANPD-----QSIPPGILSAYAAKMTAKDDSYTTFFSN 81

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPLQS 113
           +D   +  ++T +PWY SRLE  + S
Sbjct: 82  IDDSYIQYMVTGVPWYSSRLEPAIVS 107

>KAFR0G02810 Chr7 (587244..588293) [1050 bp, 349 aa] {ON} 
          Length = 349

 Score = 65.5 bits (158), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 51/78 (65%), Gaps = 2/78 (2%)

Query: 30  AELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVD 89
           AE + ++ DV+SN+ DY++L  T    +SL  LP+G+++  +A+  +S   Y++L  N+D
Sbjct: 27  AEFEAVMADVQSNIGDYISLVMTGQ--LSLADLPSGLMEYVEAVMASSTAEYSSLMNNID 84

Query: 90  FDGVSSLMTKLPWYQSRL 107
           F  V S++T L WY +RL
Sbjct: 85  FSAVDSMITGLSWYSTRL 102

>TBLA0J01810 Chr10 (411692..412963) [1272 bp, 423 aa] {ON} Anc_7.161
           YER011W
          Length = 423

 Score = 64.7 bits (156), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 54/89 (60%), Gaps = 7/89 (7%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           ++ E+ +++ DV  NL +Y  L    +       +P  + D+  A+  A+DDS+TT+Y N
Sbjct: 28  DVDEMNLIMADVNENLVEYANLLGKIE-------IPDALFDIYGAMDAATDDSWTTMYDN 80

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPLQSIAN 116
           +D   +++++T LPWY SRLE PL SI +
Sbjct: 81  LDMAQITAMLTALPWYSSRLEQPLYSITH 109

>NCAS0F00800 Chr6 (163727..164470) [744 bp, 247 aa] {ON} 
          Length = 247

 Score = 63.5 bits (153), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/87 (44%), Positives = 61/87 (70%), Gaps = 7/87 (8%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFT-PDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYA 86
           E+AE   +L DV+++L DY++LA   PD      T+P+GVL V + L T +DD+YT+L++
Sbjct: 24  EVAEFNAILVDVQAHLEDYMSLAMNNPDF-----TIPSGVLSVYEELTTYTDDTYTSLFS 78

Query: 87  NVDFDGVSSLMTKLPWYQSRLEAPLQS 113
            +DF  V+++M ++PWY SRLE PL +
Sbjct: 79  AIDFAQVTTVMHQVPWYSSRLE-PLMA 104

>Ecym_1223 Chr1 (464202..464747) [546 bp, 181 aa] {ON} similar to
           Saccharomyces cerevisiae YBR067C TIP1 YIL011W TIR3
          Length = 181

 Score = 62.0 bits (149), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 5/94 (5%)

Query: 25  TTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTL 84
           T  +IA++KV L DVK+N ++Y+ L +T         +P   + V +A+ T +D+SYT+L
Sbjct: 24  TPEDIAKIKVFLSDVKANFSEYMNL-YTSGG----FKIPDNFIPVWRAMQTYTDESYTSL 78

Query: 85  YANVDFDGVSSLMTKLPWYQSRLEAPLQSIANSN 118
           + ++  D V+S +T +PWY SRL   L SI    
Sbjct: 79  FTSLKMDQVNSALTAVPWYSSRLAPALVSIGGGG 112

>Ecym_4465 Chr4 (946303..947031) [729 bp, 242 aa] {ON} similar to
           Ashbya gossypii ADR019C
          Length = 242

 Score = 62.8 bits (151), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 59/88 (67%), Gaps = 4/88 (4%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           +++ + V++ D+KS+L +YV+ A + +SG+S+   P  V+ V   + T +D SYT+L++N
Sbjct: 26  QVSSIDVVVQDIKSHLTEYVSYAGS-NSGLSI---PEDVISVYTQVATYTDGSYTSLFSN 81

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPLQSIA 115
           ++F  ++S +T LPWY SRL     S++
Sbjct: 82  LNFQEINSAITGLPWYSSRLAPAFASLS 109

>Smik_5.127 Chr5 (179561..179761) [201 bp, 67 aa] {ON} YOR009W
          (REAL)
          Length = 67

 Score = 58.5 bits (140), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%)

Query: 25 TTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKA 72
          T  +I EL V+L+DVKSN+ +Y++LA  P+SG SL ++PAG+LD+G A
Sbjct: 20 TQDQINELNVILNDVKSNIQEYISLASDPNSGFSLASMPAGILDLGMA 67

>TBLA0A01110 Chr1 (255570..256301) [732 bp, 243 aa] {ON} 
          Length = 243

 Score = 62.0 bits (149), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 51/81 (62%), Gaps = 7/81 (8%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           +++E+++++ DV +NL DYV L    D       +P  + ++   + TA+DDSYT   A 
Sbjct: 24  QVSEMQIIMADVNANLADYVGLVADMD-------IPDALFNLYTEMATATDDSYTKDMAA 76

Query: 88  VDFDGVSSLMTKLPWYQSRLE 108
           +D + +S+++T LPWY SRLE
Sbjct: 77  LDMNQISAMLTVLPWYSSRLE 97

>TBLA0J01865 Chr10 (437434..438153) [720 bp, 239 aa] {ON}
          Length = 239

 Score = 61.6 bits (148), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (58%), Gaps = 6/85 (7%)

Query: 30  AELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVD 89
           AE+ V++ D+  +L DY  L   PD      T+P  V+ V  A  + + D YTT+Y  +D
Sbjct: 26  AEINVVVQDINDHLTDYAGLVGNPD-----ITIPDSVMKVYAAYASGNKD-YTTMYDQLD 79

Query: 90  FDGVSSLMTKLPWYQSRLEAPLQSI 114
            + V+SL++ LPWY SRLE  L +I
Sbjct: 80  MNQVNSLISALPWYSSRLEPQLATI 104

>NDAI0H01290 Chr8 (314469..315248) [780 bp, 259 aa] {ON} 
          Length = 259

 Score = 62.0 bits (149), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 64/96 (66%), Gaps = 6/96 (6%)

Query: 24  NTTTEIAELKVLLDDVKSNLNDYVALAFT-PDSGVSLDTLPAGVLDVGKALFTASDDSYT 82
            T  E+AE   +L DV+++L +Y++LA   PD      T+P+GVL+V + L T +D++YT
Sbjct: 20  QTGYEVAEFNAILVDVQAHLQEYMSLAMNNPDF-----TIPSGVLEVYEQLTTYTDETYT 74

Query: 83  TLYANVDFDGVSSLMTKLPWYQSRLEAPLQSIANSN 118
           TL++ ++F  V+++M +LPWY +RLE  + S   ++
Sbjct: 75  TLFSAINFAQVTTIMEQLPWYTTRLEPIISSYMEAH 110

>Suva_5.100 Chr5 (150965..151165) [201 bp, 67 aa] {ON} YER011W
          (REAL)
          Length = 67

 Score = 57.0 bits (136), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 36/49 (73%)

Query: 24 NTTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKA 72
           T  EI EL V+L+DVKS+L +Y++LA  P SG SL  +PAGVL++G A
Sbjct: 19 QTQEEIDELNVILNDVKSHLQEYMSLAQDPSSGFSLANMPAGVLNIGMA 67

>KAFR0K01210 Chr11 complement(248291..249019) [729 bp, 242 aa] {ON} 
           YIL011W
          Length = 242

 Score = 60.5 bits (145), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 57/83 (68%), Gaps = 4/83 (4%)

Query: 25  TTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTL 84
           T  E+ E + LL DV++NL DY++LA    S     T+P GVL+V + + T +DDSYTTL
Sbjct: 24  TEYELVEFEALLADVEANLEDYISLAVNDAS----FTIPDGVLEVYEQMTTYTDDSYTTL 79

Query: 85  YANVDFDGVSSLMTKLPWYQSRL 107
           ++ ++F  V+++M +LPWY SRL
Sbjct: 80  FSEINFAQVTTVMEQLPWYSSRL 102

>KAFR0K01220 Chr11 complement(250023..250781) [759 bp, 252 aa] {ON} 
          Length = 252

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 59/86 (68%), Gaps = 5/86 (5%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           E  E + +L DV++NL DY++LA    S     T+P GVL+V + + T +DDSYTTL++ 
Sbjct: 27  EYLEFEAILADVEANLEDYISLAVNDAS----FTIPDGVLEVYEQMTTYTDDSYTTLFSQ 82

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPLQS 113
           ++F  V+++M +LPWY SR+ AP+ S
Sbjct: 83  INFAQVTTVMNQLPWYSSRI-APIMS 107

>NDAI0E03650 Chr5 (788320..789501) [1182 bp, 393 aa] {ON} 
          Length = 393

 Score = 57.4 bits (137), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 53/86 (61%), Gaps = 6/86 (6%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           ++ EL++++DDVKSNL  Y+ L   P  G SL   P  ++DV  A+  +  + YTT +  
Sbjct: 23  DVVELEIVMDDVKSNLVRYMNLLTVP--GFSL---PDNIMDVYMAM-NSDPEGYTTAFTE 76

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPLQS 113
           +D   +S++MT LPWY + +E  ++S
Sbjct: 77  LDMTQISNMMTWLPWYSTEIEPKIES 102

>TBLA0J01790 Chr10 complement(402292..402960) [669 bp, 222 aa] {ON} 
          Length = 222

 Score = 56.6 bits (135), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (62%), Gaps = 4/86 (4%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           E+ E   +L DV +NLNDY+++A   +  V    LP GVLDV   + T +DDSYTTL++ 
Sbjct: 24  EVIEFNAILTDVVNNLNDYMSIAENQEGFV----LPDGVLDVYTQMTTYTDDSYTTLFSI 79

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPLQS 113
           +DF  + S+M  LPWY +RL   + S
Sbjct: 80  LDFSEIDSVMAGLPWYSTRLAPAIAS 105

>NDAI0H01300 Chr8 (317052..317753) [702 bp, 233 aa] {ON} 
          Length = 233

 Score = 56.6 bits (135), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 56/80 (70%), Gaps = 4/80 (5%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           E+AE   +L DV+++L +Y++LA          T+P+GVL+V + L T +D++YTTL++ 
Sbjct: 24  EVAEFNAILVDVQAHLQEYMSLAMNNADF----TIPSGVLEVYEQLTTYTDETYTTLFSA 79

Query: 88  VDFDGVSSLMTKLPWYQSRL 107
           ++F  V+++M ++PWY SRL
Sbjct: 80  INFAQVTTVMEQVPWYSSRL 99

>TPHA0C05010 Chr3 complement(1081648..1082256) [609 bp, 202 aa] {ON}
           
          Length = 202

 Score = 54.7 bits (130), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 50/82 (60%), Gaps = 8/82 (9%)

Query: 28  EIA--ELKVLLDDVKSNLNDYVALA-FTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTL 84
           EIA  EL V L D+ +N+ DY+++A  +PD  +     P  +L +     TA+DDSYT+ 
Sbjct: 24  EIANVELGVYLSDIGANMKDYLSMAKVSPDVAI-----PPAMLSIYAEQMTATDDSYTSW 78

Query: 85  YANVDFDGVSSLMTKLPWYQSR 106
           + ++D   V+ ++T +PWY SR
Sbjct: 79  FNSIDPTEVNYMVTGVPWYSSR 100

>KNAG0J00780 Chr10 (134070..134699) [630 bp, 209 aa] {ON}  YBR067C
          Length = 209

 Score = 51.6 bits (122), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 47/90 (52%), Gaps = 4/90 (4%)

Query: 25  TTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTL 84
           T  + AE+  ++ D+ SN   Y+ L            +P  +L + + + T  DDSYT+L
Sbjct: 21  TDEQSAEIYAIVQDINSNQAQYIGLEMNTGGF----QIPPQLLSMYQQVLTYKDDSYTSL 76

Query: 85  YANVDFDGVSSLMTKLPWYQSRLEAPLQSI 114
           +  +D++ ++S +T L WY  RL   L S+
Sbjct: 77  FTALDYNMITSTITGLSWYNERLAPALSSV 106

>TBLA0J01845 Chr10 complement(424079..424891) [813 bp, 270 aa] {ON}
          Length = 270

 Score = 50.8 bits (120), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 49/84 (58%), Gaps = 5/84 (5%)

Query: 32  LKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVDFD 91
           ++V ++D+ S++ DY+++    +      ++P GVL    A  T   DSYT+ +A++  +
Sbjct: 28  MEVYMNDIGSHMKDYLSM----EKAHPEQSIPPGVLSAYAAKLTDKTDSYTSFFADIGDE 83

Query: 92  GVSSLMTKLPWYQSRLEAPLQSIA 115
            +  ++T +PWY +RL AP  S A
Sbjct: 84  QIHYMITGVPWYSTRL-APAISQA 106

>TBLA0J01800 Chr10 complement(408277..408969) [693 bp, 230 aa] {ON} 
          Length = 230

 Score = 50.4 bits (119), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 32  LKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVDFD 91
           ++V ++D+ S++ DY+++    +      ++P GVL    A  T   DSYT+ +A++  +
Sbjct: 28  MEVYMNDIGSHMKDYLSM----EKAHPEQSIPPGVLSAYAAKLTDKTDSYTSFFADIGDE 83

Query: 92  GVSSLMTKLPWYQSRL 107
            +  ++T +PWY +RL
Sbjct: 84  QIHYMITGVPWYSTRL 99

>NCAS0E02110 Chr5 (403722..405935) [2214 bp, 737 aa] {ON} Anc_7.161
          Length = 737

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (58%), Gaps = 6/78 (7%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           E AEL+V+L DV  NL +Y+ L       VS  TLP  ++D+   + T    SYTTL+  
Sbjct: 25  ENAELQVVLADVNDNLGNYMNLL-----TVSGFTLPDNIIDIYIGMGT-DPVSYTTLFTE 78

Query: 88  VDFDGVSSLMTKLPWYQS 105
           +D   +S+++T LPWY S
Sbjct: 79  LDMGQISAMLTWLPWYSS 96

 Score = 47.8 bits (112), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 46/78 (58%), Gaps = 6/78 (7%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           E AEL+V+L DV  NL +Y+ L       VS  +LP  +++V   +  A   SYTTL+  
Sbjct: 205 ENAELQVVLADVNDNLGNYMNLL-----TVSGFSLPDNIVNVYMGMG-ADPVSYTTLFTE 258

Query: 88  VDFDGVSSLMTKLPWYQS 105
           +D   +S+++T LPWY S
Sbjct: 259 LDMGQISAMLTWLPWYSS 276

 Score = 47.8 bits (112), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 46/78 (58%), Gaps = 6/78 (7%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           E AEL+V+L DV  NL +Y+ L       VS  +LP  +++V   +  A   SYTTL+  
Sbjct: 363 ENAELQVVLADVNDNLGNYMNLL-----TVSGFSLPDNIVNVYMGMG-ADPVSYTTLFTE 416

Query: 88  VDFDGVSSLMTKLPWYQS 105
           +D   +S+++T LPWY S
Sbjct: 417 LDMGQISAMLTWLPWYSS 434

>TBLA0A01120 Chr1 (257989..258630) [642 bp, 213 aa] {ON} Anc_7.161
           YER011W
          Length = 213

 Score = 48.9 bits (115), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 47/82 (57%), Gaps = 4/82 (4%)

Query: 32  LKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVDFD 91
           ++V ++D+ S++ +Y+++    +      ++P GVL    A  TA  DSYT+ ++++   
Sbjct: 30  MQVYMNDIGSHMKEYLSM----EKANPEQSIPPGVLSAYAAKMTAKGDSYTSFFSDIPDS 85

Query: 92  GVSSLMTKLPWYQSRLEAPLQS 113
            +  ++T +PWY +RL   + S
Sbjct: 86  YIHYMITGVPWYSTRLAPAISS 107

>Suva_5.21 Chr5 (39195..39569) [375 bp, 124 aa] {ON} YEL049W (REAL)
          Length = 124

 Score = 47.4 bits (111), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 49/90 (54%), Gaps = 9/90 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D+++++ DY A      +    DT P   ++V +A+F   D  +TT+   +
Sbjct: 36  LVELGVYVSDIRAHMADYYAF----QAAHPTDTYP---IEVAEAVFNYGD--FTTMLTGI 86

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQSIANSN 118
             D V+ ++T +PWY +RL   + S  +S+
Sbjct: 87  AADQVTRMITGVPWYSTRLRPAISSALSSD 116

>NCAS0B00460 Chr2 (65100..66020) [921 bp, 306 aa] {ON} 
          Length = 306

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 45/88 (51%), Gaps = 9/88 (10%)

Query: 26  TTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLY 85
           T  + EL V ++D+K+NLNDY A+A         D + + V           D  +TT+ 
Sbjct: 30  TVNLIELAVYVNDIKANLNDYFAMAAAHPEQAYPDIIASAVFG---------DADFTTML 80

Query: 86  ANVDFDGVSSLMTKLPWYQSRLEAPLQS 113
             ++   V+S++T + WY SR+   +++
Sbjct: 81  TGIEPAEVTSMLTGVAWYSSRIAPAIEA 108

>NCAS0E02100 Chr5 complement(401247..401921) [675 bp, 224 aa] {ON}
           YJR150C
          Length = 224

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 10/78 (12%)

Query: 31  ELKVLLDDVKSNLNDYVALA-FTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVD 89
           EL V + D+++N+NDY+++A   P+        PA    +  A+    DD +TT+   + 
Sbjct: 34  ELSVYVKDIRANMNDYLSMAKANPN-----QAYPA---IIATAVMGKGDD-FTTMLTGIS 84

Query: 90  FDGVSSLMTKLPWYQSRL 107
            D V+ ++T +PWY SRL
Sbjct: 85  GDEVTMMLTGVPWYSSRL 102

>NDAI0A08910 Chr1 (2052786..2054264) [1479 bp, 492 aa] {ON} 
          Length = 492

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 47/85 (55%), Gaps = 3/85 (3%)

Query: 26  TTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLY 85
           T  + EL V ++D+ SN+  Y+++            + + VL +   L T  D+ +TTL 
Sbjct: 30  TVNMIELAVYVNDIHSNMAAYLSMQMANPEMAYPAVIESAVLKI--LLKTDPDNKFTTLL 87

Query: 86  ANVDFDGVSSLMTKLPWYQSRLEAP 110
             +D + ++S++T +PWY SRL AP
Sbjct: 88  TGIDPEEITSMITGVPWYSSRL-AP 111

>NCAS0B00470 Chr2 (67250..67696) [447 bp, 148 aa] {ON} 
          Length = 148

 Score = 44.7 bits (104), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 6/82 (7%)

Query: 26  TTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLY 85
           T  + EL V + D+KS++ DY+ +     S    D +   VL         S+D +TTL+
Sbjct: 30  TVNLIELAVYVHDIKSHMLDYLKMQMANPSQKYPDIIETAVL------HNYSNDDFTTLF 83

Query: 86  ANVDFDGVSSLMTKLPWYQSRL 107
            ++D   V+S++T + WY +RL
Sbjct: 84  LDIDGAEVTSMLTGVSWYSTRL 105

>Skud_10.376 Chr10 complement(666881..667774) [894 bp, 297 aa] {ON}
           YJR150C (REAL)
          Length = 297

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 9/81 (11%)

Query: 31  ELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVDF 90
           EL V + D+ ++L +Y A      +    +T P    +V KA+F   D  +TTL   +  
Sbjct: 37  ELAVYVSDIGAHLAEYYAFQALHKT----ETYPP---EVAKAVFAGGD--FTTLLTGIAG 87

Query: 91  DGVSSLMTKLPWYQSRLEAPL 111
           D V+ ++T +PWY +RL A +
Sbjct: 88  DEVTRMITGVPWYSTRLRAAI 108

>Suva_10.48 Chr10 (99563..99934) [372 bp, 123 aa] {ON} YEL049W
           (REAL)
          Length = 123

 Score = 44.3 bits (103), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 50/90 (55%), Gaps = 9/90 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L DY    ++  +    +T P   +++ +A+F   D  +TT+   +
Sbjct: 36  LVELGVYVSDIRAHLADY----YSFQAAHPTETYP---IEIAEAVFDYGD--FTTMLTGI 86

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQSIANSN 118
             D V+ ++T +PWY +RL   + S  +S+
Sbjct: 87  AADQVTRMITGVPWYSTRLRPAISSALSSD 116

>YFL020C Chr6 complement(99231..99599) [369 bp, 122 aa] {ON}
           PAU5Member of the seripauperin multigene family encoded
           mainly in subtelomeric regions; induced during alcoholic
           fermentation; induced by low temperature and also by
           anaerobic conditions; negatively regulated by oxygen and
           repressed by heme
          Length = 122

 Score = 43.5 bits (101), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 48/85 (56%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L +Y    ++  +    +T P   +++ +A+F   D  +TT+   +
Sbjct: 35  LVELGVYVSDIRAHLAEY----YSFQAAHPTETYP---VEIAEAVFNYGD--FTTMLTGI 85

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY SRL+  + S
Sbjct: 86  PADQVTRVITGVPWYSSRLKPAISS 110

>Skud_5.41 Chr5 (61810..62172) [363 bp, 120 aa] {ON} YIR041W (REAL)
          Length = 120

 Score = 43.5 bits (101), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 47/86 (54%), Gaps = 11/86 (12%)

Query: 29  IAELKVLLDDVKSNLNDYVAL-AFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           + EL V + D++++L +Y +  A  P      +T P   +++ +A+F   D  +TT+   
Sbjct: 33  LVELGVYVSDIRAHLAEYYSFQAVHPT-----ETYP---VEIAEAVFNYGD--FTTMLTG 82

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPLQS 113
           +  D V+ ++T +PWY SRL   + S
Sbjct: 83  ISPDQVTRMITGVPWYSSRLRPAISS 108

>Smik_10.445 Chr10 complement(698010..698888) [879 bp, 292 aa] {ON}
           YJR150C (REAL)
          Length = 292

 Score = 44.7 bits (104), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 43/82 (52%), Gaps = 9/82 (10%)

Query: 31  ELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVDF 90
           EL V + D+ ++LN+Y +      +    +T P    ++ KA+F   D  +TT+   +  
Sbjct: 37  ELAVYVSDIGAHLNEYYSFQGLHKT----ETYPP---EIAKAVFAGGD--FTTMLTGISG 87

Query: 91  DGVSSLMTKLPWYQSRLEAPLQ 112
           D V+ ++T +PWY +RL   + 
Sbjct: 88  DEVTRMITGVPWYSTRLAGAIS 109

>YEL049W Chr5 (63728..64090) [363 bp, 120 aa] {ON}  PAU2Member of
           the seripauperin multigene family encoded mainly in
           subtelomeric regions, active during alcoholic
           fermentation, regulated by anaerobiosis, negatively
           regulated by oxygen, repressed by heme
          Length = 120

 Score = 43.1 bits (100), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 47/85 (55%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y    ++  +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 33  LVELGVYVSDIRAHLAQY----YSFQAAHPTETYP---IEVAEAVFNYGD--FTTMLTGI 83

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY SRL+  + S
Sbjct: 84  APDQVTRMITGVPWYSSRLKPAISS 108

>TBLA0H00500 Chr8 complement(96289..98253) [1965 bp, 654 aa] {ON} 
          Length = 654

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 48/88 (54%), Gaps = 6/88 (6%)

Query: 32  LKVLLDDVKSNLNDYVAL-AFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVDF 90
           ++V + D+  N+ +Y+++   +PD     +++P  V      +       +TT ++++  
Sbjct: 32  MEVYMTDIVHNMQEYLSIHKASPD-----ESVPPVVTSAMMTMMLHPTAEFTTFFSDIPL 86

Query: 91  DGVSSLMTKLPWYQSRLEAPLQSIANSN 118
             +  ++T +PW+ SRLE P+ SI ++N
Sbjct: 87  SEIEYMITGVPWFSSRLEGPILSIWSAN 114

>Suva_12.247 Chr12
           complement(397418..397551,398161..398323,398390..398395,
           398759..398781,399013..399072,399148..399227,
           399261..399272,400121..400124,400249..400261,
           400385..400402,400526..400529,400634..400637,
           400814..400817,400930..400947,401143..401499) [900 bp,
           299 aa] {ON} YJR150C (REAL)
          Length = 299

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 45/83 (54%), Gaps = 9/83 (10%)

Query: 31  ELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVDF 90
           EL V + D+++++  Y A   +  +    +T PA   ++  A+F   D  +TT+   +  
Sbjct: 37  ELAVYVSDIRAHMLQYYAFQASHKT----ETYPA---EIASAVFNYGD--FTTMLTGISG 87

Query: 91  DGVSSLMTKLPWYQSRLEAPLQS 113
           D V+ ++T +PWY +RL+  + S
Sbjct: 88  DEVTRMITGVPWYSTRLKGAISS 110

>Smik_3.7 Chr3 complement(7472..7834) [363 bp, 120 aa] {ON} YGL261C
           (REAL)
          Length = 120

 Score = 42.7 bits (99), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 47/85 (55%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y    ++  +    +T P   +++ +A+F   D  +TT+   +
Sbjct: 33  LVELGVYVSDIRAHLAQY----YSFQAAHPTETYP---IEIAEAVFNYGD--FTTMLTGI 83

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY SRL+  + S
Sbjct: 84  APDQVTRMITGVPWYSSRLKPAISS 108

>YJR150C Chr10 complement(708811..709707) [897 bp, 298 aa] {ON}
           DAN1Cell wall mannoprotein with similarity to Tir1p,
           Tir2p, Tir3p, and Tir4p; expressed under anaerobic
           conditions, completely repressed during aerobic growth
          Length = 298

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 48/87 (55%), Gaps = 10/87 (11%)

Query: 31  ELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVDF 90
           EL V + D+ ++L++Y A      +    +T P    ++ KA+F   D  +TT+   +  
Sbjct: 37  ELAVYVSDIGAHLSEYYAFQALHKT----ETYPP---EIAKAVFAGGD--FTTMLTGISG 87

Query: 91  DGVSSLMTKLPWYQSRLEAPL-QSIAN 116
           D V+ ++T +PWY +RL   + +++AN
Sbjct: 88  DEVTRMITGVPWYSTRLMGAISEALAN 114

>Skud_1.71 Chr1 (139279..139641) [363 bp, 120 aa] {ON} YGR294W
           (REAL)
          Length = 120

 Score = 42.7 bits (99), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 47/86 (54%), Gaps = 11/86 (12%)

Query: 29  IAELKVLLDDVKSNLNDYVAL-AFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           + EL V + D++++L +Y +  A  P      +T P   +++ +A+F   D  +TT+   
Sbjct: 33  LVELGVYVSDIRAHLAEYYSFQAVHPT-----ETYP---VEIAEAVFNYGD--FTTMLTG 82

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPLQS 113
           +  D V+ ++T +PWY SRL   + S
Sbjct: 83  IAPDQVTRMITGVPWYSSRLRPAISS 108

>Skud_6.51 Chr6 complement(101902..102264) [363 bp, 120 aa] {ON}
           YFL020C (REAL)
          Length = 120

 Score = 42.7 bits (99), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 47/86 (54%), Gaps = 11/86 (12%)

Query: 29  IAELKVLLDDVKSNLNDYVAL-AFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           + EL V + D++++L +Y +  A  P      +T P   +++ +A+F   D  +TT+   
Sbjct: 33  LVELGVYVSDIRAHLAEYYSFQAVHPT-----ETYP---VEIAEAVFNYGD--FTTMLTG 82

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPLQS 113
           +  D V+ ++T +PWY SRL   + S
Sbjct: 83  IAPDQVTRMITGVPWYSSRLRPAISS 108

>TPHA0I02200 Chr9 (490236..491036) [801 bp, 266 aa] {ON} 
          Length = 266

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 46/88 (52%), Gaps = 7/88 (7%)

Query: 29  IAELKVLLDDVKSNLNDYVAL-AFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           I EL+V + D+ +N++ Y+A+ A  P         PA ++     +   +  SYT+ ++ 
Sbjct: 26  IVELEVYMTDIVNNMDQYLAMQAANPGQA-----FPAEIMSAYVQMARGNTISYTSFFST 80

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPLQSIA 115
           +D   V  LMT + WY +RL AP  S A
Sbjct: 81  IDESEVEFLMTGVSWYSARL-APSVSAA 107

>Smik_1.80 Chr1 complement(154201..154563) [363 bp, 120 aa] {ON}
           YLL064C (REAL)
          Length = 120

 Score = 42.4 bits (98), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 47/85 (55%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y    ++  +    +T P   +++ +A+F   D  +TT+   +
Sbjct: 33  LVELGVYVSDIRAHLAQY----YSFQAAHPTETYP---VEIAEAVFNYGD--FTTMLTGI 83

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY SRL+  + S
Sbjct: 84  APDQVTRMITGVPWYSSRLKPAISS 108

>YJL223C Chr10 complement(8776..9138) [363 bp, 120 aa] {ON}
           PAU1Member of the seripauperin multigene family encoded
           mainly in subtelomeric regions, active during alcoholic
           fermentation, regulated by anaerobiosis, negatively
           regulated by oxygen, repressed by heme; identical to
           Pau14p
          Length = 120

 Score = 42.4 bits (98), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 46/85 (54%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y    +   +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 33  LVELGVYVSDIRAHLAQY----YMFQAAHPTETYP---VEVAEAVFNYGD--FTTMLTGI 83

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY SRL+  + S
Sbjct: 84  SPDQVTRMITGVPWYSSRLKPAISS 108

>YIL176C Chr9 complement(8793..9155) [363 bp, 120 aa] {ON}
           PAU14Protein of unknown function, member of the
           seripauperin multigene family encoded mainly in
           subtelomeric regions; identical to Pau1p
          Length = 120

 Score = 42.4 bits (98), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 46/85 (54%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y    +   +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 33  LVELGVYVSDIRAHLAQY----YMFQAAHPTETYP---VEVAEAVFNYGD--FTTMLTGI 83

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY SRL+  + S
Sbjct: 84  SPDQVTRMITGVPWYSSRLKPAISS 108

>YDR542W Chr4 (1523249..1523611) [363 bp, 120 aa] {ON}  PAU10Protein
           of unknown function, member of the seripauperin
           multigene family encoded mainly in subtelomeric regions
          Length = 120

 Score = 42.4 bits (98), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 46/85 (54%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y    +   +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 33  LVELGVYVSDIRAHLAQY----YMFQAAHPTETYP---VEVAEAVFNYGD--FTTMLTGI 83

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY SRL+  + S
Sbjct: 84  APDQVTRMITGVPWYSSRLKPAISS 108

>YGR294W Chr7 (1080306..1080668) [363 bp, 120 aa] {ON}  PAU12Protein
           of unknown function, member of the seripauperin
           multigene family encoded mainly in subtelomeric regions
          Length = 120

 Score = 42.4 bits (98), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 47/85 (55%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y    ++  +    +T P   +++ +A+F   D  +TT+   +
Sbjct: 33  LVELGVYVSDIRAHLAQY----YSFQAAHPTETYP---VEIAEAVFNYGD--FTTMLTGI 83

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY SRL+  + S
Sbjct: 84  APDQVTRMITGVPWYSSRLKPAISS 108

>YAL068C Chr1 complement(1807..2169) [363 bp, 120 aa] {ON}
           PAU8Protein of unknown function, member of the
           seripauperin multigene family encoded mainly in
           subtelomeric regions
          Length = 120

 Score = 42.0 bits (97), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 46/85 (54%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y    +   +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 33  LVELGVYVSDIRAHLAQY----YMFQAAHPTETYP---VEVAEAVFNYGD--FTTMLTGI 83

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY SRL+  + S
Sbjct: 84  APDQVTRMITGVPWYSSRLKPAISS 108

>YGL261C Chr7 complement(6290..6652) [363 bp, 120 aa] {ON}
           PAU11Putative protein of unknown function and member of
           the seripauperin multigene family encoded mainly in
           subtelomeric regions; mRNA expression appears to be
           regulated by SUT1 and UPC2
          Length = 120

 Score = 42.0 bits (97), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 46/85 (54%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y    +   +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 33  LVELGVYVSDIRAHLAQY----YMFQAAHPTETYP---VEVAEAVFNYGD--FTTMLTGI 83

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY SRL+  + S
Sbjct: 84  APDQVTRMITGVPWYSSRLKPAISS 108

>YBR301W Chr2 (809057..809419) [363 bp, 120 aa] {ON}  PAU24Cell wall
           mannoprotein with similarity to Tir1p, Tir2p, Tir3p, and
           Tir4p; member of the seripauperin multigene family
           encoded mainly in subtelomeric regions; expressed under
           anaerobic conditions, completely repressed during
           aerobic growth
          Length = 120

 Score = 42.0 bits (97), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 46/85 (54%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y +      +    +T P   +++ +A+F   D  +TT+   +
Sbjct: 33  LVELGVYVSDIRAHLAQYYSFQVAHPT----ETYP---VEIAEAVFNYGD--FTTMLTGI 83

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY SRL+  + S
Sbjct: 84  APDQVTRMITGVPWYSSRLKPAISS 108

>YHL046C Chr8 complement(11923..12285) [363 bp, 120 aa] {ON}
           PAU13Protein of unknown function, member of the
           seripauperin multigene family encoded mainly in
           subtelomeric regions; expression is induced after
           ethanol shock
          Length = 120

 Score = 42.0 bits (97), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 45/85 (52%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y        +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 33  LVELGVYVSDIRAHLAQYYMF----QAAHPTETYP---VEVAEAVFNYGD--FTTMLTGI 83

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY SRL+  + S
Sbjct: 84  APDQVTRMITGVPWYSSRLKPAISS 108

>Suva_12.248 Chr12 complement(401059..401499) [441 bp, 146 aa] {ON}
           YJR150C (REAL)
          Length = 146

 Score = 42.4 bits (98), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 45/83 (54%), Gaps = 9/83 (10%)

Query: 31  ELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVDF 90
           EL V + D+++++  Y A   +  +    +T PA   ++  A+F   D  +TT+   +  
Sbjct: 37  ELAVYVSDIRAHMLQYYAFQASHKT----ETYPA---EIASAVFNYGD--FTTMLTGISG 87

Query: 91  DGVSSLMTKLPWYQSRLEAPLQS 113
           D V+ ++T +PWY +RL+  + S
Sbjct: 88  DEVTRMITGVPWYSTRLKGAISS 110

>Smik_12.39 Chr12 (80692..81066) [375 bp, 124 aa] {ON} YLL025W
           (REAL)
          Length = 124

 Score = 42.0 bits (97), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 46/85 (54%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L +Y +      +    +T P   +++ +A+F   D  +TT+   +
Sbjct: 36  LVELGVYVSDIRAHLAEYYSF----QAAHPTETYP---VEIAEAVFNYGD--FTTMLTGI 86

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY +RL   + S
Sbjct: 87  APDQVTRIITGVPWYSTRLRPAISS 111

>YLR037C Chr12 complement(222685..223059) [375 bp, 124 aa] {ON}
           PAU23Cell wall mannoprotein with similarity to Tir1p,
           Tir2p, Tir3p, and Tir4p; member of the seripauperin
           multigene family encoded mainly in subtelomeric regions;
           expressed under anaerobic conditions, completely
           repressed during aerobic growth
          Length = 124

 Score = 41.6 bits (96), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 45/85 (52%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L +Y        +    +T P   +++ +A+F   D  +TT+   +
Sbjct: 36  LVELGVYVSDIRAHLAEYYMF----QAAHPTETYP---VEIAEAVFNYGD--FTTMLTGI 86

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY +RL   + S
Sbjct: 87  PADQVTRVITGVPWYSTRLRPAISS 111

>YLL025W Chr12 (94747..95121) [375 bp, 124 aa] {ON}  PAU17Protein of
           unknown function, member of the seripauperin multigene
           family encoded mainly in subtelomeric regions; YLL025W
           is not an essential gene
          Length = 124

 Score = 41.6 bits (96), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 45/85 (52%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L +Y        +    +T P   +++ +A+F   D  +TT+   +
Sbjct: 36  LVELGVYVSDIRAHLAEYYMF----QAAHPTETYP---VEIAEAVFNYGD--FTTMLTGI 86

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY +RL   + S
Sbjct: 87  PADQVTRVITGVPWYSTRLRPAISS 111

>Suva_5.106 Chr5 complement(162509..162883) [375 bp, 124 aa] {ON}
           YLL064C (REAL)
          Length = 124

 Score = 41.6 bits (96), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y        +    +T P   ++V +A+F   D  +TT+   V
Sbjct: 36  LVELGVYVSDIRAHLAQYYLF----QAAHPTETYP---VEVAEAVFNYGD--FTTMLTGV 86

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY +RL   + S
Sbjct: 87  AADQVTRMITGVPWYSTRLRPAISS 111

>Suva_7.585 Chr7 (1022458..1022832) [375 bp, 124 aa] {ON} YFL020C
           (REAL)
          Length = 124

 Score = 41.6 bits (96), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 44/85 (51%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D+++++  Y        +    +T P   ++V +A+F   D  +TT+   V
Sbjct: 36  LVELGVYVSDIRAHMAQYYLF----QAAHPTETYP---IEVAEAVFNYGD--FTTMLTGV 86

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY +RL   + S
Sbjct: 87  AADQVTRMITGVPWYSTRLRPAISS 111

>Suva_14.413 Chr14 (711723..712088) [366 bp, 121 aa] {ON} YAL068C
           (REAL)
          Length = 121

 Score = 41.2 bits (95), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y    +   +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 34  LVELGVYVSDIRAHLAQY----YLFQAAHPTETYP---VEVAEAVFNYGD--FTTMLTGI 84

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY +RL   + S
Sbjct: 85  AADQVTRMITGVPWYSTRLRPAISS 109

>KNAG0B06950 Chr2 (1382599..1384200) [1602 bp, 533 aa] {ON} 
          Length = 533

 Score = 42.7 bits (99), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 5/80 (6%)

Query: 30  AELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVD 89
           A L VL  DV  N   Y +   +   GV     P  +++V +A  T +DDS++T+  +++
Sbjct: 28  AVLIVLFKDVFKNFPKYGSWFMSSGFGV-----PNNIIEVYEAAHTYTDDSFSTMLTSLE 82

Query: 90  FDGVSSLMTKLPWYQSRLEA 109
              +  ++T +PWY S L A
Sbjct: 83  MSQIMPMVTAVPWYSSYLSA 102

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 3/81 (3%)

Query: 31  ELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVDF 90
           EL V + D+ +N+  Y+       +       PA    V  A+    +  Y TL   +D 
Sbjct: 173 ELAVYVKDINANMQQYLNFQ---QANPGQPYPPAIAQAVMHAMMGQPESEYMTLLTGIDP 229

Query: 91  DGVSSLMTKLPWYQSRLEAPL 111
             V  +++ +PWY +RLE  L
Sbjct: 230 ATVQMMLSGVPWYSTRLEQAL 250

>Smik_16.460 Chr16 (792614..792988) [375 bp, 124 aa] {ON} YFL020C
           (REAL)
          Length = 124

 Score = 41.2 bits (95), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y        +    +T P   ++V +A+F   D  +TT+   V
Sbjct: 36  LVELGVYVSDIRAHLAQYYLF----QAAHPTETYP---VEVAEAVFNYGD--FTTMLTGV 86

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY +RL   + S
Sbjct: 87  APDQVTRMITGVPWYSTRLRPAISS 111

>YLR461W Chr12 (1062919..1063281) [363 bp, 120 aa] {ON}  PAU4Member
           of the seripauperin multigene family encoded mainly in
           subtelomeric regions; active during alcoholic
           fermentation, regulated by anaerobiosis, negatively
           regulated by oxygen, repressed by heme
          Length = 120

 Score = 41.2 bits (95), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 44/80 (55%), Gaps = 9/80 (11%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y    +   +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 33  LVELGVYVSDIRAHLAQY----YMFQAAHPTETYP---VEVAEAVFNYGD--FTTMLTGI 83

Query: 89  DFDGVSSLMTKLPWYQSRLE 108
             D V+ ++T +PWY SRL+
Sbjct: 84  APDQVTRMITGVPWYSSRLK 103

>Smik_5.10 Chr5 complement(11236..11610) [375 bp, 124 aa] {ON}
           YFL020C (REAL)
          Length = 124

 Score = 41.2 bits (95), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y        +    +T P   ++V +A+F   D  +TT+   V
Sbjct: 36  LVELGVYVSDIRAHLAQYYLF----QAAHPTETYP---VEVAEAVFNYGD--FTTMLTGV 86

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY +RL   + S
Sbjct: 87  APDQVTRMITGVPWYSTRLRPAISS 111

>Smik_5.360 Chr5 (558125..558499) [375 bp, 124 aa] {ON} YIL176C
           (REAL)
          Length = 124

 Score = 41.2 bits (95), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y        +    +T P   ++V +A+F   D  +TT+   V
Sbjct: 36  LVELGVYVSDIRAHLAQYYLF----QAAHPTETYP---VEVAEAVFNYGD--FTTMLTGV 86

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY +RL   + S
Sbjct: 87  APDQVTRMITGVPWYSTRLRPAISS 111

>Skud_5.2 Chr5 (3597..3971) [375 bp, 124 aa] {ON} YHL046C (REAL)
          Length = 124

 Score = 41.2 bits (95), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 44/85 (51%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y        +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 36  LVELGVYVSDIRAHLAQYYLF----QAAHPTETYP---VEVAQAVFNYGD--FTTMLTGI 86

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY +RL   + S
Sbjct: 87  APDQVTRMITGVPWYSTRLRPAISS 111

>Skud_12.556 Chr12 (996687..997061) [375 bp, 124 aa] {ON} YPL282C
           (REAL)
          Length = 124

 Score = 41.2 bits (95), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 44/85 (51%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y        +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 36  LVELGVYVSDIRAHLAQYYLF----QAAHPTETYP---VEVAQAVFNYGD--FTTMLTGI 86

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY +RL   + S
Sbjct: 87  APDQVTRMITGVPWYSTRLRPAISS 111

>Skud_3.170 Chr3 (274863..275237) [375 bp, 124 aa] {ON} YFL020C
           (REAL)
          Length = 124

 Score = 41.2 bits (95), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 44/85 (51%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y        +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 36  LVELGVYVSDIRAHLAQYYLF----QAAHPTETYP---VEVAQAVFNYGD--FTTMLTGI 86

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY +RL   + S
Sbjct: 87  APDQVTRMITGVPWYSTRLRPAISS 111

>Skud_3.174 Chr3 (286829..287191) [363 bp, 120 aa] {ON} YIR041W
           (REAL)
          Length = 120

 Score = 40.8 bits (94), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y    +   +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 33  LVELGVYVSDIRAHLAQY----YLFQAAHPTETYP---VEVAQAVFNYGD--FTTMLTGI 83

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY +RL   + S
Sbjct: 84  APDQVTRMITGVPWYSTRLRPAISS 108

>Skud_14.3 Chr14 complement(4247..4609) [363 bp, 120 aa] {ON}
           YOR394W (REAL)
          Length = 120

 Score = 40.8 bits (94), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y    +   +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 33  LVELGVYVSDIRAHLAQY----YLFQAAHPTETYP---VEVAQAVFNYGD--FTTMLTGI 83

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY +RL   + S
Sbjct: 84  APDQVTRMITGVPWYSTRLRPAISS 108

>Suva_6.39 Chr6 complement(72184..72549) [366 bp, 121 aa] {ON}
           YFL020C (REAL)
          Length = 121

 Score = 40.8 bits (94), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 45/85 (52%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D+++++  Y    +   +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 34  LVELGVYVSDIRAHMAQY----YLFQAAHPTETYP---VEVAEAVFNYGD--FTTMLTGI 84

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY +RL   + S
Sbjct: 85  AADQVTRMITGVPWYSTRLRPAISS 109

>Suva_12.243 Chr12 complement(387278..388099) [822 bp, 273 aa] {ON}
           YJR150C (REAL)
          Length = 273

 Score = 42.0 bits (97), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 44/81 (54%), Gaps = 9/81 (11%)

Query: 31  ELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVDF 90
           EL V + D++++L DY +      +    +T P    +V  A+F   +  +TT+   +  
Sbjct: 37  ELAVYVSDIRAHLVDYYSFQGQHPT----ETYPP---EVASAVFNYGE--FTTMLTGISG 87

Query: 91  DGVSSLMTKLPWYQSRLEAPL 111
           D V+ ++T +PWY +RL+A +
Sbjct: 88  DQVTRMITGVPWYSTRLKAAI 108

>Suva_7.36 Chr7 (70912..71283) [372 bp, 123 aa] {ON} YFL020C (REAL)
          Length = 123

 Score = 40.8 bits (94), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 9/80 (11%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y        +    +T P   ++V KA+F   D  +TT+   V
Sbjct: 36  LVELGVYVSDIRAHLAQYYLF----QAAHPTETYP---VEVAKAVFNYGD--FTTMLTGV 86

Query: 89  DFDGVSSLMTKLPWYQSRLE 108
           +   V+ ++T +PWY +RL 
Sbjct: 87  EPAQVTRMITGVPWYSTRLR 106

>YOL161C Chr15 complement(11549..11911) [363 bp, 120 aa] {ON}
           PAU20Protein of unknown function, member of the
           seripauperin multigene family encoded mainly in
           subtelomeric regions; expression induced by low
           temperature and also by anaerobic conditions; induced
           during alcoholic fermentation
          Length = 120

 Score = 40.4 bits (93), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 43/80 (53%), Gaps = 9/80 (11%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y        +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 33  LVELGVYVSDIRAHLAQYYMF----QAAHPTETYP---VEVAEAVFNYGD--FTTMLTGI 83

Query: 89  DFDGVSSLMTKLPWYQSRLE 108
             D V+ ++T +PWY +RL+
Sbjct: 84  SPDQVTRMITGVPWYSTRLK 103

>Skud_12.104 Chr12 complement(207545..207919) [375 bp, 124 aa] {ON}
           YLR037C (REAL)
          Length = 124

 Score = 40.4 bits (93), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 45/85 (52%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L +Y        +    +T P   +++ +A+F   D  +TT+   +
Sbjct: 36  LVELGVYVSDIRAHLAEYYMF----QAAHPTETYP---VEIAEAVFNYGD--FTTMLTGI 86

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             + V+ ++T +PWY +RL   + S
Sbjct: 87  PAEQVTRVITGVPWYSTRLRPAISS 111

>Smik_2.6 Chr2 complement(7672..8046) [375 bp, 124 aa] {ON} YFL020C
           (REAL)
          Length = 124

 Score = 40.4 bits (93), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 43/80 (53%), Gaps = 9/80 (11%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y        +    +T P   ++V +A+F   D  +TT+   V
Sbjct: 36  LVELGVYVSDIRAHLAQYYLF----QAAHPTETYP---VEVAEAVFNYGD--FTTMLTGV 86

Query: 89  DFDGVSSLMTKLPWYQSRLE 108
             D V+ ++T +PWY +RL+
Sbjct: 87  APDQVTRMITGVPWYSTRLK 106

>Smik_14.411 Chr14 (729137..729511) [375 bp, 124 aa] {ON} YFL020C
           (REAL)
          Length = 124

 Score = 40.4 bits (93), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 43/80 (53%), Gaps = 9/80 (11%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y        +    +T P   ++V +A+F   D  +TT+   V
Sbjct: 36  LVELGVYVSDIRAHLAQYYLF----QAAHPTETYP---VEVAEAVFNYGD--FTTMLTGV 86

Query: 89  DFDGVSSLMTKLPWYQSRLE 108
             D V+ ++T +PWY +RL+
Sbjct: 87  APDQVTRMITGVPWYSTRLK 106

>Suva_1.96 Chr1 complement(159596..159961) [366 bp, 121 aa] {ON}
           YLL025W (REAL)
          Length = 121

 Score = 40.0 bits (92), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 45/85 (52%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D+++++  Y    +   +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 34  LVELGVYVSDIRAHMAQY----YLFQAAHPTETYP---VEVAEAVFNYGD--FTTMLTGI 84

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY +RL   + S
Sbjct: 85  APDQVTRMITGVPWYSTRLRPAISS 109

>Suva_1.88 Chr1 complement(156025..156390) [366 bp, 121 aa] {ON}
           YLL025W (REAL)
          Length = 121

 Score = 40.0 bits (92), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 45/85 (52%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D+++++  Y    +   +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 34  LVELGVYVSDIRAHMAQY----YLFQAAHPTETYP---VEVAEAVFNYGD--FTTMLTGI 84

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             D V+ ++T +PWY +RL   + S
Sbjct: 85  APDQVTRMITGVPWYSTRLRPAISS 109

>YNR076W Chr14 (781918..782280) [363 bp, 120 aa] {ON}  PAU6Member of
           the seripauperin multigene family encoded mainly in
           subtelomeric regions, active during alcoholic
           fermentation, regulated by anaerobiosis, negatively
           regulated by oxygen, repressed by heme; identical to
           Pau18p
          Length = 120

 Score = 40.0 bits (92), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 9/80 (11%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y    +   +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 33  LVELGVYVSDIRAHLAQY----YMFQAAHPTETYP---VEVAEAVFNYGD--FTTMLTGI 83

Query: 89  DFDGVSSLMTKLPWYQSRLE 108
             D V+ ++T +PWY +RL+
Sbjct: 84  APDQVTRMITGVPWYSTRLK 103

>YLL064C Chr12 complement(13083..13445) [363 bp, 120 aa] {ON}
           PAU18Protein of unknown function, member of the
           seripauperin multigene family encoded mainly in
           subtelomeric regions; identical to Pau6p
          Length = 120

 Score = 40.0 bits (92), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 9/80 (11%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y    +   +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 33  LVELGVYVSDIRAHLAQY----YMFQAAHPTETYP---VEVAEAVFNYGD--FTTMLTGI 83

Query: 89  DFDGVSSLMTKLPWYQSRLE 108
             D V+ ++T +PWY +RL+
Sbjct: 84  APDQVTRMITGVPWYSTRLK 103

>Smik_5.44 Chr5 (65812..66174) [363 bp, 120 aa] {ON} YNR076W (REAL)
          Length = 120

 Score = 39.7 bits (91), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 9/80 (11%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y    +   +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 33  LVELGVYVSDIRAHLAQY----YLFQAAHPTETYP---VEVAEAVFNYGD--FTTMLTGI 83

Query: 89  DFDGVSSLMTKLPWYQSRLE 108
             D V+ ++T +PWY +RL+
Sbjct: 84  APDQVTRMITGVPWYSTRLK 103

>Smik_17.5 Chr17 complement(4181..4543) [363 bp, 120 aa] {ON}
           YNR076W (REAL)
          Length = 120

 Score = 39.7 bits (91), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 9/80 (11%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y    +   +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 33  LVELGVYVSDIRAHLAQY----YLFQAAHPTETYP---VEVAEAVFNYGD--FTTMLTGI 83

Query: 89  DFDGVSSLMTKLPWYQSRLE 108
             D V+ ++T +PWY +RL+
Sbjct: 84  APDQVTRMITGVPWYSTRLK 103

>Smik_19.2 Chr19 complement(865..1227) [363 bp, 120 aa] {ON} YNR076W
           (REAL)
          Length = 120

 Score = 39.7 bits (91), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 9/80 (11%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y    +   +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 33  LVELGVYVSDIRAHLAQY----YLFQAAHPTETYP---VEVAEAVFNYGD--FTTMLTGI 83

Query: 89  DFDGVSSLMTKLPWYQSRLE 108
             D V+ ++T +PWY +RL+
Sbjct: 84  APDQVTRMITGVPWYSTRLK 103

>Smik_10.12 Chr10 (22480..23244) [765 bp, 255 aa] {ON} YJR151C
           (REAL)
          Length = 255

 Score = 40.4 bits (93), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 47/88 (53%), Gaps = 10/88 (11%)

Query: 31  ELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVDF 90
           EL V + D++++L  Y +      S    +T P    ++ KA+F   D  +TT+   +  
Sbjct: 37  ELAVYVSDIRAHLFQYYSFQNRHKS----ETYPP---EIAKAVFDNGD--FTTMLTGISG 87

Query: 91  DGVSSLMTKLPWYQSRLEAPLQSIANSN 118
           D V+ ++T +PWY +RL+ P  S+A S 
Sbjct: 88  DEVTRMITGVPWYSTRLK-PAISVALSK 114

>ADR019C Chr4 complement(739205..739837) [633 bp, 210 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER011W
           (TIR1) and YIL011W (TIR3) and Non-syntenic homolog of
           Saccharomyces cerevisiae YBR067C (TIP1)
          Length = 210

 Score = 40.4 bits (93), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 43/92 (46%), Gaps = 9/92 (9%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTL--Y 85
           E + L VL  D +++  DY+   F P   V     P G+ +   A F     ++ T   Y
Sbjct: 24  ESSSLDVLFSDAQAHTQDYMGF-FKP---VGTHDPPRGLKE---AFFKLLAGNFPTEADY 76

Query: 86  ANVDFDGVSSLMTKLPWYQSRLEAPLQSIANS 117
             +DF+ V + +  LPWY  RL  PL +I  +
Sbjct: 77  EAIDFETVKNGVKDLPWYNDRLAKPLAAIGGA 108

>YCR104W Chr3 (307801..308175) [375 bp, 124 aa] {ON}  PAU3Member of
           the seripauperin multigene family encoded mainly in
           subtelomeric regions, active during alcoholic
           fermentation, regulated by anaerobiosis, negatively
           regulated by oxygen, repressed by heme
          Length = 124

 Score = 39.3 bits (90), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 44/85 (51%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y        +    +T P   +++ +A+F   D  +TT+   +
Sbjct: 36  LVELGVYVSDIRAHLAQYYLF----QAAHPTETYP---VEIAEAVFNYGD--FTTMLTGI 86

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             + V+ ++T +PWY +RL   + S
Sbjct: 87  PAEQVTRVITGVPWYSTRLRPAISS 111

>YMR325W Chr13 (922641..923015) [375 bp, 124 aa] {ON}  PAU19Protein
           of unknown function, member of the seripauperin
           multigene family encoded mainly in subtelomeric regions
          Length = 124

 Score = 39.3 bits (90), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 44/85 (51%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y        +    +T P   +++ +A+F   D  +TT+   +
Sbjct: 36  LVELGVYVSDIRAHLAQYYLF----QAAHPTETYP---VEIAEAVFNYGD--FTTMLTGI 86

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             + V+ ++T +PWY +RL   + S
Sbjct: 87  PAEQVTRVITGVPWYSTRLRPAISS 111

>YKL224C Chr11 complement(1810..2181) [372 bp, 123 aa] {ON}
           PAU16Protein of unknown function, member of the
           seripauperin multigene family encoded mainly in
           subtelomeric regions
          Length = 123

 Score = 39.3 bits (90), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 44/85 (51%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y        S    +T P   +++ +A+F   D  +TT+   +
Sbjct: 36  LVELGVYVSDIRAHLAQYYLFQAAHPS----ETYP---VEIAEAVFNYGD--FTTMLTGI 86

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             + V+ ++T +PWY +RL   + S
Sbjct: 87  PAEQVTRVITGVPWYSTRLRPAISS 111

>YPL282C Chr16 complement(7933..8427) [495 bp, 164 aa] {ON}
           PAU22Protein of unknown function, member of the
           seripauperin multigene family encoded mainly in
           subtelomeric regions; identical to Pau21p; encodes 2
           proteins that are translated from 2 different start
           codons
          Length = 164

 Score = 39.7 bits (91), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 44/85 (51%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y        +    +T P   +++ +A+F   D  +TT+   +
Sbjct: 76  LVELGVYVSDIRAHLAQYYLF----QAAHPTETYP---VEIAEAVFNYGD--FTTMLTGI 126

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             + V+ ++T +PWY +RL   + S
Sbjct: 127 PAEQVTRVITGVPWYSTRLRPAISS 151

>YOR394W Chr15 (1082718..1083212) [495 bp, 164 aa] {ON}
           PAU21Protein of unknown function, member of the
           seripauperin multigene family encoded mainly in
           subtelomeric regions; identical to Pau22p; encodes 2
           proteins that are translated from 2 different start
           codons
          Length = 164

 Score = 39.7 bits (91), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 44/85 (51%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y        +    +T P   +++ +A+F   D  +TT+   +
Sbjct: 76  LVELGVYVSDIRAHLAQYYLF----QAAHPTETYP---VEIAEAVFNYGD--FTTMLTGI 126

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             + V+ ++T +PWY +RL   + S
Sbjct: 127 PAEQVTRVITGVPWYSTRLRPAISS 151

>YIR041W Chr9 (433929..434303) [375 bp, 124 aa] {ON}  PAU15Protein
           of unknown function, member of the seripauperin
           multigene family encoded mainly in subtelomeric regions
          Length = 124

 Score = 38.9 bits (89), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 44/85 (51%), Gaps = 9/85 (10%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y        S    +T P   +++ +A+F   D  +TT+   +
Sbjct: 36  LVELGVYVSDIRAHLAQYYLFQAAHPS----ETYP---VEIAEAVFNYGD--FTTMLTGI 86

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQS 113
             + V+ ++T +PWY +RL   + S
Sbjct: 87  PAEQVTRVITGVPWYSTRLRPAISS 111

>TPHA0I02150 Chr9 complement(476635..477951) [1317 bp, 438 aa] {ON} 
          Length = 438

 Score = 39.7 bits (91), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 46/87 (52%), Gaps = 5/87 (5%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           I EL+V + D+ +N++ Y+A+    + G      P+ ++     +   +  SYT+ ++ +
Sbjct: 26  IVELEVYMTDIVNNMDQYLAMQ-EANPG---QAFPSEIMSAYIQIAIGNTISYTSFFSTI 81

Query: 89  DFDGVSSLMTKLPWYQSRLEAPLQSIA 115
           D   V  +MT + WY +RL AP  S A
Sbjct: 82  DESEVEFMMTGVSWYSARL-APSVSAA 107

>Skud_10.379 Chr10 complement(672005..673015) [1011 bp, 337 aa] {ON}
           YGR294W (REAL)
          Length = 337

 Score = 39.3 bits (90), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 44/83 (53%), Gaps = 9/83 (10%)

Query: 31  ELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVDF 90
           EL V + D++++L  Y +      +    +T P    ++ +A+F   D  +TT+   +  
Sbjct: 37  ELAVYVSDIRAHLWQYYSF----QNKHKTETYPP---EIAQAVFNYGD--FTTMLTGIAP 87

Query: 91  DGVSSLMTKLPWYQSRLEAPLQS 113
           D V+ ++T +PWY +RL+  + S
Sbjct: 88  DQVTRMITGVPWYSTRLKPAISS 110

>Smik_12.560 Chr12 (989728..989910) [183 bp, 61 aa] {ON} YJL223C
           (REAL)
          Length = 61

 Score = 37.0 bits (84), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 2/47 (4%)

Query: 67  LDVGKALFTASDDSYTTLYANVDFDGVSSLMTKLPWYQSRLEAPLQS 113
           ++V +A F  SD  +TT+   +  D V+ ++T +PWY SRLE  + S
Sbjct: 5   VEVAEAAFNYSD--FTTMLTGLSPDQVTRMITGVPWYSSRLEPAIAS 49

>NDAI0A07890 Chr1 complement(1811865..1813862) [1998 bp, 665 aa]
           {ON} 
          Length = 665

 Score = 39.3 bits (90), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 46/81 (56%), Gaps = 8/81 (9%)

Query: 31  ELKVLLDDVKSNLNDYVALAFTPDSGVSLDT-LPAGVLDVGKALFTASD--DSYTTLYAN 87
           EL + ++D+  ++ DY+++      G + D   P+ ++    A+   +D  + +TTL++ 
Sbjct: 35  ELAIYVNDIHGHMADYLSM-----QGANPDMPYPSEIMKAVMAILFGTDPNNKFTTLFST 89

Query: 88  VDFDGVSSLMTKLPWYQSRLE 108
           +    ++S++T +PWY  RL+
Sbjct: 90  IPPAEITSMITGVPWYSERLQ 110

>Skud_7.45 Chr7 (81233..81607) [375 bp, 124 aa] {ON} YFL020C (REAL)
          Length = 124

 Score = 37.7 bits (86), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 41/80 (51%), Gaps = 9/80 (11%)

Query: 29  IAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANV 88
           + EL V + D++++L  Y        +    +T P   ++V +A+F   D  +TT+   +
Sbjct: 36  LVELGVYVSDIRAHLAQYYLF----QAAHPTETYP---VEVAQAVFNYGD--FTTMLTGI 86

Query: 89  DFDGVSSLMTKLPWYQSRLE 108
               V+ ++T +PWY +RL 
Sbjct: 87  APAQVTRMITGVPWYSTRLR 106

>TBLA0J01850 Chr10 (427405..428802) [1398 bp, 465 aa] {ON} 
          Length = 465

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 6/78 (7%)

Query: 32  LKVLLDDVKSNLNDYVALAF-TPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVDF 90
           L+V + D+++N+  Y++L   +PD  V     P  V      +      +YTT ++ V  
Sbjct: 32  LQVYMTDIRNNIAQYMSLQKESPDQSV-----PPAVTKAMMDMMLHPTAAYTTHFSTVPL 86

Query: 91  DGVSSLMTKLPWYQSRLE 108
             +  ++T +PW+ +RL+
Sbjct: 87  SEIEFIITGVPWFTTRLK 104

>KNAG0B06980 Chr2 (1389595..1391592) [1998 bp, 665 aa] {ON} 
          Length = 665

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 3/81 (3%)

Query: 31  ELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVDF 90
           EL V + D+ +N+  Y  L F   +       PA    V  A+    +  + TL   +D 
Sbjct: 236 ELAVYVKDINANMQQY--LNFQ-QANPGQPHPPAIAQAVMHAMMGQPESEFMTLLTGIDP 292

Query: 91  DGVSSLMTKLPWYQSRLEAPL 111
             V  +++ +PWY +RLE  L
Sbjct: 293 ATVQMMLSGVPWYSTRLEQAL 313

 Score = 35.8 bits (81), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 4/83 (4%)

Query: 25  TTTEIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTL 84
           T  EI EL V ++D+ SN+  Y+    T       D++   V+     +F + +  +   
Sbjct: 28  TVKEI-ELAVYVNDIYSNMMQYLNFRSTHKDQPYPDSVQQAVM---ARMFGSPESKWLGQ 83

Query: 85  YANVDFDGVSSLMTKLPWYQSRL 107
              + +  VS +MT +PWY +RL
Sbjct: 84  LTTIPYATVSMMMTGVPWYSTRL 106

>KAFR0B07040 Chr2 complement(1464938..1465750) [813 bp, 270 aa] {ON}
           
          Length = 270

 Score = 37.4 bits (85), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 5/75 (6%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           +IA+L++ + + K+N   Y+    T D       +P G+ ++       +DD YTTL++N
Sbjct: 28  DIAQLELAVSEYKANAASYMMWGLTADY-----PMPDGLANIFLTAVHYTDDFYTTLFSN 82

Query: 88  VDFDGVSSLMTKLPW 102
           +    + ++   LPW
Sbjct: 83  IAMSDMQAIAEALPW 97

>KNAG0E01130 Chr5 complement(220233..220631) [399 bp, 132 aa] {ON} 
          Length = 132

 Score = 35.4 bits (80), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 9/86 (10%)

Query: 31  ELKVLLDDVKSNLNDYVAL-AFTPDSGVSLDTLPAGVLD--VGKALFTASDDSYTTLYAN 87
           EL V ++D+  NL +Y A  A  P+          G+++  V + +       +      
Sbjct: 39  ELGVYVNDITKNLMEYYAFRAEHPEQAYP------GIIETAVFEDMMGQPQSEWINQLTT 92

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPLQS 113
           +D++ V S+ T +PWY  RL   L S
Sbjct: 93  IDYNEVQSMFTGVPWYSDRLAPALSS 118

>Skud_74.1 Chr74 (3..218) [216 bp, 71 aa] {OFF} YPL282C (HSP)
          Length = 71

 Score = 33.9 bits (76), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 67  LDVGKALFTASDDSYTTLYANVDFDGVSSLMTKLPWYQSRLEAPLQS 113
           ++V +A+F   D  +TT+   +  D V+ ++T +PWY +RL   + S
Sbjct: 14  VEVAQAVFNYGD--FTTMLTGIAPDQVTRMITGVPWYSTRLRPAISS 58

>Skud_12.43 Chr12 (86079..86291) [213 bp, 70 aa] {ON} YLL025W (REAL)
          Length = 70

 Score = 33.9 bits (76), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 67  LDVGKALFTASDDSYTTLYANVDFDGVSSLMTKLPWYQSRLEAPLQS 113
           +++ +A+F   D  +TT+   +  D V+ ++T +PWY +RL   + S
Sbjct: 13  VEIAEAVFNYGD--FTTMLTGIPADQVTRVITGVPWYTTRLRPAISS 57

>YJR151C Chr10 complement(712255..715740) [3486 bp, 1161 aa] {ON}
           DAN4Cell wall mannoprotein with similarity to Tir1p,
           Tir2p, Tir3p, and Tir4p; expressed under anaerobic
           conditions, completely repressed during aerobic growth
          Length = 1161

 Score = 35.8 bits (81), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 43/83 (51%), Gaps = 9/83 (10%)

Query: 31  ELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVDF 90
           EL V + D+++++  Y +      +    +T P+   ++  A+F   D  +TT    +  
Sbjct: 37  ELAVYVSDIRAHIFQYYSF----RNHHKTETYPS---EIAAAVFDYGD--FTTRLTGISG 87

Query: 91  DGVSSLMTKLPWYQSRLEAPLQS 113
           D V+ ++T +PWY +RL+  + S
Sbjct: 88  DEVTRMITGVPWYSTRLKPAISS 110

>KNAG0M00110 Chr13 complement(11044..11826) [783 bp, 260 aa] {ON} 
          Length = 260

 Score = 32.3 bits (72), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 2/86 (2%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYAN 87
           ++ EL V + D+ +NL  Y +             +   V+D  +A     +  + TL ++
Sbjct: 31  KMVELGVYVMDIANNLPQYYSFQGANPGEKYPPVIETAVID--QAFNGVPESQWITLLSD 88

Query: 88  VDFDGVSSLMTKLPWYQSRLEAPLQS 113
           +D   V  ++T +PWY SR+   L +
Sbjct: 89  IDEADVQRMLTGVPWYSSRIAPALSA 114

>NCAS0B00350 Chr2 complement(43786..45075) [1290 bp, 429 aa] {ON} 
          Length = 429

 Score = 32.0 bits (71), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 4/79 (5%)

Query: 31  ELKVLLDDVKSNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYTTLYANVDF 90
           EL V + D+ +  +DY+++     +      +P  VL    A        +TTL++ +  
Sbjct: 3   ELMVYVKDIVAYRDDYLSMQKANPAMPYPAEMPRAVL----AAIMGDKSKFTTLFSTIPA 58

Query: 91  DGVSSLMTKLPWYQSRLEA 109
             V  ++T +PWY +RL +
Sbjct: 59  TEVDFMVTGVPWYSTRLSS 77

>KNAG0I02500 Chr9 complement(483170..486460) [3291 bp, 1096 aa] {ON}
           
          Length = 1096

 Score = 29.3 bits (64), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 11/88 (12%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDT---LPAGVLDVGKALF-TASDDSYTT 83
           +  EL V  +D+  + ++Y       DS   L T    P  V      +  T S+ +++ 
Sbjct: 734 QAVELSVYANDIAHHQSEY-------DSYNELRTSMRYPQAVASAASDIAATRSEPNWSN 786

Query: 84  LYANVDFDGVSSLMTKLPWYQSRLEAPL 111
           +   VD   V  L++ +PWY +RL+  L
Sbjct: 787 IVTMVDTVSVCGLISGVPWYSTRLQQSL 814

>KNAG0I02620 Chr9 (505371..508961) [3591 bp, 1196 aa] {ON} 
          Length = 1196

 Score = 29.3 bits (64), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 11/88 (12%)

Query: 28  EIAELKVLLDDVKSNLNDYVALAFTPDSGVSLDT---LPAGVLDVGKALF-TASDDSYTT 83
           +  EL V  +D+  + ++Y       DS   L T    P  V      +  T S+ +++ 
Sbjct: 709 QAVELSVYANDIAHHQSEY-------DSYNELRTSMRYPQAVASAASDIAATRSEPNWSN 761

Query: 84  LYANVDFDGVSSLMTKLPWYQSRLEAPL 111
           +   VD   V  L++ +PWY +RL+  L
Sbjct: 762 IVTMVDTVSVCGLISGVPWYSTRLQQSL 789

>NCAS0A00140 Chr1 complement(7200..10586) [3387 bp, 1128 aa] {ON} 
          Length = 1128

 Score = 28.1 bits (61), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 2/42 (4%)

Query: 41  SNLNDYVALAFTPDSGVSLDTLPAGVLDVGKALFTASDDSYT 82
           +N +DY AL F  DSG      P G++D+      A   SYT
Sbjct: 855 TNSDDYAALFF--DSGTYFQCCPGGIVDIPSVSTNAIFQSYT 894

>Kwal_33.14475 s33 (689067..689564) [498 bp, 165 aa] {OFF} [contig
           103] FULL
          Length = 165

 Score = 27.3 bits (59), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 3/57 (5%)

Query: 59  LDTLPAGVLDVGKALFTASDDSYTTLYANVDFD--GVSSLMTKLPW-YQSRLEAPLQ 112
           L T+P+G   V  +L      S   L AN+ FD   +  +M K PW + ++   PL 
Sbjct: 82  LFTIPSGCTVVWYSLLVLHSPSTINLNANLSFDVCAIGIVMAKSPWGFFTKGRLPLH 138

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,127,097
Number of extensions: 371612
Number of successful extensions: 1022
Number of sequences better than 10.0: 166
Number of HSP's gapped: 981
Number of HSP's successfully gapped: 170
Length of query: 118
Length of database: 53,481,399
Length adjustment: 87
Effective length of query: 31
Effective length of database: 43,505,457
Effective search space: 1348669167
Effective search space used: 1348669167
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)