Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0J013608.263ON50150127020.0
NCAS0B038408.263ON49749019420.0
KNAG0M012108.263ON52148917610.0
KLLA0F19162g8.263ON52848717440.0
KAFR0B055308.263ON51449317400.0
TDEL0F039008.263ON55949117350.0
NDAI0B019908.263ON58848917300.0
Skud_12.1578.263ON59249717240.0
SAKL0H17006g8.263ON53149217100.0
YLR089C (ALT1)8.263ON59249717150.0
KAFR0B05520singletonON51049517040.0
KNAG0G020408.263ON59149117100.0
Smik_12.1488.263ON59249717060.0
NCAS0B050208.263ON56849016970.0
ZYRO0C01628g8.263ON53448616930.0
Suva_10.1738.263ON59249716880.0
YDR111C (ALT2)8.263ON50749016430.0
Skud_4.3728.263ON50749516360.0
TPHA0A018008.263ON49849016290.0
Kpol_392.58.263ON51249016290.0
Smik_4.3578.263ON50749016250.0
CAGL0L12254g8.263ON57448816310.0
Suva_2.2718.263ON50750716210.0
Kpol_543.398.263ON49249116190.0
KAFR0B027308.263ON53948916220.0
TPHA0J007508.263ON52250015790.0
KLTH0G13662g8.263ON51949915630.0
TBLA0E044408.263ON56248515570.0
Ecym_43078.263ON53448815500.0
Kwal_56.237918.263ON51847915380.0
TBLA0G01630singletonON50050015340.0
TBLA0F030608.263ON50049715160.0
AGR085W8.263ON52149214430.0
Kwal_34.160181.472ON3791671703e-12
KLTH0G19646g1.472ON3791851445e-09
NCAS0A092001.321ON4454001421e-08
CAGL0J05126g1.321ON4334051392e-08
KNAG0B053201.321ON4333591392e-08
Suva_6.1361.321ON4443971374e-08
Smik_10.1801.321ON4443971374e-08
SAKL0D11528g1.472ON3831531339e-08
Kpol_1035.231.321ON4443981322e-07
TPHA0O014501.321ON4433961312e-07
Skud_10.1561.321ON4603291312e-07
AEL170C1.321ON4582611303e-07
SAKL0D06886g1.321ON4473401294e-07
YJL060W (BNA3)1.321ON4442601251e-06
NDAI0G057601.321ON4484001232e-06
NCAS0G040501.472ON3841531213e-06
Ecym_62921.321ON4303401214e-06
KLLA0F10021g3.511ON4973551214e-06
ZYRO0G20636g1.321ON4533961197e-06
TDEL0D019001.321ON4433951189e-06
KLTH0H10648g1.321ON4434031171e-05
Ecym_6319singletonON3542121161e-05
KLLA0F01617g1.321ON4443621152e-05
KAFR0A017101.321ON4353951143e-05
Kwal_14.25741.321ON4432031143e-05
SAKL0F02156g3.511ON4981891133e-05
KNAG0G005501.472ON3871531124e-05
Kpol_480.11.472ON3801541108e-05
Kwal_47.189823.511ON4961891054e-04
KNAG0B006603.511ON4963291000.001
KLTH0G02002g3.511ON496241990.002
Kpol_278.23.511ON498326980.002
TPHA0F012602.252ON392153970.003
KLLA0F03509g2.252ON387177950.004
KLTH0G09614g2.252ON389179930.008
KLTH0E07678gna 1ON492125920.011
KAFR0D014203.511ON492272920.012
KLTH0G19624gsingletonON46832920.013
KLTH0B00176g8.204ON44832920.013
TDEL0D057903.511ON497112900.021
TBLA0B080808.204ON444181890.025
Kwal_47.17462na 1ON492124890.027
SAKL0E08492g2.252ON384175890.028
SAKL0H21824gna 1ON499135890.028
NDAI0B045502.102ON565164880.034
Kwal_8.5858.204ON44644880.035
TPHA0D033703.511ON497123880.040
TDEL0A016008.204ON47532870.050
NCAS0E006703.511ON497193870.051
AFR548C3.511ON497188860.061
Kwal_23.48882.252ON389150850.074
TDEL0C040902.252ON383144840.089
NDAI0I028303.511ON500328850.093
KLLA0A04906gna 1ON480124820.19
Smik_7.693.511ON500336820.20
TDEL0A025102.475ON426177800.29
TPHA0O015202.102ON50349800.33
Smik_5.3198.204ON44354800.33
YGL202W (ARO8)3.511ON500337790.38
CAGL0G01254g3.511ON50444790.40
ZYRO0C06028g3.511ON496112790.44
Kpol_431.132.475ON443312790.46
Suva_7.613.511ON500121790.46
Ecym_32902.252ON386102780.46
Suva_5.2818.204ON45055780.51
ZYRO0A01672g2.252ON386133780.52
Kpol_1039.222.252ON386147780.59
Ecym_7228na 1ON488125780.60
YIL116W (HIS5)2.252ON385154770.64
Ecym_55428.204ON446113770.76
TBLA0B009902.102ON54644770.85
CAGL0C01243g2.252ON383154760.86
Skud_7.693.511ON500264760.89
YER152C8.204ON44354760.90
KAFR0J015802.252ON383149760.97
Kpol_1035.302.102ON50144761.00
KNAG0E018502.252ON384149751.2
KLLA0E00969g8.204ON44561741.8
NCAS0B072202.102ON51044741.9
KAFR0B023808.204ON44367732.0
CAGL0I06578g8.204ON43652732.0
Kpol_1032.398.204ON453190732.3
KNAG0G016808.204ON45234732.4
ADL249W2.252ON387154732.4
KLTH0B06270g2.102ON52544732.4
NCAS0B064402.252ON385185722.7
Skud_5.2908.204ON44354723.4
NCAS0A038308.204ON446108705.1
AGR141C8.204ON438101705.4
KAFR0D031602.475ON435196705.7
KAFR0I009104.78ON61167706.1
KAFR0B068304.354ON667127706.2
NDAI0B037302.252ON386154696.7
Ecym_51258.453ON56564697.9
NDAI0C059608.204ON47851688.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0J01360
         (501 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....  1045   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   752   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   682   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   676   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            674   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   672   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   671   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   668   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   663   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   665   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   660   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   663   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   661   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   658   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   656   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   654   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   637   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   634   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   632   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   632   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   630   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   632   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   629   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   628   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   629   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   612   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   606   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   604   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   601   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   597   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              595   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   588   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   560   0.0  
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    70   3e-12
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    60   5e-09
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    59   1e-08
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    58   2e-08
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    58   2e-08
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    57   4e-08
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    57   4e-08
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    56   9e-08
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    55   2e-07
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    55   2e-07
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    55   2e-07
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    55   3e-07
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    54   4e-07
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    53   1e-06
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    52   2e-06
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    51   3e-06
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    51   4e-06
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    51   4e-06
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    50   7e-06
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    50   9e-06
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    50   1e-05
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    49   1e-05
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    49   2e-05
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    49   3e-05
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    49   3e-05
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    48   3e-05
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       48   4e-05
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    47   8e-05
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    45   4e-04
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    43   0.001
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    43   0.002
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    42   0.002
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    42   0.003
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    41   0.004
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    40   0.008
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    40   0.011
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    40   0.012
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    40   0.013
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    40   0.013
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    39   0.021
TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa] ...    39   0.025
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    39   0.027
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    39   0.028
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    39   0.028
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    39   0.034
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    39   0.035
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    39   0.040
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    38   0.050
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     38   0.051
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    38   0.061
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    37   0.074
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    37   0.089
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    37   0.093
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    36   0.19 
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    36   0.20 
TDEL0A02510 Chr1 (449069..450349) [1281 bp, 426 aa] {ON} Anc_2.4...    35   0.29 
TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2....    35   0.33 
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    35   0.33 
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    35   0.38 
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    35   0.40 
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    35   0.44 
Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,...    35   0.46 
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    35   0.46 
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    35   0.46 
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    35   0.51 
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    35   0.52 
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    35   0.59 
Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar t...    35   0.60 
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    34   0.64 
Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar...    34   0.76 
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    34   0.85 
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    34   0.86 
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    34   0.89 
YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON} P...    34   0.90 
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    34   0.97 
Kpol_1035.30 s1035 (69909..71414) [1506 bp, 501 aa] {ON} (69909....    34   1.00 
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    33   1.2  
KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} simila...    33   1.8  
NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON} Anc_2...    33   1.9  
KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {O...    33   2.0  
CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} simila...    33   2.0  
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    33   2.3  
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    33   2.4  
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    33   2.4  
KLTH0B06270g Chr2 (508642..510219) [1578 bp, 525 aa] {ON} simila...    33   2.4  
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    32   2.7  
Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON...    32   3.4  
NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204     32   5.1  
AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}...    32   5.4  
KAFR0D03160 Chr4 (618891..620198) [1308 bp, 435 aa] {ON} Anc_2.4...    32   5.7  
KAFR0I00910 Chr9 (178296..180131) [1836 bp, 611 aa] {ON} Anc_4.7...    32   6.1  
KAFR0B06830 Chr2 complement(1421910..1423913) [2004 bp, 667 aa] ...    32   6.2  
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    31   6.7  
Ecym_5125 Chr5 complement(266853..268550) [1698 bp, 565 aa] {ON}...    31   7.9  
NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa] ...    31   8.8  

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score = 1045 bits (2702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/501 (100%), Positives = 501/501 (100%)

Query: 1   MATHTIQTDLHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFN 60
           MATHTIQTDLHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFN
Sbjct: 1   MATHTIQTDLHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFN 60

Query: 61  EITVANIGNPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLL 120
           EITVANIGNPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLL
Sbjct: 61  EITVANIGNPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLL 120

Query: 121 NEIGGSVGAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSN 180
           NEIGGSVGAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSN
Sbjct: 121 NEIGGSVGAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSN 180

Query: 181 GPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQP 240
           GPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQP
Sbjct: 181 GPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQP 240

Query: 241 KVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRS 300
           KVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRS
Sbjct: 241 KVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRS 300

Query: 301 LQKQFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVV 360
           LQKQFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVV
Sbjct: 301 LQKQFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVV 360

Query: 361 TGQAMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAM 420
           TGQAMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAM
Sbjct: 361 TGQAMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAM 420

Query: 421 YLFPRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLA 480
           YLFPRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLA
Sbjct: 421 YLFPRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLA 480

Query: 481 PGDQWINKWEKFHKAFLKRYT 501
           PGDQWINKWEKFHKAFLKRYT
Sbjct: 481 PGDQWINKWEKFHKAFLKRYT 501

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  752 bits (1942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/490 (70%), Positives = 424/490 (86%), Gaps = 3/490 (0%)

Query: 11  HDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNP 70
           +DF+PAPKLS+KD+N NV+ A+FA+RG+I +KA++LQ QLNKNPH LPF+EITVANIGNP
Sbjct: 9   NDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNP 68

Query: 71  QELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAY 130
           QEL+QKPLTFARQVVSILQYPELLN R+ LT     I+N+DSFDRAE+LL +IGGSVGAY
Sbjct: 69  QELNQKPLTFARQVVSILQYPELLNNRDVLTKEK--IFNSDSFDRAERLLRDIGGSVGAY 126

Query: 131 SASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPI 190
           SASQGVYGIRKT A YIT+RD GE + P DIF+TTGAT+A+SYLLS+L  GPQTGVL+PI
Sbjct: 127 SASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPI 186

Query: 191 PQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGN 250
           PQYPLYTA LAL+ +TM+PYYL+EES WS +T EIEK +  +++ KGI+P V+V+INPGN
Sbjct: 187 PQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVL-DSIKKGIKPSVIVVINPGN 245

Query: 251 PTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYN 310
           PTG++LSE ++ KIF IAAKYGIV++ADEVYQEN+F+G +FHS KKVLR LQKQ+P +++
Sbjct: 246 PTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFD 305

Query: 311 NVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMI 370
           N+QLAS+HSTSKG+FGECGQRGGYME++GF ++VR L+LKLAC+ VC VVTGQAM+DLM+
Sbjct: 306 NIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLML 365

Query: 371 LPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLST 430
           LPPK+GD SY+LD  ERQ+I + M  RA+KLY MF  ++GI+CQKPQGAMYL+P L+LS 
Sbjct: 366 LPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSK 425

Query: 431 KVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWE 490
           K I +A+   + PDEFYCHELL+ TGICTVPGSGFGQK  TYHLRTTFLAPG +WINKWE
Sbjct: 426 KAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWE 485

Query: 491 KFHKAFLKRY 500
           KFHK F ++Y
Sbjct: 486 KFHKHFYEKY 495

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/489 (64%), Positives = 395/489 (80%), Gaps = 4/489 (0%)

Query: 13  FEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQE 72
           FEPA KL   DLN N+I AE+AVRG IPMKA+EL+ QL++ P  LPFN ITVANIGNPQ+
Sbjct: 34  FEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQ 93

Query: 73  LHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSA 132
           L QKPLTF+RQVVSILQYP LL+   +L   T   Y  D+F RA  LL +IGGSVGAYS 
Sbjct: 94  LDQKPLTFSRQVVSILQYPPLLDYEEQLV--TSGAYKRDAFKRAAVLLEQIGGSVGAYSL 151

Query: 133 SQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIPQ 192
           +QGVYGIR+++A++IT+RD GE+ASP+DIF+T GA+ A++YLLSIL     TG+++PIPQ
Sbjct: 152 AQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQ 211

Query: 193 YPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPT 252
           YPLYTA + ++N+ MLPYYL+EESGWS    EIE+ +  +++ +G+ P+V+V+INPGNPT
Sbjct: 212 YPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVI-DSIKRGVTPRVIVVINPGNPT 270

Query: 253 GSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPT-QYNN 311
           G++LS D++ +I  IAAKYGIV++ADEVYQ N++ G KFHS KKVLRSLQ+  P  +Y+N
Sbjct: 271 GAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDN 330

Query: 312 VQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMIL 371
           VQLAS+HSTSKG+ GECGQRGGYME++GF+N+VR +ILKLA I +C VVTGQA++DLM+ 
Sbjct: 331 VQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLN 390

Query: 372 PPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTK 431
           PP++GD SY+LD  ER++IHN+M  R   LYD F  +EGI+CQ+PQGAMYLFP+LLLS K
Sbjct: 391 PPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKK 450

Query: 432 VIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWEK 491
            I+EAK   ++PDEFYCH LL+ TGICTVPGSGFGQK  TYH+RTTFLAPG QWI  WE 
Sbjct: 451 AIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWET 510

Query: 492 FHKAFLKRY 500
           FHKAF  +Y
Sbjct: 511 FHKAFYDKY 519

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/487 (64%), Positives = 395/487 (81%), Gaps = 4/487 (0%)

Query: 14  EPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQEL 73
           +PAPKLS+ D+N NV+KA++AVRG IPM+A+EL+ QL K+P SLPF++I  ANIGNPQ+L
Sbjct: 44  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQL 103

Query: 74  HQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSAS 133
            QKPLTF R+V+S+LQ+PELL   +E   T   +Y  DS  RA++LL+E+GGSVGAYS S
Sbjct: 104 DQKPLTFYREVLSLLQHPELLEEADEALQT---LYKTDSIKRAKRLLSEVGGSVGAYSQS 160

Query: 134 QGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIPQY 193
           QGV GIR+T+A++IT+RD GE + P DI++T GA+AA SY+LSIL  GP TGVL+PIPQY
Sbjct: 161 QGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQY 220

Query: 194 PLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTG 253
           PLYTA LAL+N+  LPYYL EE  WS D  EIE+ +  +A+ KGI+P  +V+INPGNPTG
Sbjct: 221 PLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVL-DAIQKGIKPTCLVVINPGNPTG 279

Query: 254 SILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQ 313
           +ILSE S+ KIF +AAKYGIV+IADEVYQEN+F G+KF+S KKVLR+LQK +  QY+N+Q
Sbjct: 280 AILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQ 339

Query: 314 LASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPP 373
           LASLHSTSKG+ GECGQRGGYME++GFN+D+R + LKLA I +CPVVTGQA++DLM+ PP
Sbjct: 340 LASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPP 399

Query: 374 KQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTKVI 433
           + GD+SY+ D  ER+ IH+ +  RA KL++ FS +EGI+C+KPQGAMYL+P+L L  KVI
Sbjct: 400 QPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVI 459

Query: 434 DEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWEKFH 493
            EA+  EMEPDEFYC  LL  TGICTVPGSGFGQ P TYHLRTTFL PG +W+  WEKFH
Sbjct: 460 QEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFH 519

Query: 494 KAFLKRY 500
           KAF  +Y
Sbjct: 520 KAFFDKY 526

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/493 (64%), Positives = 398/493 (80%), Gaps = 6/493 (1%)

Query: 10  LHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQL--NKNPHSLPFNEITVANI 67
           +H+F+PA K+++ DLN NV+K+E+AVRG+IP +A+EL+ +L  N +  SL F  I  ANI
Sbjct: 25  IHNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANI 84

Query: 68  GNPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSV 127
           GNPQ+L QKPLTF+RQV+SILQYPELLN+RN L ST   I+ +D+ +RAE LL  IGGSV
Sbjct: 85  GNPQQLDQKPLTFSRQVISILQYPELLNQRNILVSTG--IFKSDAMERAETLLCHIGGSV 142

Query: 128 GAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVL 187
           GAYS+SQGVYGIR+T+ANYIT RD GE+ASP+DIF+T GA+ A+SYLLS+L     TGVL
Sbjct: 143 GAYSSSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVL 202

Query: 188 LPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIIN 247
           +PIPQYPLYTA + L +A MLPYYL EESGWS +TNEIEK +  +A+   ++P VMV+IN
Sbjct: 203 IPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVL-DAIADNVKPSVMVVIN 261

Query: 248 PGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPT 307
           PGNPTGS+LS+D +I I NI AKYGIV+IADEVYQEN+F+G +FHS KKVLRSLQKQ+P 
Sbjct: 262 PGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPG 320

Query: 308 QYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMD 367
           +Y+ VQLASLHSTSKG+ GECGQRGGYME++GF +++R  ILKLA I +C V+TGQA++D
Sbjct: 321 KYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVD 380

Query: 368 LMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLL 427
           LM+ PPK+GD+SY+LD  ER+ IH  +  RA+KLY++F  ++G++CQKPQGAMYLFP+L 
Sbjct: 381 LMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLH 440

Query: 428 LSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWIN 487
               +I EA    M PDEFYCH LL  TGICTVPGSGFGQK  TYHLRTTFLAPG+QW  
Sbjct: 441 FPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTE 500

Query: 488 KWEKFHKAFLKRY 500
           KW+ FH+ F  +Y
Sbjct: 501 KWKLFHEEFFSKY 513

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/491 (63%), Positives = 399/491 (81%), Gaps = 4/491 (0%)

Query: 11  HDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNP 70
            DF PA  L+++DLN NV+KA++AVRG+IPM+A+ELQ QL ++P SLPF++I  ANIGNP
Sbjct: 70  QDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNP 129

Query: 71  QELHQKPLTFARQVVSILQYPELLNR-RNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGA 129
           Q+L+QKPL+F RQV+SILQYPE+L +   EL S    ++  D+ +RA+++L ++GGSVGA
Sbjct: 130 QQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKG--VFKRDAIERAKRILRDVGGSVGA 187

Query: 130 YSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLP 189
           YS+SQGVYGIRKT+A++IT+RD GE A P DIF+T GA+AA SYLLSIL  G +TGVL+P
Sbjct: 188 YSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIP 247

Query: 190 IPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPG 249
           IPQYPLYTA LAL+N+ +LPYYL+EESGWS +T EIE  + + ++  GI+P V+V+INPG
Sbjct: 248 IPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTE-SIESGIRPSVLVVINPG 306

Query: 250 NPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQY 309
           NPTGS+LS +++ KIF +AAKYGIV+IADEVYQEN+F G++FHS KKVLR LQK+ P  Y
Sbjct: 307 NPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIY 366

Query: 310 NNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLM 369
           +NVQL SLHSTSKG+ GECGQRGGYME+ GF +++R ++LKLA I +CPVVTGQA++DLM
Sbjct: 367 DNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLM 426

Query: 370 ILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLS 429
           + PPK GD+SY+ D  ER+ IH ++ +RA  L+D F+ +EGI+CQKP+GAMYLFP++ L 
Sbjct: 427 VCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLP 486

Query: 430 TKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKW 489
            K I  A+  E  PDEFYC +LL  TGICTVPGSGFGQ+P TYHLRTTFLAPG +WI KW
Sbjct: 487 YKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKW 546

Query: 490 EKFHKAFLKRY 500
           E FHK F  +Y
Sbjct: 547 EDFHKKFYDQY 557

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/489 (64%), Positives = 391/489 (79%), Gaps = 2/489 (0%)

Query: 12  DFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQ 71
           DF PA +L++ DLN NV+KA++AVRG+IPM+A+EL+ QL  NP +LPF++I  ANIGNPQ
Sbjct: 100 DFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQ 159

Query: 72  ELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYS 131
           +L QKPL+F RQV+SILQYP++L + NE       +Y  D+ DRA+ LL+EIGGSVGAYS
Sbjct: 160 QLKQKPLSFYRQVLSILQYPDIL-KENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYS 218

Query: 132 ASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIP 191
           ASQGVYGIRKT+AN+IT+RD GE A P DIF+T        YLLSIL  GP+TGVL+PIP
Sbjct: 219 ASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIP 278

Query: 192 QYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNP 251
           QYPLYTA LAL+N+  LPYYL+E+SGWS +  EIE+ ++ +AM + I P V+V+INPGNP
Sbjct: 279 QYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQ-DAMERAINPSVLVVINPGNP 337

Query: 252 TGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNN 311
           TG++L+E+S+  IF IAAKYGIV+IADEVYQEN+ +G KF+S KKVLR LQK  P +++N
Sbjct: 338 TGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDN 397

Query: 312 VQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMIL 371
           VQLASLHSTSKG+ GECGQRGGYME+IGF ++VR +ILKLA I +CPVVTGQA++DLM+ 
Sbjct: 398 VQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVS 457

Query: 372 PPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTK 431
           PPK+GD SY+ D  ER+ I +++  RA +LY+ F  +EGI+CQKPQGAMYLFP+L L  K
Sbjct: 458 PPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFK 517

Query: 432 VIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWEK 491
            + EA+  EM PDEFYC  LL+ TGICTVPGSGFGQ+P TYHLRTTFLAPG +WI KWE 
Sbjct: 518 AVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEA 577

Query: 492 FHKAFLKRY 500
           FHK F   Y
Sbjct: 578 FHKEFYDNY 586

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/497 (61%), Positives = 399/497 (80%), Gaps = 2/497 (0%)

Query: 4   HTIQTDLHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEIT 63
           HT++T   DF PA +L+++D+N NV+KA++AVRG IPM+A+EL+ QL K+P SLPF++I 
Sbjct: 96  HTLKTGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKII 155

Query: 64  VANIGNPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEI 123
            ANIGNPQ+L QKPLT+ RQV+S+LQYPELLN+ NE       ++  D+  RA+ L+ +I
Sbjct: 156 NANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQ-NEQQLVDSKLFKLDAIKRAKSLMEDI 214

Query: 124 GGSVGAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQ 183
           GGSVGAYS+SQGV GIRK++A +IT+RD GE + P DIF+T GA+AA +YLLSI   GP+
Sbjct: 215 GGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPE 274

Query: 184 TGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVM 243
           TGVL+PIPQYPLYTA LAL+N+  LPYYL+E+SGWS +  EIE T+ K A+   I+P V+
Sbjct: 275 TGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIE-TVVKEAIQNEIKPTVL 333

Query: 244 VIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQK 303
           V+INPGNPTG++LS +S+ +IF +AAKYG V+IADEVYQEN+F G KFHS KK+LR+LQ+
Sbjct: 334 VVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQR 393

Query: 304 QFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQ 363
           + P +++NVQLASLHSTSKG+ GECGQRGGYME+ GF++++R +ILKLA I +CPVVTGQ
Sbjct: 394 EHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ 453

Query: 364 AMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLF 423
           A++DLM+ PP +G++S++LD  ER  IH  ++ RA  LYD F+ +EGI+CQKPQGAMYLF
Sbjct: 454 ALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLF 513

Query: 424 PRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGD 483
           P++ L  K + EA+  E+ PDEFYC  LL  TGICTVPGSGFGQ+P TYHLRTTFLAPG 
Sbjct: 514 PKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGL 573

Query: 484 QWINKWEKFHKAFLKRY 500
           +WI KWE FHK F  +Y
Sbjct: 574 EWIKKWETFHKEFFDQY 590

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/492 (63%), Positives = 391/492 (79%), Gaps = 7/492 (1%)

Query: 11  HDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNP 70
           + F+PA KLS++DLN NV++A++AVRG IP KA+EL+ QL ++P SLPF+ I  ANIGNP
Sbjct: 43  YKFQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNP 102

Query: 71  QELHQKPLTFARQVVSILQYPELLNR--RNELTSTTPPIYNNDSFDRAEKLLNEIGGSVG 128
           Q+L QKPLTF RQV+S+LQ P++L    R +L+     IY  D+ DRA +LL+ IGGSVG
Sbjct: 103 QQLDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQ----IYKPDAIDRAARLLSNIGGSVG 158

Query: 129 AYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLL 188
           AYS SQGVYG RKT+A++IT+RD GE A   DIF+T GA+AA SY+LSIL  GPQTGVL+
Sbjct: 159 AYSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLI 218

Query: 189 PIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINP 248
           PIPQYPLYTA LAL+N+  LPYYL+EES WS +  EIEK +  N++ KG++PK +V+INP
Sbjct: 219 PIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVT-NSIAKGVEPKCLVVINP 277

Query: 249 GNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQ 308
           GNPTG+ILS +S+ KIF +AAKYGIV+IADEVYQEN+FNG +FHS +KVL+ LQ++   +
Sbjct: 278 GNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGK 337

Query: 309 YNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDL 368
           ++N+QLASLHSTSKG+ GECGQRGGYME++GF++DVR + LKLA I +CPVVTGQA++DL
Sbjct: 338 FDNIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDL 397

Query: 369 MILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLL 428
           M+ PPK GD SY+ D  ER +IH+ +  RA  LY+ F+ +EGI+CQKPQGAMYLFPRL L
Sbjct: 398 MVCPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDL 457

Query: 429 STKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINK 488
           S K + +A+   + PDEFYC ELL  TGICTVPGSGFGQ P TYHLRTTFLAPG  WI  
Sbjct: 458 SYKAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKA 517

Query: 489 WEKFHKAFLKRY 500
           WE+FHK F   Y
Sbjct: 518 WEEFHKKFYNEY 529

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/497 (61%), Positives = 397/497 (79%), Gaps = 2/497 (0%)

Query: 4   HTIQTDLHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEIT 63
           HT++T  ++F PA +L+++D+N NV+KA++AVRG IPM+A+EL+ QL K+P SLPF+ I 
Sbjct: 96  HTLKTSNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRII 155

Query: 64  VANIGNPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEI 123
            ANIGNPQ+L QKPLT+ RQV+S+LQYPELLN+ NE       ++  D+  RA+ L+ +I
Sbjct: 156 NANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQ-NEQQLVDSKLFKLDAIKRAKSLMEDI 214

Query: 124 GGSVGAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQ 183
           GGSVGAYS+SQGV GIRK++A +IT+RD GE + P DIF+T GA+AA +YLLSI   GP+
Sbjct: 215 GGSVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPE 274

Query: 184 TGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVM 243
           TGVL+PIPQYPLYTA LAL+N+  LPYYL+E SGWS +  EIE T+ K A+   I+P V+
Sbjct: 275 TGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIE-TVVKEAIQNEIKPTVL 333

Query: 244 VIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQK 303
           V+INPGNPTG++LS +S+ +IF +AAKYG V+IADEVYQEN+F G KFHS KK+LR LQ+
Sbjct: 334 VVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQR 393

Query: 304 QFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQ 363
           + P +++NVQLASLHSTSKG+ GECGQRGGYME+ GF++++R +ILKLA I +CPVVTGQ
Sbjct: 394 EHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ 453

Query: 364 AMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLF 423
           A++DLM+ PP +G++S++ D  ER  IH  ++ RA  LY+ F+ +EGI+CQKPQGAMYLF
Sbjct: 454 ALVDLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLF 513

Query: 424 PRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGD 483
           P++ L  K + EA+  E+ PDEFYC +LL  TGICTVPGSGFGQ+P TYHLRTTFLAPG 
Sbjct: 514 PKIDLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGL 573

Query: 484 QWINKWEKFHKAFLKRY 500
           +WI KWE FHK F  +Y
Sbjct: 574 EWIKKWESFHKEFFDQY 590

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/495 (61%), Positives = 395/495 (79%), Gaps = 6/495 (1%)

Query: 8   TDLHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQL--NKNPHSLPFNEITVA 65
           ++ HDFEPAPK+S+ DLN  +I AE+AVRG+I M+A+EL+ +L     PHS PF  I  A
Sbjct: 19  SNTHDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYA 78

Query: 66  NIGNPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGG 125
           NIGNPQ+L QKPLTF+RQV+SIL+YP LL  ++ L S    IY  D+ +RAE L ++IG 
Sbjct: 79  NIGNPQQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQG--IYKKDALERAELLQSQIGA 136

Query: 126 SVGAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTG 185
           SVGAYS +QGVYGIR+T A +I++RD  E+AS +DIF+T GA+ A +YL+  L     TG
Sbjct: 137 SVGAYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTG 196

Query: 186 VLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVI 245
           +L+PIPQYPLYTA + +HNA MLPYYL+EESGWS    EIE ++  NA+  GI+P  MV+
Sbjct: 197 ILIPIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVI-NAIENGIKPSAMVV 255

Query: 246 INPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQF 305
           INPGNPTG++LS D + +I  +AAKYGIV+IADEVYQ+N+FNG +FHS KK+LR LQK++
Sbjct: 256 INPGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKY 314

Query: 306 PTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAM 365
           P +Y+NVQLASLHSTSKG+ GECGQRGGYMEI+GF+++VR+L+LKLA I++C VVTGQA+
Sbjct: 315 PGKYDNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQAL 374

Query: 366 MDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPR 425
           +DLM+ PP  GD+SY+ D  ER +IH+ +  RA KLYD FS++EGI+CQKPQGAMYLFPR
Sbjct: 375 VDLMVDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPR 434

Query: 426 LLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQW 485
           L+L  + I+EAKK +ME DEFYCH+LL  TGICTVPGSGFGQ+  TYH+RTTFL+PG +W
Sbjct: 435 LILPDRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEW 494

Query: 486 INKWEKFHKAFLKRY 500
           I+ W+KFH+ F+K Y
Sbjct: 495 IDDWKKFHEKFMKEY 509

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/491 (62%), Positives = 396/491 (80%), Gaps = 2/491 (0%)

Query: 11  HDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNP 70
           + F PA ++ I DLN NV+KA++AVRG+IPM+A++LQ QL ++P SLPF++I  ANIGNP
Sbjct: 100 YKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNP 159

Query: 71  QELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAY 130
           Q+L+QKPL+F RQV+S+LQ+PELLN   E  +    +Y  D+  RAEKLL +IGGSVGAY
Sbjct: 160 QQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAY 219

Query: 131 SASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPI 190
           S SQGV GIRKT+A++IT+RD  E A P DIF+T GA+AA SYLLSI   G +TGVL+PI
Sbjct: 220 STSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPI 279

Query: 191 PQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGN 250
           PQYPLYTA LAL+N+  LPYYL+E+SGWS +T EI+  +  +A+ + I+P V+V+INPGN
Sbjct: 280 PQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVL-DAIDRNIKPSVLVVINPGN 338

Query: 251 PTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGN-KFHSCKKVLRSLQKQFPTQY 309
           PTG++LSE ++ +IF IAAKYGIV+IADEVYQEN+F+ + KFHS KKVLR LQ++ P ++
Sbjct: 339 PTGAVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKF 398

Query: 310 NNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLM 369
           + VQLASLHSTSKG+ GECGQRGG+ME+ GF++++R +ILKLA I +CPVVTGQA++DLM
Sbjct: 399 DEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLM 458

Query: 370 ILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLS 429
           + PP++G++SY+LD  ER  IH+++  RA KL++ F+ +EGIQCQKPQGAMYLFPRL L 
Sbjct: 459 VHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLP 518

Query: 430 TKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKW 489
            K + +A+  EM  DEFYC ELL  TGICTVPGSGFGQ P TYHLRTTFLAPG +WI+ W
Sbjct: 519 FKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLW 578

Query: 490 EKFHKAFLKRY 500
           EKFHK F  +Y
Sbjct: 579 EKFHKEFYNKY 589

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/497 (60%), Positives = 394/497 (79%), Gaps = 2/497 (0%)

Query: 4   HTIQTDLHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEIT 63
           HT++T  ++F PA +L++ D+N NV+KA++AVRG IPM+A+EL+ QL K+P SLPFN+I 
Sbjct: 96  HTLKTSNNEFYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKII 155

Query: 64  VANIGNPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEI 123
            ANIGNPQ+L QKPLT+ RQV+S+LQYPELLN+ NE       ++  D+  RA+ L+ EI
Sbjct: 156 NANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQ-NEQQLVDSKLFKLDAIKRAKSLMEEI 214

Query: 124 GGSVGAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQ 183
           GGSVGAYS+SQGV GIR+++A +IT+RD GE + P DIF+T GA+AA +YLLSI   GP+
Sbjct: 215 GGSVGAYSSSQGVEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPE 274

Query: 184 TGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVM 243
           TGVL+PIPQYPLYTA LAL+N+  LPYYL+E SGWS +  EIE T+ K A+   I+  V+
Sbjct: 275 TGVLIPIPQYPLYTATLALNNSQALPYYLDESSGWSTNPEEIE-TVVKEAIENEIKSTVL 333

Query: 244 VIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQK 303
           V+INPGNPTG++LS +S+ +IF +AAKYG V+IADEVYQEN+F G KFHS KK+LR LQ+
Sbjct: 334 VVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQR 393

Query: 304 QFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQ 363
           + P +++NVQLASLHSTSKG+ GECGQRGGYME+ GF++++R +ILKLA I +CPVVTGQ
Sbjct: 394 EHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ 453

Query: 364 AMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLF 423
           A++DLM+ PP +G++S++ D  ER  IH  ++ RA  LY  F+ +EGI+CQKPQGAMYLF
Sbjct: 454 ALVDLMVRPPLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLF 513

Query: 424 PRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGD 483
           P++ L  + + EA+  E+ PDEFYC +LL  TGICTVPGSGFGQ+P TYHLRTTFLAPG 
Sbjct: 514 PKIDLPFRAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGL 573

Query: 484 QWINKWEKFHKAFLKRY 500
           +WI KWE FHK F   Y
Sbjct: 574 EWIKKWETFHKEFFDHY 590

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/490 (63%), Positives = 395/490 (80%), Gaps = 2/490 (0%)

Query: 11  HDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNP 70
           ++F PA +L++ +LN NV+KA++AVRG IPM+A+EL+ QL ++P SLPF+ I  ANIGNP
Sbjct: 79  NNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNP 138

Query: 71  QELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAY 130
           Q+L+QKPL+F RQV+S+LQYPE+L +++E       ++  D+ +RA+ LL+EIGG+VGAY
Sbjct: 139 QQLNQKPLSFYRQVLSLLQYPEIL-KQDESKLVASGLFKKDALERAKTLLHEIGGTVGAY 197

Query: 131 SASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPI 190
           SASQGVYGIRKT+AN+IT+RD GE A P DIF+T GA+AA  YLLSIL  GP+TGVL+PI
Sbjct: 198 SASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPI 257

Query: 191 PQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGN 250
           PQYPLYTA LAL+N+  LPYYL+E+SGWS +  EIE+ +   A  K I+P V+V+INPGN
Sbjct: 258 PQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLA-AKDKKIRPSVLVVINPGN 316

Query: 251 PTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYN 310
           PTG++LSE S+  IF IAAKYGIV+IADEVYQEN+FN  KFHS KKVLR+LQK+ P  Y+
Sbjct: 317 PTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYD 376

Query: 311 NVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMI 370
            VQLASLHSTSKG+ GECGQRGGYME+ GF ++VR++ILKLA I +CPVVTGQA++DLM+
Sbjct: 377 MVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMV 436

Query: 371 LPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLST 430
            PPK+GD+S++ D  ER+ I +++  RA +LY  F+ +EGI+CQKPQGAMYLFPRL L  
Sbjct: 437 SPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPF 496

Query: 431 KVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWE 490
           K + +A+  EM PDEFYC  LL  TGICTVPGSGFGQ+P TYHLRTTFLAPG +WI KW+
Sbjct: 497 KAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWK 556

Query: 491 KFHKAFLKRY 500
            FH+ F   Y
Sbjct: 557 IFHQDFYNTY 566

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/486 (63%), Positives = 380/486 (78%), Gaps = 2/486 (0%)

Query: 15  PAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQELH 74
           PA KL + ++N NV+KA++AVRG IPM A EL  +L K+PHSLPF+ I  ANIGNPQ L 
Sbjct: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108

Query: 75  QKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSASQ 134
           QKPLTF RQV+S+LQYP LL   NE       +Y  D+  RA +LLN+IG SVGAYS SQ
Sbjct: 109 QKPLTFYRQVLSLLQYPGLL-EENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQ 167

Query: 135 GVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYP 194
           G+ GIR+T+A +IT+RD GE A   DIF+T GA++A SYLLSIL  G +TGVL+PIPQYP
Sbjct: 168 GIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYP 227

Query: 195 LYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGS 254
           LYTA LAL+N+  LPYYL+E+SGWS +  EIE  +  NA+ + I+P V+V+INPGNPTG+
Sbjct: 228 LYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVN-NAIEQNIKPSVLVVINPGNPTGA 286

Query: 255 ILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQL 314
           +LSE+ + +IF IAAKYGIV+IADEVYQEN+F+G +FHS KK+LR LQK  P  ++NVQL
Sbjct: 287 VLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQL 346

Query: 315 ASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPPK 374
           ASLHSTSKG+ GECGQRGGYMEI GFNND+R +ILKLA I +CPVVTGQA++DLM+ PPK
Sbjct: 347 ASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPK 406

Query: 375 QGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTKVID 434
            GD+SY+LD  ER+ IH  +  RA KL+  F+ +EGI+CQKP+GAMYLFPRLLL  K I 
Sbjct: 407 PGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQ 466

Query: 435 EAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWEKFHK 494
            A+   M PD FYC +LL  TGICTVPGSGFGQ+P TYHLRTTFLAPG +WI +WE FHK
Sbjct: 467 SAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHK 526

Query: 495 AFLKRY 500
           AF + Y
Sbjct: 527 AFYEEY 532

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/497 (61%), Positives = 394/497 (79%), Gaps = 2/497 (0%)

Query: 4   HTIQTDLHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEIT 63
           HT++T  ++F PA +L++ D+N NV+KA +AVRG IPM+A+EL+ QL K+P SLPFN+I 
Sbjct: 96  HTLKTANNEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKII 155

Query: 64  VANIGNPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEI 123
            ANIGNPQ+L QKPLT+ RQV+S+LQYPELLN  NE       ++  D+  RA+ L+ +I
Sbjct: 156 NANIGNPQQLQQKPLTYYRQVLSLLQYPELLNH-NEQELVGSKLFKIDAIKRAKSLIKDI 214

Query: 124 GGSVGAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQ 183
           GGSVGAYS+SQGV GIRK++A++IT+RD GE+A P DIF+T GA+AA +YLLSI   GP+
Sbjct: 215 GGSVGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPE 274

Query: 184 TGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVM 243
           TGVL+PIPQYPLYTA LAL+N+  LPYYL+E SGWS +  EIE T+ K A+   I+P V+
Sbjct: 275 TGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIE-TVVKEAIQNEIKPTVL 333

Query: 244 VIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQK 303
           V+INPGNPTG++LS +S+ +IF +AAKYG V+IADEVYQEN+F G +F+S KKVLR LQ+
Sbjct: 334 VVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQR 393

Query: 304 QFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQ 363
             P +++NVQLASLHSTSKG+ GECGQRGGYME+ GF++++R +ILKLA I +CPVVTGQ
Sbjct: 394 DHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ 453

Query: 364 AMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLF 423
           A++DLM+ PP +G++S++ D  ER  IH  +  RA  LY+ F+ +EGI+CQKPQGAMYLF
Sbjct: 454 ALVDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLF 513

Query: 424 PRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGD 483
           P++ +  K I EA   E+ PDEFYC +LL  TGICTVPGSGFGQ+P TYHLRTTFLAPG 
Sbjct: 514 PKIDVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGV 573

Query: 484 QWINKWEKFHKAFLKRY 500
           +W+ KWE FHK F  +Y
Sbjct: 574 EWMKKWEIFHKEFFDQY 590

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/490 (60%), Positives = 389/490 (79%), Gaps = 4/490 (0%)

Query: 12  DFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQ 71
           DF+PA K++ KDLN  V KAE+AVRG IP +A EL+ +L KNP  LPF++I  ANIGNPQ
Sbjct: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQ 78

Query: 72  ELHQKPLTFARQVVSILQYPELLN-RRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAY 130
           +L QKPLTF RQV++IL+YPE+L    NEL S    +++ D+ +RAE+LLN+IGGS+GAY
Sbjct: 79  QLDQKPLTFTRQVLAILEYPEILRVGHNELASLN--LFSRDALERAERLLNDIGGSIGAY 136

Query: 131 SASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPI 190
           S SQGV GIR+T+A++IT+RD GE A+P DI++TTGA++A++ LLS+L    QTG+L+PI
Sbjct: 137 SHSQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPI 196

Query: 191 PQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGN 250
           PQYPLYTA  +L NA +LPYYL+EES WS +++EIEK ++ +A+ K I+P V+++INPGN
Sbjct: 197 PQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQ-DALKKQIRPSVLIVINPGN 255

Query: 251 PTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYN 310
           PTG++LSE+++ +I  IAAKYGI II+DEVYQEN+FN  KFHS KKVLR LQ  +P +++
Sbjct: 256 PTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFD 315

Query: 311 NVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMI 370
           NVQLASLHS SKG   ECGQRGGYMEIIGF+ ++R+ + KL  I +C VVTGQA++DLM+
Sbjct: 316 NVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMV 375

Query: 371 LPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLST 430
            PP+ GD+SY+ D  ER +I ++M  RA  LY+ F  +EGI+CQKPQGAMYLFPRL+L  
Sbjct: 376 KPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPK 435

Query: 431 KVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWE 490
           K + E+++  +EPDEFYC  LL  TGICTVPGSGFGQ+P TYH+RTTFLAPG +WI  W+
Sbjct: 436 KALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWK 495

Query: 491 KFHKAFLKRY 500
           +FH+ F  +Y
Sbjct: 496 EFHQDFFSKY 505

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/495 (59%), Positives = 389/495 (78%), Gaps = 3/495 (0%)

Query: 6   IQTDLHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVA 65
           I  DL DF+PA K++ KDLN +V KAE+AVRG+IP +A EL+ +L KNP  LPF++I  A
Sbjct: 14  IAKDL-DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINA 72

Query: 66  NIGNPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGG 125
           NIGNPQ+L QKPLTF RQV+SIL+YPE+L   +E  ++   +++ D+  RAE LL +IGG
Sbjct: 73  NIGNPQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLN-LFSKDALKRAECLLKDIGG 131

Query: 126 SVGAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTG 185
           SVGAYS SQGV GIR+T+A++IT RD GE A+P DI++TTGA++A++ LLS+L    +TG
Sbjct: 132 SVGAYSHSQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTG 191

Query: 186 VLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVI 245
           +L+PIPQYPLYTA  +L NA +LPYYL+EE  WS +++EIEK ++ +A+ KGI+P V+++
Sbjct: 192 LLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQ-DALEKGIRPSVLIV 250

Query: 246 INPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQF 305
           INPGNPTG++L+E+++ +I  IAAKYGI +I+DEVYQEN+FN  KFHS KKVLR LQ  +
Sbjct: 251 INPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCY 310

Query: 306 PTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAM 365
           P +++NVQLASLHS SKG  GECGQRGGYMEI+GF+ D+R+ + KL  I +C VVTGQA+
Sbjct: 311 PGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAI 370

Query: 366 MDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPR 425
           +DLM+ PP+ GD+SY+ D  ER +I N+M  RA  LY+ F+ +EGI+CQ PQGAMYLFPR
Sbjct: 371 VDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPR 430

Query: 426 LLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQW 485
           L+L  K   E+++  +EPDEFYC  LL  TGICTVPGSGFGQKP TYH+RTTFLAPG QW
Sbjct: 431 LILPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQW 490

Query: 486 INKWEKFHKAFLKRY 500
           I  W+ FH++F   Y
Sbjct: 491 IQNWKNFHQSFFNEY 505

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/490 (59%), Positives = 378/490 (77%), Gaps = 2/490 (0%)

Query: 12  DFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQ 71
           DF P  K+++KDLN  +IK ++AVRG IP +A+EL+ QL K+P SLPFN+I  ANIGNPQ
Sbjct: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67

Query: 72  ELHQKPLTFARQVVSILQYPELLNRRNEL-TSTTPPIYNNDSFDRAEKLLNEIGGSVGAY 130
           +L QKPL+F R+V+SILQYP++L   ++L T     +Y  D   RA KLL EIGGSVGAY
Sbjct: 68  QLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAY 127

Query: 131 SASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPI 190
           S SQGV GI++T+A+YIT+RD GE A P DIF+TTGA++A S++L +  NGP TGVL+PI
Sbjct: 128 SLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187

Query: 191 PQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGN 250
           PQYPLYTA + L  AT + YYL EE  WS++T E+E TI++ ++  GI+P  +VIINPGN
Sbjct: 188 PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQE-SIKSGIKPTTIVIINPGN 246

Query: 251 PTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYN 310
           PTGSIL+E  +  I  I+AKYG++IIADEVYQEN+F+GN+FHS KKVLR LQ+++   Y 
Sbjct: 247 PTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYE 306

Query: 311 NVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMI 370
            VQLASLHSTSKGL GECGQRGGYME+IG  +DVR  ++KL  I +C VVTGQA++D+++
Sbjct: 307 TVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVV 366

Query: 371 LPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLST 430
            PP+ GD+SY++D +ER  I ND+++R++KL+ +F  +EG++C +PQGAMYLFP+ +   
Sbjct: 367 SPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQ 426

Query: 431 KVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWE 490
           K ID A+K   E D  YC ELL  TGICTVPGSGFGQKPNTYHLRTTFL PGD WI+ W 
Sbjct: 427 KFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWR 486

Query: 491 KFHKAFLKRY 500
           KFH  F +RY
Sbjct: 487 KFHTEFCERY 496

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/490 (61%), Positives = 383/490 (78%), Gaps = 10/490 (2%)

Query: 11  HDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNP 70
           H+  PA KL + DLN NV+KA++AVRG+IP++A+EL+  L      LPF+ +  ANIGNP
Sbjct: 31  HNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTVINANIGNP 89

Query: 71  QELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAY 130
           Q+L QKPLTF RQV+SILQYPELL   +        I+  D+ +RA KLL EIG SVG+Y
Sbjct: 90  QQLKQKPLTFYRQVLSILQYPELLESGSN-------IFKKDAIERARKLLKEIG-SVGSY 141

Query: 131 SASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPI 190
           S+SQG+  IRKT+AN+IT+RD GE ++PNDIF+T GA++A  YLLSIL    ++GVL+PI
Sbjct: 142 SSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPI 201

Query: 191 PQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGN 250
           PQYPLYTA LAL+NA  LPYYL+E  GWS D NEIE+ I  +++ KGI+P  +VIINPGN
Sbjct: 202 PQYPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVIN-DSLDKGIKPTALVIINPGN 260

Query: 251 PTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYN 310
           PTGSILS +S+ KI  +AA +GIVIIADEVYQEN+FN  KFHS KKVLR+LQK FP +Y+
Sbjct: 261 PTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYD 320

Query: 311 NVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMI 370
            VQLASLHSTSKG+ GECGQRGGYME+ GFN +++ +ILKL  I +CPVVTGQA++DLM+
Sbjct: 321 TVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMV 380

Query: 371 LPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLST 430
            PP++GD+SY+ D +ER  I ND+ NRA  L++ F+ MEG+ CQKP+GAMYLFP++ L  
Sbjct: 381 SPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPF 440

Query: 431 KVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWE 490
           KV+ ++++ ++ PDEFYC  LL  TGICTVPGSGFGQ+P TYHLRTTFLAPG +WI++W 
Sbjct: 441 KVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWN 500

Query: 491 KFHKAFLKRY 500
           KFH  F  +Y
Sbjct: 501 KFHAEFYDKY 510

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/490 (59%), Positives = 384/490 (78%), Gaps = 4/490 (0%)

Query: 12  DFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQ 71
           +F+PA K++ KDLN  V KAE+AVRG IP +A EL+ +L + P  LPF++I  ANIGNPQ
Sbjct: 19  NFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQ 78

Query: 72  ELHQKPLTFARQVVSILQYPELLNRR-NELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAY 130
           +L QKPLTF RQV+SIL+YPE+L    ++L S    ++  D+  RAE LL +IGGS+GAY
Sbjct: 79  QLDQKPLTFTRQVLSILEYPEILRVGPDKLASLN--LFRKDALGRAEHLLEDIGGSIGAY 136

Query: 131 SASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPI 190
           S SQGV GIR+++A +IT+RD GE A+P +I++TTGA++A++ LLS+L    QTG+L+PI
Sbjct: 137 SHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKDVQTGLLIPI 196

Query: 191 PQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGN 250
           PQYPLYTA  +L NA +LPYYL+E S WS  ++EIEK +K +A+ KGI+P V+++INPGN
Sbjct: 197 PQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVK-DALEKGIKPSVLIVINPGN 255

Query: 251 PTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYN 310
           PTG++LSED++ KI  IAAKYGI II+DEVYQEN+FNG KFHS KKVLR LQ+ +P +++
Sbjct: 256 PTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFD 315

Query: 311 NVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMI 370
           NVQLASLHS SKG  GECGQRGGYME++GF+ D+R+ + KL  I +C VVTGQA++DLM+
Sbjct: 316 NVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMV 375

Query: 371 LPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLST 430
            PP+ GD+SY  D  ER +I ++M  RA  L++ F+ +EGI+CQKPQGAMYLFPRL+L  
Sbjct: 376 KPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPE 435

Query: 431 KVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWE 490
           K + E+++  +EPDEFYC  LL  TGICTVPGSGFGQ+P TYH+RTTFLAPG QWI  W+
Sbjct: 436 KALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWK 495

Query: 491 KFHKAFLKRY 500
            FH+ F  +Y
Sbjct: 496 HFHQDFFNKY 505

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/488 (60%), Positives = 381/488 (78%), Gaps = 4/488 (0%)

Query: 13  FEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQE 72
           F PA + ++KD+N  V+ A++AVRG IPM+A+EL+TQL +NPHSLPFN+I  ANIGNPQ+
Sbjct: 89  FLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIGNPQQ 148

Query: 73  LHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSA 132
           L QKPL+F RQV+S+LQYPEL+     L +    +   D+ DRA++LL++IGGSVGAYS+
Sbjct: 149 LKQKPLSFYRQVLSLLQYPELIPT---LENNPQTMIKQDAIDRAKRLLDDIGGSVGAYSS 205

Query: 133 SQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIPQ 192
           SQGV GIRKT+A++IT RD G  A P DIF+T GA++A  YLLSI   G +TGVL+PIPQ
Sbjct: 206 SQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQ 265

Query: 193 YPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPT 252
           YPLYTA LAL N+  LPYYL EE+GWS D  E+E  I  +++   I+P V+V+INPGNPT
Sbjct: 266 YPLYTATLALQNSHALPYYLNEETGWSTDPEELESIIL-DSIENNIKPSVLVVINPGNPT 324

Query: 253 GSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNV 312
           G++LSE+++ +IF +AAKYGI++IADEVYQEN+F   KFHS KKVLR LQ + P  Y+NV
Sbjct: 325 GAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNV 384

Query: 313 QLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILP 372
           QLASLHSTSKG+ GECGQRGGYME++GF +D+R ++LKLA I +CPVVTGQA++DLM+ P
Sbjct: 385 QLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVCP 444

Query: 373 PKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTKV 432
           P++G++SY+ D  ER+ IH ++  RA  L+D F  ++GI CQKPQGAMYLFP+L L  K 
Sbjct: 445 PQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYKA 504

Query: 433 IDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWEKF 492
           I EA   +M PDEFYC  LL +TGICTVPGSGFGQ+P TYHLRTTFLAPG +WI  W  F
Sbjct: 505 IQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWVDF 564

Query: 493 HKAFLKRY 500
           H+ F  ++
Sbjct: 565 HQEFYNKF 572

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/507 (58%), Positives = 388/507 (76%), Gaps = 12/507 (2%)

Query: 3   THTIQTDLH--------DFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNP 54
           T T Q DL         DF+PA KL+ KDLN +V KAE+AVRG IP +A+EL+ +L ++ 
Sbjct: 2   TMTDQKDLKSVFTTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSS 61

Query: 55  HSLPFNEITVANIGNPQELHQKPLTFARQVVSILQYPELLN-RRNELTSTTPPIYNNDSF 113
           +SLPFN I  ANIGNPQ+L QKPLTF RQV+SIL+YPE+L    ++L S    ++  D+ 
Sbjct: 62  NSLPFNSIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLN--LFAKDAL 119

Query: 114 DRAEKLLNEIGGSVGAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSY 173
            RA++LL++IGGSVGAYS SQGV GIR+T+A++IT+RD GE A P DI++TTGA++A++ 
Sbjct: 120 KRAQRLLDDIGGSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATS 179

Query: 174 LLSILSNGPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNA 233
           LLS+L    QTG+LLPIPQYPLYTA  +L+NA +LPYYL+EE+ WS +++EIE+ +  +A
Sbjct: 180 LLSLLCKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVL-DA 238

Query: 234 MTKGIQPKVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHS 293
           + KGI+P V+V+INPGNPTG++L+E+++ KI  IAAKYGI II+DEVYQEN+F   KFHS
Sbjct: 239 LKKGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHS 298

Query: 294 CKKVLRSLQKQFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLAC 353
            KK+LR LQ   P +++NVQLASLHS SKG  GECGQRGGYMEI+GF+ D+R+ + KL  
Sbjct: 299 MKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMS 358

Query: 354 IDVCPVVTGQAMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQC 413
           I +C V TGQA++DLM+ PP+ GD+SY  D  ER +I+N+ML RA  LY+ F+ +EGI+C
Sbjct: 359 ISICSVATGQAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKC 418

Query: 414 QKPQGAMYLFPRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYH 473
           QKPQGAMYLFP+L L  K + E+++  +EPD  YC  LL  TGICTVPGSGFGQK  TYH
Sbjct: 419 QKPQGAMYLFPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYH 478

Query: 474 LRTTFLAPGDQWINKWEKFHKAFLKRY 500
           +RTTFL PG QWI  W +FH+ F  +Y
Sbjct: 479 VRTTFLPPGTQWIQDWRQFHQDFFNKY 505

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/491 (59%), Positives = 380/491 (77%), Gaps = 3/491 (0%)

Query: 13  FEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQE 72
           F PA KLS+ DLN + + A++AVRG+IPM+A++L  Q+  +P SLPF++I  ANIGNPQ+
Sbjct: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62

Query: 73  LHQKPLTFARQVVSILQYPELLNRRNELTSTTP-PIYNNDSFDRAEKLLNEIGGSVGAYS 131
           + QKPLTF RQV+SIL+YP +LN    L       +Y  D  +RA K+L+ IGGSVGAYS
Sbjct: 63  VGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYS 122

Query: 132 ASQGVYGIRKTIANYITQRD-LGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPI 190
           ASQGV G R+T+A++I +RD   + ASPNDIF+T GA++A  YLLSIL +GP+ GVL+PI
Sbjct: 123 ASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPI 182

Query: 191 PQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGN 250
           PQYPLYTA L L N+T +PYYL+E + WS +T EIE  IK+ +M  G++P  +VIINPGN
Sbjct: 183 PQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKE-SMANGVKPVAIVIINPGN 241

Query: 251 PTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYN 310
           PTG+ILSE  L  I  I+AKYGI IIADEVYQEN+F G +FHS +KVL +LQ +FP  Y+
Sbjct: 242 PTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYD 301

Query: 311 NVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMI 370
           NVQLASLHSTSKG  GECGQRGGYME+IGF ++V  ++LKLA I +C VVTGQA+MDL+ 
Sbjct: 302 NVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVT 361

Query: 371 LPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLST 430
            PP+ GD SY+LD  ER +I  D++ RA +LY +F+ +EG++CQ+PQGAMYLFP+L+L  
Sbjct: 362 CPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPD 421

Query: 431 KVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWE 490
           K I++A + E+ PDE+YC ELL+ TGICTVPGSGFGQ P TYHLRTTFL PG +WI +W 
Sbjct: 422 KAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWR 481

Query: 491 KFHKAFLKRYT 501
           +FH+ F +R++
Sbjct: 482 EFHQQFYERFS 492

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/489 (61%), Positives = 395/489 (80%), Gaps = 2/489 (0%)

Query: 12  DFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQ 71
           +F+PA +L+I DLN NV+KA++AVRG IP +A+EL+ QL + P+SLPF++I  ANIGNPQ
Sbjct: 51  NFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNPQ 110

Query: 72  ELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYS 131
           +L Q+PL+F RQV+S+LQYP LL+   E    +  +Y  D+  RA+K+L +IGGSVGAYS
Sbjct: 111 QLQQQPLSFYRQVLSLLQYPTLLHAI-ETKPGSSAVYKKDAILRAKKILKDIGGSVGAYS 169

Query: 132 ASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIP 191
            SQGVYGIR+T+AN+IT+RD GE A P DIF+T GA+AA +YLLSIL  G +TGVL+PIP
Sbjct: 170 ESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIP 229

Query: 192 QYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNP 251
           QYPLYTA LAL+N+  LPY+L+E +GWSI+  EIE  IKK A+   I+P V+V+INPGNP
Sbjct: 230 QYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKK-AVQDNIKPDVLVVINPGNP 288

Query: 252 TGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNN 311
           TG++LS+++++ I  IAAKYGIV+IADEVYQEN+F+G KFHS K VLR LQ++ P +++N
Sbjct: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348

Query: 312 VQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMIL 371
           VQLASLHSTSKG+ GECGQRGGYMEIIGF ++VR +ILKLA I +CPVVTGQA++DLM+ 
Sbjct: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408

Query: 372 PPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTK 431
           PPK+G++S+ LD  +R+ IH+ +  RA+ L+  F+ ++GI+CQKP GAMYLFP+L L  +
Sbjct: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468

Query: 432 VIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWEK 491
            I EA++ E+ PDEFYC ELL  TGICTVPGSGFGQ   TYHLRTTFLAPG +WI+ W++
Sbjct: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528

Query: 492 FHKAFLKRY 500
           FH  F+++Y
Sbjct: 529 FHIEFMEKY 537

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/500 (58%), Positives = 391/500 (78%), Gaps = 3/500 (0%)

Query: 1   MATHTIQTDLHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFN 60
           ++  TI     +F+PA KL+I DLN NV+KA++AVRG IP +A+ L+ QL  NP SLPF 
Sbjct: 24  LSLTTISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFK 83

Query: 61  EITVANIGNPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLL 120
           ++  ANIGNPQ+L+QKPLTF RQV+S+LQYP +L+     +  T  +Y  D+ +RA+++L
Sbjct: 84  KVINANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDE--TFSGNTKTLYKQDAIERAKRIL 141

Query: 121 NEIGGSVGAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSN 180
           N+IG SVG+YS+SQGV+G+RKT+A YI++RD GE A   DIF+T GA++A SYLL+IL  
Sbjct: 142 NDIGSSVGSYSSSQGVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCK 201

Query: 181 GPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQP 240
           G ++GVL+PIPQYPLYTA LAL+N   LPYYLEE SGWS +  EIE  +  NA+ + I P
Sbjct: 202 GKESGVLIPIPQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVVH-NAIREKIIP 260

Query: 241 KVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRS 300
           +V+V+INPGNPTG+ILS +S+ KIF++AA +GIV+IADEVYQEN+F GN+FHS KKVLR 
Sbjct: 261 RVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRD 320

Query: 301 LQKQFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVV 360
           LQ++ P +Y NVQLASLHSTSKG+ GECGQRGGYME+ GF+ ++++ ILKL  I +CPVV
Sbjct: 321 LQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVV 380

Query: 361 TGQAMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAM 420
           TGQA++DLM  PPK+G+ SY+ D +ER  IH+++  RA  L+  F+ MEG+ CQKPQG+M
Sbjct: 381 TGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSM 440

Query: 421 YLFPRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLA 480
           YLFP++ +  K +++A++ ++ PDE YC ELL  TGICTVPGSGFGQKP T+HLRTTFLA
Sbjct: 441 YLFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLA 500

Query: 481 PGDQWINKWEKFHKAFLKRY 500
           PG  WI++W +FH+ F  +Y
Sbjct: 501 PGTSWIDQWREFHQIFCNKY 520

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/499 (56%), Positives = 378/499 (75%), Gaps = 4/499 (0%)

Query: 2   ATHTIQTDLHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNE 61
           A   +++DL       K +++D+N  V+ A++AVRG IP++A+EL+ +L + P SLPFN+
Sbjct: 23  AKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNK 82

Query: 62  ITVANIGNPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLN 121
           I  ANIGNPQ+L QKPLTF RQV+S+LQ P L+      T     ++  D+ +RA+K+L 
Sbjct: 83  IINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLP--TGELHKLFKPDAVERAKKMLK 140

Query: 122 EIGGSVGAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNG 181
           ++GGSVGAYSASQGV G R+++A +I +RD GE AS NDIF+T GA++A S +LS+   G
Sbjct: 141 QVGGSVGAYSASQGVAGFRQSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTG 199

Query: 182 PQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPK 241
            + G L+PIPQYPLYTA LAL++A  LPYYL+E SGWS+DT ++E+ +K +A+ KG++P 
Sbjct: 200 SENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVK-DAIRKGVRPT 258

Query: 242 VMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSL 301
            +V+INPGNPTG+ILS +++ KI  +AAKY +V+IADEVYQEN F+   F S KKVLR L
Sbjct: 259 CLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVL 318

Query: 302 QKQFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVT 361
           QK  P +Y+NVQLASLHSTSKG+ GECGQRGGYME++GF+ +V+ + LKLA I +CPVVT
Sbjct: 319 QKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVT 378

Query: 362 GQAMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMY 421
           GQA++DLM+ PPK+GD SY+LD  ER  IHN +  ++  LY+ F  +EG+ CQKPQGAMY
Sbjct: 379 GQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMY 438

Query: 422 LFPRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAP 481
           LFP+L LS K I +A+   M PDE+YC ELL  TGICTVPGSGF Q P TYHLRTTFLAP
Sbjct: 439 LFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAP 498

Query: 482 GDQWINKWEKFHKAFLKRY 500
           G +W++ W+KFH+ F+  +
Sbjct: 499 GTEWVDSWKKFHQKFVDEH 517

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/485 (57%), Positives = 372/485 (76%), Gaps = 4/485 (0%)

Query: 16  APKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQELHQ 75
           A +L  +DLNPNV+KA++AVRG IP  A +L+ QL K+P +LPF  +  +NIGNPQ+L Q
Sbjct: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140

Query: 76  KPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSASQG 135
           KPL+F RQV+SIL+YP LL+    L  +    Y  DS +RA+ LL +IG S+GAYS SQG
Sbjct: 141 KPLSFGRQVLSILEYPALLDHERTLVDSMG--YAPDSIERAKTLLTDIG-SIGAYSNSQG 197

Query: 136 VYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPL 195
           V+GIR+T+A++IT RD GE A P+DIF+T GA++A S +LSIL  G QTGVL+PIPQYPL
Sbjct: 198 VHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPL 257

Query: 196 YTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSI 255
           YTA L L++AT LPYYL+E +GWS D NEI K + ++++  GI+P  +V+INPGNPTGS+
Sbjct: 258 YTATLTLNDATALPYYLDESNGWSTDINEISK-VAQDSLEAGIKPTCLVVINPGNPTGSV 316

Query: 256 LSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLA 315
           L+ +++  +F++AAKYG+V+IADEVYQ+N+F G++FHS KK+LR LQK+ P +Y+N+QLA
Sbjct: 317 LTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLA 376

Query: 316 SLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPPKQ 375
           SLHS SKGL GECG RGGY E IGF  +V+ +I KL+ I +C  V GQA++DLM  PPK+
Sbjct: 377 SLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKK 436

Query: 376 GDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTKVIDE 435
           G+ SY+LD  ERQ I  +   R+ KLY+MF+ +EG+ CQKPQGAMY+FP + L    I  
Sbjct: 437 GEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKM 496

Query: 436 AKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWEKFHKA 495
           A+  ++ PDEFYC ELL  TGICTVPGSGFGQ+P TYH+RTTFLAPG +W+ +WEKFH  
Sbjct: 497 AQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIE 556

Query: 496 FLKRY 500
           F ++Y
Sbjct: 557 FFEKY 561

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/488 (56%), Positives = 377/488 (77%), Gaps = 5/488 (1%)

Query: 13  FEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQE 72
           FEP   L ++DLN NV++A++AVRG IP +A EL+ QL+++P SLPF +I  ANIGNPQ+
Sbjct: 50  FEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQ 109

Query: 73  LHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSA 132
           L QKPL+F+R+V+S+L+ P LL    E+ +    IY  D+  RA++++ ++  S+GAYS 
Sbjct: 110 LGQKPLSFSREVLSLLESPNLLQMPMEVLNL---IYKPDAVRRAKRMMRDLQTSIGAYSH 166

Query: 133 SQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIPQ 192
           SQGV G RKT+A Y++ RD GE AS  DIF+TTGA+  +S ++ +L  G ++GVL+PIPQ
Sbjct: 167 SQGVLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQ 225

Query: 193 YPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPT 252
           YPLYTA + L+N   LPYYL+EESGWS++ +++E+ I + ++ KG++P  +V+INPGNPT
Sbjct: 226 YPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIE-SIEKGVKPACLVVINPGNPT 284

Query: 253 GSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNV 312
           G+IL  +S+ +IF IAAKY IV+IADEVYQEN+F G KF+S KKVLRSLQ+++   ++NV
Sbjct: 285 GAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNV 344

Query: 313 QLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILP 372
           QL SLHSTSKGL GECGQRGGYME++GF++D+R +ILK+A I +C  V GQA++DLM+  
Sbjct: 345 QLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSR 404

Query: 373 PKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTKV 432
           PK GD+SY+ D  ER  I N +  R+K L++ F+++EG++C+KPQG+MYLFPRL+L  K 
Sbjct: 405 PKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKA 464

Query: 433 IDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWEKF 492
           I  A+  +M+PDEFYC ELLN TGICTVPGSGFGQ P+T HLRTTFL PG +WI  WE F
Sbjct: 465 IKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWELF 524

Query: 493 HKAFLKRY 500
           HK+F  +Y
Sbjct: 525 HKSFYDKY 532

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/479 (58%), Positives = 373/479 (77%), Gaps = 4/479 (0%)

Query: 18  KLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQELHQKP 77
           K +++D+N  V+ A++AVRG IP++A+EL+ +L + P SLPF++I  ANIGNPQ+L QKP
Sbjct: 38  KKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKP 97

Query: 78  LTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSASQGVY 137
           LTF RQV+++LQ P+L++  +  +      +  D+ +RA+K+L ++GGSVGAYS SQGV 
Sbjct: 98  LTFYRQVLALLQNPDLISDLS--SGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVA 155

Query: 138 GIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYT 197
           G R+++A +I +RD GE AS  DIF+TTGA+ A SY+LS+  NGP+ G L+PIPQYPLYT
Sbjct: 156 GFRESVAEFIEERD-GEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYT 214

Query: 198 ALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILS 257
           A LAL+N+  LPYYL+EESGWS+DT +IEK ++ +++ KGI+P  +V+INPGNPTG++L+
Sbjct: 215 ASLALNNSHALPYYLDEESGWSMDTEQIEKVVQ-DSIKKGIRPTCLVVINPGNPTGALLN 273

Query: 258 EDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASL 317
            D++  +  +AAKY +VIIADEVYQEN FN  +F S KKVLR LQK  P +Y+NVQLASL
Sbjct: 274 TDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASL 333

Query: 318 HSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPPKQGD 377
           HSTSKG+ GECGQRGGYME++GF+ +V+ + LKLA I +CPVVTGQA++DLM+ PPK+GD
Sbjct: 334 HSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKGD 393

Query: 378 QSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTKVIDEAK 437
            SY+ D  ER  IH+ +  R+  LY  F  MEG+ CQ+PQGAMYLFP+L LS K I +A+
Sbjct: 394 ASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAE 453

Query: 438 KFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWEKFHKAF 496
              + PDE+YC ELL  TGICTVPGSGFGQ P T+HLRTTFLAPG +WI+ W+KFH+ F
Sbjct: 454 SAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKF 512

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/500 (57%), Positives = 373/500 (74%), Gaps = 16/500 (3%)

Query: 12  DFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQ 71
           D  PAPK S+ D++ +++  E+A+RGTIP +A ELQ QLN +P+ LPF +I  ANIGNPQ
Sbjct: 5   DCTPAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQ 64

Query: 72  ELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYS 131
           +L Q+PLTF RQV+S+++YP L+N +N L      IY  D+  RAE +LN IGGSVGAYS
Sbjct: 65  QLEQEPLTFQRQVLSLVEYPNLVNSKNILVENK--IYAPDAIKRAETILNSIGGSVGAYS 122

Query: 132 ASQGVYGIRKTIANYITQRD-----------LGESASPNDIFMTTGATAASSYLLSILSN 180
           +SQG+  IRK +A  I QRD           + E+AS  +IF+T GAT A SY+L + + 
Sbjct: 123 SSQGILSIRKNVAKCILQRDNDELCCNDEELINETAS--NIFLTDGATTAVSYILPLFAK 180

Query: 181 GPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQP 240
               GVLLPIPQYPLYTA + L N+ +LPYYL E+  WS D  EIE TI K+A+++ I+P
Sbjct: 181 DENCGVLLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIE-TIIKDAISRNIKP 239

Query: 241 KVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRS 300
             +VIINPGNPTG+ILS +S+ +I NIAAKYGIVIIADEVYQ N++   KFHS KK+L S
Sbjct: 240 TTLVIINPGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNS 299

Query: 301 LQKQFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVV 360
           L+ Q+P +Y+NVQLASLHS SKG+ GECGQRGGY E++GF+++++ +ILKLA ID+C VV
Sbjct: 300 LKLQYPKKYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVV 359

Query: 361 TGQAMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAM 420
           TGQ ++DLM  PP++GD SY+LD  ER  I ++++ ++  LYD+FS + GI CQKPQGAM
Sbjct: 360 TGQILVDLMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAM 419

Query: 421 YLFPRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLA 480
           YLFPRL L++ +I+EAK   +EPDEFYC +LL  TGICTVPGSGFGQK  TYH+RTTFL 
Sbjct: 420 YLFPRLHLTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLP 479

Query: 481 PGDQWINKWEKFHKAFLKRY 500
            G +WI  WEKFH  F+ +Y
Sbjct: 480 SGIEWIKLWEKFHLEFMNQY 499

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/497 (56%), Positives = 378/497 (76%), Gaps = 14/497 (2%)

Query: 13  FEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQE 72
           F PAPK S+ D+N +++KAE+A+RGTIP +A+EL  QL +N  SLPF +I  ANIGNPQ+
Sbjct: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67

Query: 73  LHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSA 132
           L Q+PLTF RQV+S++Q+P+LL  ++ L +    IY+ DS +RA KLLN IGGSVGAYS+
Sbjct: 68  LDQQPLTFQRQVMSLVQFPDLLKSKDILLAQK--IYSKDSIERATKLLNSIGGSVGAYSS 125

Query: 133 SQGVYGIRKTIANYITQRDL---------GESASPNDIFMTTGATAASSYLLSILSNGPQ 183
           SQGV  IRK +A +I +RDL          E+AS  ++F+T GA+ A  ++L + +    
Sbjct: 126 SQGVLDIRKNVARFILKRDLHHDPTQDLIDETAS--NVFLTAGASTAVDHILPLFAKDES 183

Query: 184 TGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVM 243
            GVLLPIPQYPLYTA + L  + +LPYYL E + WS D  +IE+ +  +A+ + I+P  +
Sbjct: 184 CGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVI-DAIKQNIKPTTL 242

Query: 244 VIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQK 303
           V+INPGNPTG+IL++DS+I I +IAA+YGIVIIADEVYQEN++   +FHS KKVL  L+K
Sbjct: 243 VVINPGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRK 302

Query: 304 QFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQ 363
            +P++Y+NVQLASLHS SKG+ GECGQRGGYMEI GF+NDV+ ++LK+A I +C VVTGQ
Sbjct: 303 NYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQ 362

Query: 364 AMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLF 423
            ++DLM+ PP+ GD+SY+LD +ER  IH++++ ++  LYD+F+ + GI CQKPQGAMYLF
Sbjct: 363 ILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLF 422

Query: 424 PRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGD 483
           PRL LS   I+ A +  ++PDEFYC +LL  TGICTVPGSGFGQ P TYHLRTTFL PG 
Sbjct: 423 PRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGI 482

Query: 484 QWINKWEKFHKAFLKRY 500
           +WIN WEKFH  F+++Y
Sbjct: 483 EWINSWEKFHLEFMEKY 499

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/492 (54%), Positives = 360/492 (73%), Gaps = 5/492 (1%)

Query: 9   DLHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIG 68
           D   F PA  +++ D+N NV+KA++AVRG IP +A+EL+ +L ++P SLPF++I  ANIG
Sbjct: 33  DGSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQANIG 92

Query: 69  NPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVG 128
           NPQ+L QKPLTF RQV+S++Q P+LL    E        +  D   RA ++L + GGSVG
Sbjct: 93  NPQQLGQKPLTFYRQVISLMQNPQLLEMPAEWLQQA---FKADVVVRARRMLQDAGGSVG 149

Query: 129 AYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLL 188
           AYSASQGV G R+T+A +I +RD G  A+P+++++T GA++A S LLS    GP+TGVL+
Sbjct: 150 AYSASQGVKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLI 208

Query: 189 PIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINP 248
           PIPQYPLYTA +  +NA  LPYYL E  GWS + +E+E+ I  ++  + I PK +V+INP
Sbjct: 209 PIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVIL-DSKKRNIAPKCLVVINP 267

Query: 249 GNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQ 308
           GNPTGS+LS   +  I  +AAKYGIV+IADEVYQ+N+F   KFHS +KVL++LQ + PT 
Sbjct: 268 GNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTL 327

Query: 309 YNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDL 368
           Y NVQLASLHS SKGL GECGQRGGYME+IGF  ++R + +KLA I +CPVVTGQA++DL
Sbjct: 328 YKNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDL 387

Query: 369 MILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLL 428
           M+ PP QGD SY+    E + I++++  R++ L+  F  +EGI+C  PQGA+YLFP+L L
Sbjct: 388 MVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHL 447

Query: 429 STKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINK 488
             K I+ A+K  +  DE YC ELL+ETGICTVPG+GFGQ P TYH+RTTFL PG +WI  
Sbjct: 448 PQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIES 507

Query: 489 WEKFHKAFLKRY 500
           W+ FHK F  +Y
Sbjct: 508 WKDFHKKFYDKY 519

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 83/167 (49%), Gaps = 16/167 (9%)

Query: 130 YSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLP 189
           Y A QG + +RK IA   +  D+  + S  ++ +T GA AA+ +L      G     +  
Sbjct: 55  YGAIQGSHALRKLIAEMYSNEDV--TLSEENVILTNGAIAAN-FLTHYTLAGKGDHFICI 111

Query: 190 IPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPG 249
            P Y   +++  +  A +   +L +E+ +  +  E+E+ IK N        K +V+  P 
Sbjct: 112 SPTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVELERMIKPNT-------KCIVLNTPN 164

Query: 250 NPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKK 296
           NP  S++  ++L +I  +A K+GIV+  DEVY         FHSC+K
Sbjct: 165 NPLSSVIPTETLREIAELADKHGIVVFCDEVYSP------LFHSCEK 205

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 91/185 (49%), Gaps = 22/185 (11%)

Query: 98  NELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSASQGVYGIRKTIANYITQRDLGESAS 157
           NEL+S T   +    FD+  +L          Y +  G   +R  +A   +  ++  +A 
Sbjct: 35  NELSSLTGESF---EFDQNMRL---------TYGSIWGTPVLRDLVAKIHSSDEIQLTA- 81

Query: 158 PNDIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESG 217
            +++ +T GA  A+ +L+   + GP   ++   P Y   +++ ++  A +   +LE E G
Sbjct: 82  -DNVLITNGAIGAN-FLVHYTAAGPGDHIICVDPTYQQLSSVPSMFGADVELLHLEAEDG 139

Query: 218 WSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIA 277
           ++ +  +++  ++ N        K +V+ NP NP GS++S + + +I + A +  I I+ 
Sbjct: 140 YTPNIQKLKSKVRANT-------KYIVLNNPNNPLGSVISTEKMTEIIDYAERNEIFIVC 192

Query: 278 DEVYQ 282
           DEVY 
Sbjct: 193 DEVYS 197

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 85/400 (21%), Positives = 171/400 (42%), Gaps = 74/400 (18%)

Query: 92  ELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSASQGVYGIRKTIANYITQR- 150
           EL+N      S +PP +   +   A+K L+     V  YS ++G    R ++ N + ++ 
Sbjct: 56  ELINLGQGFFSYSPPQF---AIKEAQKALD--IPLVNQYSPTRG----RVSLLNALIKQY 106

Query: 151 --DLGESASPNDIFMTTGATAAS-SYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATM 207
               G      ++ +TTGA     S L+ +L+ G +  V  P   +  Y + + L    +
Sbjct: 107 TPIYGSELKQENVTITTGANEGILSCLMGLLNAGDEVIVFEPF--FDQYISNIELMGGKI 164

Query: 208 ----------LPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILS 257
                     L   + E + W++D  +      KNA+T   + K ++I  P NP G + +
Sbjct: 165 VYVPINPPKELDQRVTEGTEWTVDMEQF-----KNAITS--KTKAVIINTPHNPIGKVFT 217

Query: 258 EDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASL 317
            + L++I NI  +  ++II+DEVY E+L+  ++F     +   +           QL   
Sbjct: 218 REELLQIGNICVEKNVIIISDEVY-EHLYFTDEFTRIATLSPEIG----------QLTLT 266

Query: 318 HSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPPKQGD 377
             ++   F   G R G+  +I  N+++   + K A   +C              P ++  
Sbjct: 267 VGSAGKTFAATGWRIGW--VISLNSELLQYVSK-AHTRICFASPS---------PLQEAC 314

Query: 378 QSYQLDCIER---QQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYL---FPRLLL--- 428
            +   D +E    +++  + + + K    +F  + G+   KP+G  ++   F ++ +   
Sbjct: 315 ANSINDALESNYFEKMRQEYIQKFKIFTSVFEEL-GLPYTKPEGTYFVLADFSKVKIPED 373

Query: 429 ---STKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGF 465
                +++++ K F +       H L+NE G+  +P + F
Sbjct: 374 YPYPKEILNKGKDFRI------SHWLINELGVVAIPPTEF 407

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 95/405 (23%), Positives = 164/405 (40%), Gaps = 60/405 (14%)

Query: 80  FARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSASQGVYGI 139
           FA   V   +  EL+N      S +PP +   + + A+  L+     V  YS ++G   +
Sbjct: 32  FAASAVGKSEGRELINLGQGFFSYSPPQF---AINAAKSALD--VPLVNQYSPTRGRPSL 86

Query: 140 RKTIANYITQRDLGESASPNDIFMTTGATAAS-SYLLSILSNGPQTGVLLP-----IPQY 193
            K++   + +   G+     ++ +TTGA     S L+ IL+ G +  V  P     IP  
Sbjct: 87  IKSLVE-LYKPVFGDFIDNQNVLVTTGANEGILSCLMGILNAGDEVIVFEPFFDQYIPNI 145

Query: 194 PLYTALLA---LHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGN 250
            L   ++    +H    +         W ID + +EKT   N  TK +     +I  P N
Sbjct: 146 ELCGGVVRYVPIHPPKEMKTRNTTGDEWQIDWDALEKTF--NNKTKAV-----IINTPHN 198

Query: 251 PTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYN 310
           P G + +E  L K+  +  ++  V+I+DEVY+   F                + FP   N
Sbjct: 199 PIGKVFTEQELTKLAQLCVEHNTVVISDEVYEHLYFT---------------ESFPRIAN 243

Query: 311 -NVQLASLHST--SKG-LFGECGQRGGYMEIIGFNNDVRNLILKLACIDVC---PVVTGQ 363
            N  +A+L  T  S G  F   G R G+  II  N+ + N + K A   +C   P    +
Sbjct: 244 INEDIANLTLTVGSAGKSFAATGWRIGW--IISKNDQLLNYVSK-AHTRICFASPSPLQE 300

Query: 364 AMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYL- 422
           A           G   + L      ++  +   + + L   F  + G+   +P+G  ++ 
Sbjct: 301 ACA---------GSIEHALKIDYFPKMREEYRKKFEILTTAFDKL-GLNYTQPEGTYFIL 350

Query: 423 --FPRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGF 465
             F ++ +    +   +  E   D    + L+NE GI  +P + F
Sbjct: 351 VDFSKVKIPEDYVYPEELLEKAKDFRISYWLINEIGIVAIPPTEF 395

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 88/359 (24%), Positives = 157/359 (43%), Gaps = 63/359 (17%)

Query: 130 YSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAA-SSYLLSILSNGPQTGVLL 188
           YS ++G   + K +A+  T    G+  S ++I + TGA  A  S L+ +L+ G +  V  
Sbjct: 77  YSPTRGRPNLIKALADLYTPL-YGQQLSADNITVHTGANEAIFSCLMGLLNKGDEVIVFE 135

Query: 189 PIPQYPLYTALLALHNATML------PYYLEEE----SGWSIDTNEIEKTIKKNAMTKGI 238
           P   +  Y + + L    +       P  L++     + W ID + +EKTI  N+ TK  
Sbjct: 136 PF--FDQYISNIELAGGVVRYVPINPPRELDDRVTRGTEWEIDWDILEKTI--NSRTK-- 189

Query: 239 QPKVMVIIN-PGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKV 297
                VIIN P NP G + + + L+++  I     IVII+DEVY E+L+  ++F     +
Sbjct: 190 ----CVIINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVY-EHLYFSDEFPRIATL 244

Query: 298 LRSLQKQFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVC 357
              +           QL     ++   F   G R G+   +  N ++ N + K A   +C
Sbjct: 245 SPEIG----------QLTFAVGSAGKTFAATGWRIGWT--VSLNKELLNYVAK-AHTRIC 291

Query: 358 ---PVVTGQAMMDLMILPPKQGDQSYQL---DCIERQQIHNDMLNRAKKLYDM-----FS 406
              P    +A+     LP  Q    ++    + I++ +I   + +     Y +     F 
Sbjct: 292 FSSPSPFQEAIAH--ALPEAQKIDYFETMRQEYIQKFKIFTAVFDELNMPYTVAEGSYFI 349

Query: 407 HMEGIQCQKPQGAMYLFPRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGF 465
            +   + + P+   Y+FP+ L      ++AK F +       + L+NE G+  +P + F
Sbjct: 350 CVNFSKVKIPED--YVFPQELQ-----EKAKDFRI------SYWLMNELGVVAIPPTEF 395

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 89/397 (22%), Positives = 170/397 (42%), Gaps = 68/397 (17%)

Query: 92  ELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSASQGVYGIRKTIANYITQRD 151
           EL+N      S +PP +   +   A+K L EI   V  YS ++G   +  ++ +  T   
Sbjct: 55  ELINLGQGFFSYSPPQF---AIKEAQKAL-EIP-LVNQYSPTRGRPSLINSLIDLYTPIY 109

Query: 152 LGESASPNDIFMTTGATAAS-SYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATML-- 208
             E  + N + +TTGA     S L+ +L++G +  V  P   +  Y   + L    ++  
Sbjct: 110 NKELKAEN-VVVTTGANEGILSCLMGLLNSGDEVIVFEPF--FDQYIPNIELCGGKVVYV 166

Query: 209 ----PYYLEEESG----WSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILSEDS 260
               P  L++ +     W+ID  + EK I         + K ++I  P NP G + + D 
Sbjct: 167 PINPPKELDQRNTRGEEWTIDFEQFEKAITS-------KTKAVIINTPNNPIGKVFTHDE 219

Query: 261 LIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHST 320
           L  + NI  K+ +VII+DEVY E+L+  + F     +   +           QL     +
Sbjct: 220 LTTLGNICVKHNVVIISDEVY-EHLYFTDSFTRVATLSPEIG----------QLTLTVGS 268

Query: 321 SKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVC---PVVTGQAMMDLMILPPKQGD 377
           +   F   G R G+  ++  N ++ +   K A   +C   P    +A  + +       +
Sbjct: 269 AGKSFAATGWRIGW--VLSLNAELLSYAAK-AHTRICFASPSPLQEACANSI-------N 318

Query: 378 QSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYL---FPRLLLST---- 430
            + ++   E   +  + + + K L  +F  + G+    P+G+ ++   F ++ +      
Sbjct: 319 DALKIGYFE--NMRQEYITKFKILTSVFDEL-GLPYTAPEGSYFVLVNFSKVKIPEDYPY 375

Query: 431 --KVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGF 465
             +++D+ K F +       H L+NE G+  +P + F
Sbjct: 376 PQEIMDKGKDFRI------SHWLINELGVVAIPPTEF 406

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 85/397 (21%), Positives = 161/397 (40%), Gaps = 68/397 (17%)

Query: 92  ELLNRRNELTSTTPPIYNNDSFDRAEK--LLNEIGGSVGAYSASQGVYGIRKTIANYITQ 149
           EL+N      S +PP +      +A +  L+N+   + G  S    +  +   I N    
Sbjct: 55  ELINLGQGFFSYSPPQFAIKECQKALEIPLVNQYSPTRGRPSLINSLIKLYSPIYN---- 110

Query: 150 RDLGESASPNDIFMTTGATAAS-SYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATML 208
           +DL    +  ++ +TTGA     S L+ +L+ G +  V  P     +    L       +
Sbjct: 111 KDL----TTENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYISNIELCGGKVVYV 166

Query: 209 PYYLEEE--------SGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILSEDS 260
           P    +E          W+ID  + EK I         + K ++I  P NP G + + + 
Sbjct: 167 PINPPKELDLRNTRGEEWTIDFEQFEKAITP-------KTKAVIINTPHNPIGKVFTREE 219

Query: 261 LIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHST 320
           L  + NI  K+ ++II+DEVY E+L+  + F     +   +           QL     +
Sbjct: 220 LTTLGNICVKHNVIIISDEVY-EHLYFTDSFTRIATISPEIG----------QLTLTVGS 268

Query: 321 SKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVC---PVVTGQAMMDLMILPPKQGD 377
           +  LF   G R G+  ++  N D+ + + K A   +C   P    +A  + +       D
Sbjct: 269 AGKLFAATGWRIGW--VVSLNADLLSYVSK-AHTRICFSSPSPLQEACANSI-------D 318

Query: 378 QSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYL---FPRLLLST---- 430
              ++   E+  +  + + + K    +F  + G+    P+G  ++   F ++ +      
Sbjct: 319 DGLKIGYFEK--MRQEYITKFKIFTSIFDEL-GLPYTAPEGTYFVLVNFSKVKIPKDYSY 375

Query: 431 --KVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGF 465
             ++ D+ K F +       H L+NE G+  +P + F
Sbjct: 376 PEEIRDKGKDFRIS------HWLINELGVVAIPPTEF 406

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 76/153 (49%), Gaps = 10/153 (6%)

Query: 130 YSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLP 189
           Y A +G   +R  +A+  + +++      +++ +T GA  A+ +L+S    GP   V+  
Sbjct: 55  YGAIKGSDELRSLVASLYSDKEV--KLDKDNVLITNGAIGAN-FLVSYTLAGPGDHVICV 111

Query: 190 IPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPG 249
            P Y   +++  +  A +    L  E+ +  D  +++  IK N        K +V+ NP 
Sbjct: 112 DPTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMIKGNT-------KCIVLNNPN 164

Query: 250 NPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQ 282
           NP GS++   +L +I  +A K  I +I DEVY+
Sbjct: 165 NPLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 92/398 (23%), Positives = 161/398 (40%), Gaps = 70/398 (17%)

Query: 92  ELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSASQGVYGIRKTIANYITQRD 151
           EL+N      S +PP +      +A ++       V  YS ++G    R  + N +   D
Sbjct: 55  ELINLGQGFFSYSPPAFAIKEIQKAVEI-----PLVNQYSPTRG----RPRLINSLI--D 103

Query: 152 L-----GESASPNDIFMTTGATAAS-SYLLSILSNGPQTGVLLP-----IPQYPL---YT 197
           L      +  +P ++ +TTGA     S L+ I++ G +  V  P     IP   L     
Sbjct: 104 LYSPFYKKQLTPENVLVTTGANEGILSCLMGIINPGDEVIVFEPFFDQYIPNIELCGGKV 163

Query: 198 ALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKV-MVIIN-PGNPTGSI 255
             + ++    L   + + + W++D +E          T+ I PK   VIIN P NP G +
Sbjct: 164 VYVPINPPKELDNRVTKGTEWTVDFDE---------FTRAITPKTKAVIINTPHNPIGKV 214

Query: 256 LSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLA 315
            + + L K+ NI  +  ++IIADEVY E+L+  ++F     +   +           QL 
Sbjct: 215 FTREELTKLGNICVENNVIIIADEVY-EHLYFVDEFPRIATLSEEIG----------QLT 263

Query: 316 SLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPPKQ 375
               ++   F   G R G+  ++  N D+     K A   +C               P Q
Sbjct: 264 LSVGSAGKSFAATGWRIGW--VVSQNPDLLQYASK-AHTRIC----------FASPSPIQ 310

Query: 376 GDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHM---EGIQCQKPQGAMYLFPRLLLSTKV 432
              SY +D   +     +M     K + +F+ +    G+    P+G+ ++      S   
Sbjct: 311 EACSYSIDHALKIDYFENMRQEYVKKFKIFTSVFDELGLPYTIPEGSYFVLAD--FSKVK 368

Query: 433 IDEAKKFEME-----PDEFYCHELLNETGICTVPGSGF 465
           I ++ +F  E      D    + L+NE G+  +P + F
Sbjct: 369 IPDSYQFPEEIMSKGKDFRISNWLINELGVVAIPPTEF 406

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 83/396 (20%), Positives = 164/396 (41%), Gaps = 68/396 (17%)

Query: 93  LLNRRNELTSTTPPIYNNDSFDRA--EKLLNEIGGSVGAYSASQGVYGIRKTIANYITQR 150
           L+N      S +PP +  ++  +A  E L+N+       YS ++G   + K++ +  +  
Sbjct: 55  LVNLGQGFFSYSPPKFAIEALQKAVEEPLVNQ-------YSPTRGRPTLIKSLTDLYSPL 107

Query: 151 DLGESASPNDIFMTTGATAAS-SYLLSILSNGPQTGVLLP-----IPQYPL---YTALLA 201
               +  P ++ +TTGA     + L+ IL+   +  V  P     IP   L       + 
Sbjct: 108 -YKLTLKPENVLVTTGANEGILACLMGILNQNDEVIVFEPFFDQYIPNIELCGGKVVYVP 166

Query: 202 LHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILSEDSL 261
           ++    L   + + + W++D  + E  I         + K ++I  P NP G + + + L
Sbjct: 167 INPPKDLDKRVTKGTEWTLDFEQFENVITN-------KTKAIIINTPHNPIGKVFTREEL 219

Query: 262 IKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHSTS 321
            +I +I  K+ ++II+DEVY +NL+  ++F     +   +           QL     ++
Sbjct: 220 KRIGDICVKHNVIIISDEVY-DNLYFVDEFTRIATLSPEIG----------QLTLSVGSA 268

Query: 322 KGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPPKQGDQSYQ 381
              F   G R G+  ++  N ++ N   K A   +C               P Q   +  
Sbjct: 269 GKTFAATGWRIGW--VVSLNPELLNFASK-AHTRIC----------FASPSPIQEACAES 315

Query: 382 LDCIERQQIHNDMLNRAKKLYDMFSHM---EGIQCQKPQGAMYL---FPRLLL------S 429
           ++   R     +M N   K Y +F+ +    G+   + +G  +L   F R+ +       
Sbjct: 316 INIALRNGYFENMRNEYVKKYKIFTSVFDELGLPYTEAEGTYFLLVDFSRVKIPEDYKFP 375

Query: 430 TKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGF 465
            ++I++ K F +       + L+NE G+  +P + F
Sbjct: 376 EEIINKGKDFRI------SNWLINELGVVAIPPTEF 405

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 72/329 (21%), Positives = 143/329 (43%), Gaps = 62/329 (18%)

Query: 160 DIFMTTGATAAS-SYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATML------PYYL 212
           ++ +TTGA     S L+ +L++G +  V  P   +  Y   + L    ++      P  L
Sbjct: 133 NVTVTTGANEGILSCLMGLLNSGDEVIVFEPF--FDQYIPNIELCGGKVVYVPINPPKEL 190

Query: 213 EEESG----WSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILSEDSLIKIFNIA 268
           ++ +     W+ID  + E     NA+T   + K ++I  P NP G + + + L  + NI 
Sbjct: 191 DQRNTKGEEWTIDFEQFE-----NAITS--KTKAVIINTPHNPIGKVFTREELTTLGNIC 243

Query: 269 AKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHSTSKGLFGEC 328
            K+ +VII+DEVY E+LF  + F     +   +           QL     ++   F   
Sbjct: 244 VKHNVVIISDEVY-EHLFFTDSFTRIATLSPEIG----------QLTLTVGSAGKSFAAT 292

Query: 329 GQRGGYMEIIGFNNDVRNLILKLACIDVC---PVVTGQAMMDLMILPPKQGDQSYQLDCI 385
           G R G+  ++  N ++ +   K A   +C   P    +A  + +       + + ++D  
Sbjct: 293 GWRIGW--VLSLNAELLSYAAK-AHTRICFASPSPLQEACANSI-------NDALKIDYF 342

Query: 386 ERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYL---FPRLLL------STKVIDEA 436
           E+  +  + + + K    +F  + G+    P+G  ++   F ++ +        +++D+ 
Sbjct: 343 EK--MRQEYITKFKIFTSIFDKL-GLPYTAPEGTYFVLVDFSKVKIPEDYPYPKEILDKG 399

Query: 437 KKFEMEPDEFYCHELLNETGICTVPGSGF 465
           K F +       H L+NE G+  +P + F
Sbjct: 400 KDFRIS------HWLINELGVVAIPPTEF 422

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/261 (23%), Positives = 111/261 (42%), Gaps = 43/261 (16%)

Query: 214 EESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILSEDSLIKIFNIAAKYGI 273
           E + W ID + + +TI +       + K ++I +P NP G + + + L+K+ NI  + GI
Sbjct: 194 EGTEWVIDYDMLRQTINE-------KTKAVIINSPHNPIGKVFTREELLKLGNICVEKGI 246

Query: 274 VIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHSTSKGLFGECGQRGG 333
            II+DEVY E+L+  ++F     +   + +   T         + S  K  F   G R G
Sbjct: 247 YIISDEVY-EHLYFTDEFTRIATLSEEISQHTLT---------VGSAGKS-FAATGWRIG 295

Query: 334 YMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPPKQGDQSYQLDCIERQQIHND 393
           +  +I  N ++  L  K A + +C            +        +Y  D    +  +  
Sbjct: 296 W--VISRNKELLALASK-AHVRICFSSPAPLQEACAVAIEHALKTTYYADT---RAAYQK 349

Query: 394 MLNRAKKLYDMFSHMEGIQCQKPQGAMYL---FPRLLLST------KVIDEAKKFEMEPD 444
              R +K +D      G+   + +G+ +L   F RL L        ++ D+ + F +   
Sbjct: 350 KYERFQKPFDDL----GLPYTRAEGSYFLLVDFSRLPLPADYHFPEELADKGRDFRV--- 402

Query: 445 EFYCHELLNETGICTVPGSGF 465
               + L+NE G+  +P S F
Sbjct: 403 ---AYWLINELGLVAIPCSSF 420

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 78/340 (22%), Positives = 144/340 (42%), Gaps = 80/340 (23%)

Query: 158 PNDIFMTTGATAAS-SYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEE- 215
           P+++ +TTGA  A  S L+ +L+ G +  V  P     +    +     T +P +  +E 
Sbjct: 118 PSNVQVTTGANEAILSCLVGLLNQGDEVIVFEPFFDQYISNIEIPGGKVTYVPLHPPKEL 177

Query: 216 -------SGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILSEDSLIKIFNIA 268
                  + W++D +E+   I         + K +++  P NP G + + + L++I NI 
Sbjct: 178 ENRVTHGTEWTVDYDELRAAITP-------KTKALILNTPHNPIGKVFTREELLEIGNIC 230

Query: 269 AKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHSTSKGLFGEC 328
            +  +VII+DEVY E+L+  ++F     +          +  N+ L S+ S  K  F   
Sbjct: 231 VENNVVIISDEVY-EHLYFTSEFTRIATL--------SPEIGNLTL-SVGSAGKT-FAAT 279

Query: 329 GQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPPKQGDQSYQLDCIERQ 388
           G R G+  I+  N +    +LK A +         A   +    P      +Q  C +  
Sbjct: 280 GWRIGW--IVSQNAE----LLKYASM---------AHTRICFASP----SPFQEACAKSI 320

Query: 389 QI--HNDMLNRAKKLY----DMFSHM---EGIQCQKPQGAMYL--------------FPR 425
           +I   N+   + ++ Y    D+F+ +    G+   +P+G  ++              FP 
Sbjct: 321 EIALQNNYFEKMRQEYINKFDIFTRVFDELGLPYTQPEGTYFVLVDFSKVKIPEDYPFPE 380

Query: 426 LLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGF 465
            LLS     +AK F +       + L+NE G+  +P + F
Sbjct: 381 ELLS-----KAKDFRI------SYWLINELGVVAIPPTEF 409

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/260 (21%), Positives = 112/260 (43%), Gaps = 49/260 (18%)

Query: 218 WSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIA 277
           W+ID  + EK I         + K ++I  P NP G + + + L  + NI  K+ +VII+
Sbjct: 184 WTIDFEQFEKAITS-------KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIIS 236

Query: 278 DEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEI 337
           DEVY E+L+  + F     +   +           QL     ++   F   G R G+  +
Sbjct: 237 DEVY-EHLYFTDSFTRIATLSPEIG----------QLTLTVGSAGKSFAATGWRIGW--V 283

Query: 338 IGFNNDVRNLILKLACIDVC---PVVTGQAMMDLMILPPKQGDQSYQLDCIERQQIHNDM 394
           +  N ++ +   K A   +C   P    +A  + +       + + ++   E+  +  + 
Sbjct: 284 LSLNAELLSYAAK-AHTRICFASPSPLQEACANSI-------NDALKIGYFEK--MRQEY 333

Query: 395 LNRAKKLYDMFSHMEGIQCQKPQGAMYL---FPRLLL------STKVIDEAKKFEMEPDE 445
           +N+ K    +F  + G+    P+G  ++   F ++ +        +++++ K F +    
Sbjct: 334 INKFKIFTSIFDEL-GLPYTAPEGTYFVLVDFSKVKIPEDYPYPEEILNKGKDFRI---- 388

Query: 446 FYCHELLNETGICTVPGSGF 465
              H L+NE G+  +P + F
Sbjct: 389 --SHWLINELGVVAIPPTEF 406

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 87/400 (21%), Positives = 169/400 (42%), Gaps = 74/400 (18%)

Query: 92  ELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSASQGVYGIRKTIANYITQRD 151
           EL+N      S +PP +   +   A+K L EI   V  YS ++G    R ++ N + +  
Sbjct: 59  ELINLGQGFFSYSPPQF---AIKEAQKAL-EIP-LVNQYSPTRG----RASLLNSLIKLY 109

Query: 152 ---LGESASPNDIFMTTGATAAS-SYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATM 207
               G+     +I +TTGA     S L+ +L+ G +  V  P   +  Y + + L    +
Sbjct: 110 SPFYGKELKQENITITTGANEGILSCLMGLLNAGDEVIVFEPF--FDQYISNIELMGGKV 167

Query: 208 ----------LPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILS 257
                     L   + E + W+ID  +      +NA+T   + K +++ +P NP G + +
Sbjct: 168 VYVPINPPKDLDQRITEGTEWTIDFEQF-----RNAITP--KTKAVIVNSPHNPIGKVFT 220

Query: 258 EDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASL 317
           ++ L K+  I  +  ++II+DEVY+   FN + F     +   +           QL   
Sbjct: 221 KEELTKLGEICVENNVIIISDEVYEFLYFN-DSFTRIATLSPEIG----------QLTLT 269

Query: 318 HSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPPKQGD 377
             ++   F   G R G+  +I  N ++   + K A   +C              P ++  
Sbjct: 270 VGSAGKTFAATGWRIGW--VISQNPELLQYVSK-AHTRICFASPS---------PLQEAC 317

Query: 378 QSYQLDCIER---QQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYL---FPRLLL--- 428
            +   D +E    +++  + + + K    +F  + G+   KP+G  ++   F ++ +   
Sbjct: 318 ANSINDALESGYFEKMRKEYVQKFKIFNAVFEEL-GLPYTKPEGTYFVLADFSKVKIPED 376

Query: 429 ---STKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGF 465
                +++D+ K F +       H L+NE G+  +P + F
Sbjct: 377 YPWPEEILDKGKDFRI------SHWLINELGVVAIPPTEF 410

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 74/153 (48%), Gaps = 13/153 (8%)

Query: 130 YSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLP 189
           Y + +G   +R  IA+       G   + +++ +T GA AA+ +L+     GP   V+  
Sbjct: 55  YGSIKGSDKLRSLIASM-----YGPEFNKDNVLVTNGAIAAN-FLIYYTLVGPGDHVICV 108

Query: 190 IPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPG 249
            P Y    ++  +  A +    L++E G+  +   ++K IK N        K+++I NP 
Sbjct: 109 DPTYAQLYSVPKMFGAEVSLLKLQKEDGFIPNIETLKKMIKSNT-------KLIIINNPN 161

Query: 250 NPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQ 282
           NP GS +S ++L  I  +  +  I +  DEVY+
Sbjct: 162 NPLGSAISTETLNDICQLCEENNIYLHCDEVYK 194

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 82/340 (24%), Positives = 135/340 (39%), Gaps = 55/340 (16%)

Query: 160 DIFMTTGATAAS-SYLLSILSNGPQTGVLLPIPQYPLYTALLA--------LHNATMLPY 210
           +I +TTGA  A    L++++  G +  V+ P     ++   +A        L N      
Sbjct: 100 NILVTTGAIQALLESLMALIKPGDEVIVIEPFFDPYIHLIKIAGGVVKYVPLTNPNQGKK 159

Query: 211 YLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILSEDSLIKIFNIAAK 270
            + E + W +D   +     + A T   + K+M+I NP NP G + + D L+++  +   
Sbjct: 160 RILEANDWILDRETL-----RAAFTD--KTKLMIINNPNNPLGKVFNRDELLEMATLCVN 212

Query: 271 YGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHSTSKGLFGECGQ 330
            G  IIADEVY+   F  N       +  ++ ++  T         + S  K +F   G 
Sbjct: 213 NGAYIIADEVYEFLQFTPNPLSRISNLSEAIAQKTIT---------IGSAGK-IFRVTGW 262

Query: 331 RGGYMEIIGFNNDVRNLILKLACIDV----CPVVTGQAMMDLMILPPKQGDQSYQLDCIE 386
           R G+M  I  N   R L+ K+  + V    C     Q    L I           L+C  
Sbjct: 263 RVGWM--ISKN---RELVEKVTAVHVRMGFCSPSISQVASGLGI--------QRALECGY 309

Query: 387 RQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTKVIDEAKKF-----EM 441
              + N+   +   +Y    ++ G+   KPQGA ++      S   I E  +F       
Sbjct: 310 FLSMPNEFDRKFSIIYKALDYL-GVSYTKPQGAHFIITD--FSKVKIPEDYQFPEYLKNR 366

Query: 442 EPDEFYCHELLNETGICTVPGSGF----GQKPNTYHLRTT 477
             D F  + L  E  I  +P S F     +K +  +LR T
Sbjct: 367 ARDFFISYWLTQEFCILLLPCSEFYCEEHRKNSETYLRIT 406

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 87/355 (24%), Positives = 148/355 (41%), Gaps = 50/355 (14%)

Query: 160 DIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLAL--HNATMLPYYLEEESG 217
           D+  T G T A   +L I  N    G  +   Q+   +++ A       + P  L+E   
Sbjct: 134 DVLATIGNTGAWESVLRIFCN---RGDTILAEQFAFSSSISAAEAQGVNVFPIPLDEHG- 189

Query: 218 WSIDTNEIEKTIKKNAMTKGIQPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVII 276
             I  +++E TI  N      +PK++  +  G NPTGS LS D   +I+ IA K+  +II
Sbjct: 190 --IIPSKLE-TILDNWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFIII 246

Query: 277 ADEVY---QENLFNGN-------KFHSCKKVLRSLQKQFPTQYNNVQLASLHSTSKGLFG 326
            DE Y   Q   +  +        +   K+ +++L+K F +     ++  L S SK L  
Sbjct: 247 EDEPYYFLQMEKYEKDPANRVVKSYADHKEFIQNLEKSFVSIDTEGRVLRLDSLSKVL-- 304

Query: 327 ECGQRGGYMEIIGFNNDVRNLILKLACIDV-CPVVTGQAMMDLMILPPKQGDQSYQLDCI 385
             G R G+  I+G   D+   IL L  + +  P    Q+++   +   + G + Y LD +
Sbjct: 305 APGTRFGW--IVG-AKDILARILSLQEMTIQAPAGFTQSIIAGTM--NRWGQEGY-LDWL 358

Query: 386 --ERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTKVIDEAKKFEMEP 443
              R +           LY     ++ I+   P   M+ F   + ++K  + A K+  +P
Sbjct: 359 IGLRHEYTKKRDCCIDALYKYLPQVDYIKINPPIAGMF-FTVNIDASKHPEFATKYGSDP 417

Query: 444 D--EFYCHELLNETGICTVPGSGF----------------GQKPNTYHLRTTFLA 480
           +  E    +    +G+  VPG+ F                 +KPN    R T+ A
Sbjct: 418 EKVEKAIFDRSIASGVLVVPGNWFKSQGQTTPPQPEASFKSEKPNEIFFRGTYAA 472

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 91/396 (22%), Positives = 164/396 (41%), Gaps = 66/396 (16%)

Query: 92  ELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSASQGVYGIRKTIANYITQRD 151
           +L+N      S +PP +   +   A+K L EI   V  YS ++G    R ++ N + +  
Sbjct: 62  DLINLGQGFFSYSPPQF---AIHEAQKAL-EIP-LVNQYSPTKG----RPSVINSLKKLY 112

Query: 152 ---LGESASPNDIFMTTGATAAS-SYLLSILSNGPQTGVLLP-----IPQYPLY---TAL 199
               G+     ++ +TTGA     S L+ IL+ G +  V  P     IP   L       
Sbjct: 113 SPLYGQELKDENVTITTGANEGILSSLMGILNPGDEVIVFEPFFDQYIPNIELLGGKVVY 172

Query: 200 LALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILSED 259
           + ++    +   + E   W+ID  E+ K             K +++  P NP G + +++
Sbjct: 173 VPINPPKDMDQRIVEGKDWTIDYEELAKAFTSKT-------KALILNTPHNPIGKVFTKE 225

Query: 260 SLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHS 319
            L KI N+  +  +VII+DEVY E L+    F      + +L  +        QL     
Sbjct: 226 ELTKIGNLCVENNVVIISDEVY-EFLY----FTDSYTRIATLSPEIG------QLTLTVG 274

Query: 320 TSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVC---PVVTGQAMMDLMILPPKQG 376
           ++   F   G R G+  +I  N ++ + + K     +C   P    +A+ +  I    +G
Sbjct: 275 SAGKTFAATGWRIGW--VISLNPELLSYVSK-GHTRICFSSPSPIQEAVAN-SIEDALKG 330

Query: 377 D--QSYQLDCIERQQIHNDMLNRAKKLYDM-----FSHMEGIQCQKPQGAMYLFPRLLLS 429
           D  ++ + D I + +I   +       Y +     F  ++  +   P+   Y +P  LL 
Sbjct: 331 DYFEAMRTDYIRKFEIFTSVFKEMGLPYTIPEGTYFILVDFSKVNVPED--YPYPEELL- 387

Query: 430 TKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGF 465
               D+ K F +       + L+NE G+  +P + F
Sbjct: 388 ----DKGKDFRI------SYWLINELGVVAIPPTEF 413

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 85/395 (21%), Positives = 165/395 (41%), Gaps = 64/395 (16%)

Query: 92  ELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSASQGVYGIRKTIANYITQRD 151
           EL+N      S +PP +   +   A+K ++     V  YS ++G   + +++    +   
Sbjct: 54  ELINLGQGFFSYSPPKF---AITEAKKAVD--IPLVNQYSPTRGRVSLLESLIKLYSPLY 108

Query: 152 LGESASPNDIFMTTGATAAS-SYLLSILSNGPQTGVLLP-----IPQYPLY---TALLAL 202
             E  + N + +TTGA     S L+ IL+ G +  V  P     IP   L       + +
Sbjct: 109 NAELKAEN-VTVTTGANEGILSCLMGILNPGDEVIVFEPFFDQYIPNIELLGGKVVYVPI 167

Query: 203 HNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILSEDSLI 262
           +    +   + + + W++D  +       NA+T   + K ++I  P NP G + + + L 
Sbjct: 168 NPPKDMDQRVVKGTEWTVDYEQF-----ANAITD--KTKAVIINTPHNPIGKVFTREELT 220

Query: 263 KIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHSTSK 322
           +I  I  K  +VII+DEVY E+L+  + F     +   +           QL     ++ 
Sbjct: 221 RIGEICVKKNVVIISDEVY-EHLYFTDSFTRIATLSPEIG----------QLTLSVGSAG 269

Query: 323 GLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPPKQGDQSYQL 382
             F   G R G+  ++  N ++ + + K A   +C              P ++   +   
Sbjct: 270 KSFAATGWRVGW--VVSLNPELLSYVSK-AHTRICFASPS---------PLQEAVANSIN 317

Query: 383 DCIERQQIHNDMLNRAKKLYDMFSHM---EGIQCQKPQGAMYL---FPRLLL------ST 430
           D +E     N M    K  YD+F+ +    G+   +P+G  ++   F ++ +        
Sbjct: 318 DALEINYFEN-MRQEYKHKYDIFTSVFKELGLPYTEPEGTYFILVDFSKVKIPEGYSYPE 376

Query: 431 KVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGF 465
           ++ ++AK F +       + L+NE G+  +P + F
Sbjct: 377 EIANKAKDFRI------AYWLINELGVVAIPPTEF 405

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 85/403 (21%), Positives = 161/403 (39%), Gaps = 80/403 (19%)

Query: 92  ELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSASQGVYGIRKTIANYITQRD 151
           +L+N      S +PP +     + A+K L++    V  YS ++G    R ++ N + ++ 
Sbjct: 54  DLINLGQGFFSYSPPAF---VVEEAQKALDD--AMVNQYSPTKG----RMSLINSLIKQY 104

Query: 152 ---LGESASPNDIFMTTGATAAS-SYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATM 207
                     N+I +TTGA     + L+ +L+ G +  V  P     +    +     T 
Sbjct: 105 SPLYNTQLQANNIQVTTGANEGILACLVGLLNPGDEVIVFEPFFDQYISNIQIPGGKVTY 164

Query: 208 LPYYLEEE--------SGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILSED 259
           +P +  +E        + W++D +E+   I           K +++  P NP G + + +
Sbjct: 165 VPLHPPKEMSVRPTEGTEWTVDYDELRAAITPKT-------KALILNTPHNPVGKVFTRE 217

Query: 260 SLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHS 319
            L++I  I  +  +VII+DEVY E+L+   +F     +   +           Q+     
Sbjct: 218 ELLQIGQICVENNVVIISDEVY-EHLYFTPEFTRVATLSPEIG----------QITLTIG 266

Query: 320 TSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVC---PVVTGQAMMDLMILPPKQG 376
           ++   F   G R G+  I+  N ++      +A   +C   P    +A  + +   P   
Sbjct: 267 SAGKSFAATGWRIGW--IVSLNPELLEYA-SMAHTRICFASPSPLQEACANAL---PIAL 320

Query: 377 DQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYL-------------- 422
           D  Y    +  + IH    N   +++D      G+   KP+G  ++              
Sbjct: 321 DNGY-FKKMREEYIHK--FNIFTRVFDEL----GLPYTKPEGTYFVLVDFSKVKIPEDYP 373

Query: 423 FPRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGF 465
           FP  L S     +AK F +       + L+NE G+  +P + F
Sbjct: 374 FPEELRS-----KAKDFRI------SYWLINELGVVAIPPTEF 405

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 101/212 (47%), Gaps = 36/212 (16%)

Query: 158 PNDIFMTTGATAA-SSYLLSILSNGPQTGVLLPIPQYPLYT----ALLALHNATMLPYYL 212
           P +I +TTGA     + L+S+L+ G +  VL P     +Y       +  H     P  L
Sbjct: 99  PENIQVTTGANVGIFACLMSLLNPGDEVIVLEPFFDQYIYNIKVLGGIVKHVPLTPPKDL 158

Query: 213 EEE----SGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILSEDSLIKIFNIA 268
           +      S W++D ++    I +       + K ++I +P NPTG + + + L+ + NI 
Sbjct: 159 KTRRTKGSEWTLDFDQFRSAISE-------KTKAVIINSPHNPTGKVFTREELLTLGNIC 211

Query: 269 AKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHSTSKGLFGEC 328
            +  + II+DEVY ENL+   +   C K L SL  +     +N+ L ++ S  K +F   
Sbjct: 212 VEKNVYIISDEVY-ENLYFTPE---CVK-LASLSPEI----SNITL-TIGSAGK-IFAVT 260

Query: 329 GQRGGYMEIIGFNNDVRNLILKLAC---IDVC 357
           G R G+  II  N +    +LKLA    I +C
Sbjct: 261 GWRIGW--IISENVE----LLKLASSAHIKIC 286

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 74/362 (20%), Positives = 152/362 (41%), Gaps = 69/362 (19%)

Query: 130 YSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAAS-SYLLSILSNGPQTGVLL 188
           YS ++G   + K++ ++ +     E+ + +++ +TTGA     + L+ +L+ G +  V  
Sbjct: 88  YSPTRGRPSLLKSLTDFYSPI-YNETLNESNVTITTGANEGILASLVGLLNPGDEVIVFE 146

Query: 189 PIPQYPLYTALLALHNATMLPYYLEEE--------SGWSIDTNEIEKTIKKNAMTKGIQP 240
           P     +    +       +P    +E        + W ID + + KTI +       + 
Sbjct: 147 PFFDQYISNIEIPGGKVRYVPLVAPKELSERVTIGAEWKIDFDILNKTINE-------RT 199

Query: 241 KVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRS 300
           K +++  P NP G + + + L ++ +I  K  I II+DEVY E+L+ G++F     + + 
Sbjct: 200 KCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVY-EHLYFGDEFTRIATISKE 258

Query: 301 LQKQFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVV 360
           +         ++ L S+ S  K  F   G R G+  ++  N ++ + + K A   +C   
Sbjct: 259 I--------GDLTL-SVGSAGKS-FAATGWRIGW--VVSRNAELLSYVSK-AHTRIC--- 302

Query: 361 TGQAMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHM---EGIQCQKPQ 417
                       P Q   ++ +D         +M    K+ + + + +    G+   KP 
Sbjct: 303 -------FSSPSPFQEACAHSIDIGLHNGYFENMREEYKEKFAILTRVFDELGLPYTKPD 355

Query: 418 GAMYL--------------FPRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGS 463
           G  ++              FPR     ++ + AK F++       + L+NE G+  +P +
Sbjct: 356 GTYFVCVDFSKVQIPDEYPFPR-----ELNERAKDFKL------SYWLVNELGVVAIPPT 404

Query: 464 GF 465
            F
Sbjct: 405 EF 406

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 82/395 (20%), Positives = 155/395 (39%), Gaps = 64/395 (16%)

Query: 92  ELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSASQGVYGIRKTIANYITQRD 151
           E++N      S  PP +      RA ++       V  YS ++G   +  ++  + T   
Sbjct: 46  EMINLGQGFFSYAPPQFAIKEAQRALEI-----PLVNQYSPTRGRLSLIDSLVKFYTPFY 100

Query: 152 LGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLP-----IPQYPLY---TALLALH 203
             +  + N    T    A  S L+ +L+ G +  V  P     IP   L       + + 
Sbjct: 101 NTKLEAANFSVFTGANEAIFSILIGLLNPGDEVIVFEPFFDQYIPNIELSGGKVVYVPIT 160

Query: 204 NATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILSEDSLIK 263
               L   + +   W ID + ++  +  N+ TK I     +I  P NP G + +E  L +
Sbjct: 161 PPKNLDTRVTKGEEWQIDWDSLQAAM--NSKTKAI-----IINTPHNPIGKVFTEPELRR 213

Query: 264 IFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHSTSKG 323
           + +I  K  +VII+DEVY E+L+  + F     +   +           QL     ++  
Sbjct: 214 LGDICVKNNVVIISDEVY-EHLYFKDSFTRIATLSPEIG----------QLTLTVGSAGK 262

Query: 324 LFGECGQRGGYMEIIGFNNDVRNLILKLACIDVC---PVVTGQAMMDLMILPPK-QGDQS 379
            F   G R G+   +  N ++ +   K A   +C   P    +A+ +      K +  + 
Sbjct: 263 SFAATGWRIGWA--LSLNQELLSYAAK-AHTRICFASPSPLQEAVANAFNDAEKVEYFKE 319

Query: 380 YQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLF---------PRLLLST 430
            +L  I + +I  ++LN             G+   +P+G  ++          P      
Sbjct: 320 TRLQYIRKYEIFTNVLNEL-----------GLPYTEPEGTYFILVNFSKVKIPPDYKYPE 368

Query: 431 KVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGF 465
           +++++AK F +       + L+NE G+  +P + F
Sbjct: 369 ELLNKAKDFRI------SYWLMNELGVVAIPPTEF 397

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 90/203 (44%), Gaps = 20/203 (9%)

Query: 92  ELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSASQGVYGIRKTIAN-----Y 146
           EL+N      S +PP +   +   A+  L+     V  Y+ ++G   +  ++       Y
Sbjct: 54  ELINLGQGFFSYSPPPF---AIHEAQAALS--SPMVNQYAPTKGRVSLINSLVKLYSPLY 108

Query: 147 ITQRDLGESASPNDIFMTTGATAAS-SYLLSILSNGPQTGVLLPIPQYPLYTALLALHNA 205
            TQ D       +++ +TTGA     S L+ +L+ G +  V  P     +    +     
Sbjct: 109 NTQLD------ASNVQVTTGANEGILSCLVGLLNPGDEVIVFEPFFDQYISNIQIPGGKV 162

Query: 206 TMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVII--NPGNPTGSILSEDSLIK 263
           T +P +  +E     +T   E T+  + +   I PK   +I   P NP G + + + L++
Sbjct: 163 TYVPMHPPKEMNVR-NTKGTEWTVNYDELEAAITPKTKALILNTPHNPVGKVFTREELLR 221

Query: 264 IFNIAAKYGIVIIADEVYQENLF 286
           I  I  K+ +VII+DEVY+   F
Sbjct: 222 IGEICVKHNVVIISDEVYEHLYF 244

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 83/189 (43%), Gaps = 22/189 (11%)

Query: 160 DIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLAL--HNATMLPYYLEEESG 217
           D+  T G T A    L +  N    G  +    Y   ++L A       + P  L+E   
Sbjct: 135 DVLATAGNTNAWESTLRVFCN---RGDTILAEAYSFSSSLYAAEAQGVNVFPVPLDE--- 188

Query: 218 WSIDTNEIEKTIKKNAMTKGIQPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVII 276
           + I   ++E +I  N   +  +PK++  I  G NPTGS LS+D   KI+ IA K+  +II
Sbjct: 189 FGIIPEKLE-SIMDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKAKIYRIAQKHNFIII 247

Query: 277 ADEVY----------QENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHSTSKGLFG 326
            DE Y            +      + S  + ++SL K F +   + ++  L S SK L  
Sbjct: 248 EDEPYYFLQMEPYVKDASAREKKTYSSHDEFIQSLAKSFISLDTDGRVVRLDSFSKVL-- 305

Query: 327 ECGQRGGYM 335
             G R G++
Sbjct: 306 APGTRLGWI 314

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 70/153 (45%), Gaps = 13/153 (8%)

Query: 130 YSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLP 189
           Y A +G   +R  IA        G   S +++ +T GA  A+ +LL     G    V+  
Sbjct: 56  YGAIKGSKDLRTLIAGL-----YGVQFSADNVLVTNGAIGAN-FLLYYTLVGKGDHVICV 109

Query: 190 IPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPG 249
            P Y    ++  +  A +    L E+  +  + + ++K IK N        K+++I NP 
Sbjct: 110 HPTYSQLYSVPKMFGAEVTLLELSEKDSFLPNLDTLKKAIKSNT-------KLIIINNPN 162

Query: 250 NPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQ 282
           NP G ++S++ L  I  +  +  + +  DEVY+
Sbjct: 163 NPLGCVISDELLTSICELCKEKNVYLHCDEVYR 195

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 72/154 (46%), Gaps = 13/154 (8%)

Query: 129 AYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLL 188
           +Y A +G   +R +IA+       G   + +DI +T GA  A+      L  G    V+ 
Sbjct: 54  SYGAIKGSDELRTSIASL-----YGPDFTMDDILLTNGAIGANFLAFYTLV-GAGDHVIC 107

Query: 189 PIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINP 248
             P Y    ++  +  A +    L++E  +  +   ++  IK N        K+++I NP
Sbjct: 108 VEPTYSQLYSVPEMFGAEVDLLTLKKEDDFLPNLQTLKSMIKNNT-------KLIIINNP 160

Query: 249 GNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQ 282
            NP GS++ +D L +I  +  +  I + +DEVY+
Sbjct: 161 NNPLGSVIKKDLLKQICKLCEENDIYLHSDEVYR 194

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 84/189 (44%), Gaps = 22/189 (11%)

Query: 160 DIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLAL--HNATMLPYYLEEESG 217
           ++  TTG T +    L I  N    G  +   QY   +++ A       + P  L+ +  
Sbjct: 135 NVLATTGNTGSWESTLRIFCN---RGDTILAEQYTFSSSVYAAEAQGINVFPVPLDADGL 191

Query: 218 WSIDTNEIEKTIKKNAMTKGIQPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVII 276
                 E  + I  N      +PK++  I  G NPTGS LS+D  ++I+ IA K+ ++II
Sbjct: 192 ----IPERLEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLII 247

Query: 277 ADE--------VYQENLFNGNKFH--SCKKVLRSLQKQFPTQYNNVQLASLHSTSKGLFG 326
            DE         YQ+++    + H  S +  + SL K F +     ++  L S SK L  
Sbjct: 248 EDEPYYFLQMDAYQKDVSQRKETHFASQEDFVNSLAKSFISLDTEGRVLRLDSFSKVL-- 305

Query: 327 ECGQRGGYM 335
             G R G++
Sbjct: 306 GPGTRLGWI 314

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 75/329 (22%), Positives = 133/329 (40%), Gaps = 29/329 (8%)

Query: 160 DIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATMLPYYLE-EESGW 218
           D+  TTG T A    L +  +    G ++    +   + L A     ++ + +  +E G 
Sbjct: 132 DVVATTGNTNAWESTLRVFCD---KGDVILAEAHSFSSCLAAAQAQGIITFPIPIDEHG- 187

Query: 219 SIDTNEIEKTIKKNAMTKGIQPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVIIA 277
            I   ++E+ I  N      +PK++  I  G NPTGS LS+D   KI+ +A K+  +II 
Sbjct: 188 -IIPEKLEQ-ILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIIIE 245

Query: 278 DEVY-------------QENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHSTSKGL 324
           DE Y             + N        +  + ++SL K F +   + ++  + S SK L
Sbjct: 246 DEPYYFLQIDEYVKDKDERNKLYSRPTPTHDEFVKSLAKTFLSVDTDGRVVRMDSFSKVL 305

Query: 325 FGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPPKQGDQSYQLDC 384
               G R G+  I G    +   +         P    Q+++   +     G   Y    
Sbjct: 306 --APGTRLGW--ITGSKKLLSAYVALHEMTIQAPAGFTQSIVSTTLH--NWGQSGYLDWL 359

Query: 385 IERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTKVIDEAKKFEMEPD 444
           I+ +  +N   + A    + +     I    P  A   F   + ++   D A KF+ +P 
Sbjct: 360 IKLRHEYNLKRDCAIDALNKYLPESPIFTVNPPIAGMFFTVNIDASAHPDFATKFDSDPA 419

Query: 445 --EFYCHELLNETGICTVPGSGFGQKPNT 471
             E + +E + + G+  VPG  F  + +T
Sbjct: 420 KVEQHIYETVVKHGVLVVPGVWFVTEGDT 448

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 104/241 (43%), Gaps = 21/241 (8%)

Query: 239 QPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVIIADEVY---QENLFNGN----- 289
           +PK++  I  G NPTGS LS+D   +I+ IA K+  +II DE Y   Q + +  +     
Sbjct: 209 KPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFIIIEDEPYYFLQMDAYEKDPSKRK 268

Query: 290 --KFHSCKKVLRSLQKQFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNL 347
             +F S  + + SL K F +     ++  + S SK L    G R G++  +G    +R  
Sbjct: 269 AIEFASHDEFVNSLAKSFISLDTEGRVIRMDSFSKVL--GPGTRLGWL--VGSKRILRAY 324

Query: 348 ILKLACIDVCPVVTGQAMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRA-KKLYDMFS 406
                     P    QA++   +   + G   +    I  +Q +N+  + A   LY    
Sbjct: 325 TQLHEMTIQNPSGFSQAIVSGTL--NRWGQHGFLDWLIGLRQEYNEKRDVAIDALYKYVP 382

Query: 407 HMEGIQCQKPQGAMYLFPRLLLSTKVIDEAKKFEMEPD--EFYCHELLNETGICTVPGSG 464
               +    P   M+ F   + ++   + A K++ +P+  E   +E +   G+  VPG  
Sbjct: 383 STPALTVTPPIAGMF-FTVNIDASAHPEFATKYQSKPELVEQAIYEKVIACGVLVVPGIW 441

Query: 465 F 465
           F
Sbjct: 442 F 442

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 75/326 (23%), Positives = 123/326 (37%), Gaps = 35/326 (10%)

Query: 160 DIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWS 219
           DI +TTG T      L +  N     +L     +    A       T  P  ++E     
Sbjct: 132 DIILTTGNTNGWESTLRVFCNKGDV-ILAEAHSFSSSLASAEAQGITTFPIPIDEHG--- 187

Query: 220 IDTNEIEKTIKKNAMTKGIQPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVIIAD 278
           I   ++E+ I  N      +PK++  I  G NPTG+ L+++  ++I+ IA K+  +II D
Sbjct: 188 IIPEKLEE-ILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDFLIIED 246

Query: 279 EVYQ--------ENLFNGNKFHSCKK-----VLRSLQKQFPTQYNNVQLASLHSTSKGLF 325
           E Y          +L    K     K      L SL K F +     ++  + S SK L 
Sbjct: 247 EPYYFLQMGEYIADLDERKKVQDVPKPTHDQFLGSLAKTFLSVDTEGRVIRMDSFSKVL- 305

Query: 326 GECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMI--LPPKQGDQSYQLD 383
              G R G++         + L+     +    V         ++  L  + G   Y +D
Sbjct: 306 -APGSRLGWL------TGSKKLLQPYISLHEMTVQAASGFTQSLVNGLLQRWGQDGY-ID 357

Query: 384 CI--ERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTKVIDEAKKFEM 441
            +   R +      N    LY+     E  +   P   M+    +  S     E  KF+ 
Sbjct: 358 WLIGLRHEYTLKRDNAIDALYEYAPKHEAFKINPPIAGMFFTINIDASIHPEFET-KFQS 416

Query: 442 EPD--EFYCHELLNETGICTVPGSGF 465
            P   E Y ++ +  +G+  VPG+ F
Sbjct: 417 NPAMVEQYIYDKVVRSGVLVVPGAWF 442

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 76/153 (49%), Gaps = 16/153 (10%)

Query: 183 QTGVLLPIPQYPLYTALLALHNATML--PYYLEEESGWSIDTNEIEKTIKKNAMTKGIQP 240
           Q  ++LP P Y +Y+    +++  ++  P  +E+ S + +D     +T+KK+ + +    
Sbjct: 110 QKIMVLP-PTYSMYSVCANINDVDVVNCPLIVEDNS-FQMDVKRTLETLKKDDLIR---- 163

Query: 241 KVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRS 300
            ++ I +PGNPTG I++   +I +     K G+V++ DE Y +  F+       KK    
Sbjct: 164 -LLFITSPGNPTGKIIAIKDIIYVLE-HWKNGLVVV-DEAYVD--FSTYFNEETKKTEYF 218

Query: 301 LQKQFPTQYNNVQLASLHSTSKGLFGECGQRGG 333
              +  T+Y N  L  L + SK  FG  G R G
Sbjct: 219 SVAKLVTKYPN--LTVLQTLSKS-FGLAGIRLG 248

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 81/177 (45%), Gaps = 21/177 (11%)

Query: 159 NDIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLALHNA--TMLPYYLEEES 216
           +++ +  G+  +   L+       +  +L+    Y +YT    +++     +P  L EE 
Sbjct: 88  DNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLLLSEED 147

Query: 217 GWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVII 276
            + ID  +I +T++ +   K     ++ I +PGNPTG+ +  + + KI +   + G+V++
Sbjct: 148 KFQIDEEKILETLQNDPSIK-----LVFITSPGNPTGTFIDVNRIEKILS-QWQTGLVVV 201

Query: 277 ADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHSTSKGLFGECGQRGG 333
            DE Y + +   +K                T+Y N+  A L + SK  FG  G R G
Sbjct: 202 -DEAYIDFVEGSDKGSLAP---------LATKYENI--AVLQTLSKS-FGLAGIRLG 245

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 86/179 (48%), Gaps = 24/179 (13%)

Query: 157 SPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATML--PYYLEE 214
           S +++ +  G+  +   L+       +  +L+  P Y +Y+    +++  ++  P  +E+
Sbjct: 86  SADNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVED 145

Query: 215 ESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIV 274
            S + ++T+++ +T++ ++       K+  + +PGNPTG+++   S+ KI +   + GIV
Sbjct: 146 NS-FQMNTDKVIETLQGDS-----NIKIAFVTSPGNPTGALIDIASIEKILS-QWQSGIV 198

Query: 275 IIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHSTSKGLFGECGQRGG 333
            I DE Y +       F S       L  ++P       LA L + SK  FG  G R G
Sbjct: 199 AI-DEAYID-------FCSTGGSAAPLVNKYP------NLAVLQTLSKS-FGLAGVRLG 242

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 56/125 (44%), Gaps = 7/125 (5%)

Query: 160 DIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWS 219
           DI  TTG+T      L I  N   T VLL    Y              +P  L+ E    
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDT-VLLEDYTYSSSVEAADAQGLNCVPMPLDGEG--- 187

Query: 220 IDTNEIEKTIKKNAMTKG--IQPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVII 276
           I  +++E+ +   +   G    PK++  I  G NPTG  LS++    I+ +A +Y I+II
Sbjct: 188 IVPSKLEEMLANWSSLYGEMPMPKLLYTIPTGQNPTGCTLSDNRKPHIYRLAQQYDIIII 247

Query: 277 ADEVY 281
            D+ Y
Sbjct: 248 EDDPY 252

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 65/272 (23%), Positives = 100/272 (36%), Gaps = 38/272 (13%)

Query: 239 QPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVIIADEVY----QENLFNGNKFH- 292
           +PK++  I  G NPTGS L  +   +++ IA K+  +I+ DE Y     E+         
Sbjct: 206 KPKLLYTIPTGQNPTGSSLDAERKSQVYKIAQKHDFLIVEDEPYYFLQMEDYVKDPSLRK 265

Query: 293 ----SCKKVLRSLQKQFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLI 348
               S  + L SL + F +   + ++  + S SK L    G R G+   I  +N +    
Sbjct: 266 EVKLSHDEFLASLDQTFLSIDTDGRVIRMDSFSKVL--APGSRLGW---ITCSNQIMKAY 320

Query: 349 LKLACIDVCPVVTGQAMMDLMILPPKQGDQSYQLDCI--ERQQIHNDMLNRAKKLYDMFS 406
           L L  + +     G     +     K G   Y LD +   R +      N     Y    
Sbjct: 321 LALYEMSMQ-AAAGFTQSIVSATLSKWGQHGY-LDWLLGLRHEYTLKRDNAIDACYKYIP 378

Query: 407 HMEGIQCQKPQGAMYLFPRLLLSTKVIDEAKKFEMEP--DEFYCHELLNETGICTVPGSG 464
             +      P   M+ F       K  +   KF+ +P   E Y +E   E+G+   PGS 
Sbjct: 379 QTDAFHINPPVAGMF-FTITFDGAKHPEFTTKFKSDPLLLESYLYEKAVESGVIIAPGSW 437

Query: 465 F----------------GQKPNTYHLRTTFLA 480
           F                   PN+   R TF A
Sbjct: 438 FITDGETIPPQPKESKESNNPNSVFFRGTFAA 469

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 24/32 (75%)

Query: 250 NPTGSILSEDSLIKIFNIAAKYGIVIIADEVY 281
           NPTG+I S  S +K+  +A KY I+II+D+VY
Sbjct: 198 NPTGAIYSRSSRLKLLELARKYDILIISDDVY 229

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 24/32 (75%)

Query: 250 NPTGSILSEDSLIKIFNIAAKYGIVIIADEVY 281
           NPTG+I S  S +K+  +A KY I+II+D+VY
Sbjct: 199 NPTGAIYSRSSRLKLLELARKYDILIISDDVY 230

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 55/112 (49%), Gaps = 18/112 (16%)

Query: 239 QPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVIIADEVY--------------QE 283
           +PK++  I  G NPTG+ L++D   +I+ IA K+  +II DE Y              +E
Sbjct: 205 RPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPYYFLQMDPYVEDVGKRE 264

Query: 284 NLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHSTSKGLFGECGQRGGYM 335
            L N  K  +  + L+SL + F +     ++  + S SK L    G R G++
Sbjct: 265 ELRNKPK-QTHDEFLKSLARTFLSVDTEGRVIRMDSFSKVL--APGTRLGWL 313

>TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa]
           {ON} Anc_8.204 YER152C
          Length = 444

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 75/181 (41%), Gaps = 33/181 (18%)

Query: 129 AYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSIL--SNGPQTG- 185
            Y + +G   +R+ + N I Q     ++ P  I +T+GA+     +L+IL  +  P TG 
Sbjct: 50  TYGSDEGALWVRQEVCNMINQIGSDINSKPEYINLTSGASYG---ILNILLQTTLPHTGY 106

Query: 186 ---VLLPIPQYPL---------------------YTALLALHNATMLPYYLEEESGWSID 221
                +  P Y L                     YT++   +    L Y+ +E     + 
Sbjct: 107 TKQAFIVSPTYFLINDCFIDAGFGSKMTAIKEKGYTSIDLEYLKEKLEYFEQEIP--DVP 164

Query: 222 TNEIEKTIKKNAMTKGIQPKVMVII-NPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEV 280
            N  +    KN + K I   V   I    NP+G     ++ I++  IA KY ++II D+V
Sbjct: 165 QNSTDIIQNKNNLQKKIYKYVFYCIPTFSNPSGITWDYETRIQLIKIAKKYDMLIICDDV 224

Query: 281 Y 281
           Y
Sbjct: 225 Y 225

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 53/124 (42%), Gaps = 5/124 (4%)

Query: 160 DIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWS 219
           DI  TTG+T      L I  N   T VLL    Y              +P  L+ E    
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDT-VLLEEYTYSSSVEAADAQGLNCIPMPLDGEG--I 188

Query: 220 IDTNEIEKTIKKNAMTKGI-QPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVIIA 277
           I     E  I  + +   I  PK++  I  G NPTG  LS+     I+++A KY ++II 
Sbjct: 189 IPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIE 248

Query: 278 DEVY 281
           DE Y
Sbjct: 249 DEPY 252

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 36/175 (20%), Positives = 78/175 (44%), Gaps = 24/175 (13%)

Query: 160 DIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATMLPYYL-EEESGW 218
           +I +  G+  +   L+ +     +  +++  P Y +Y+    +++   +   L  E++ +
Sbjct: 89  NICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVAEDNSF 148

Query: 219 SIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIAD 278
            +DT+++ +T+ ++   K     ++ I +PGNPT +++    + K+ N     G +++ D
Sbjct: 149 QMDTSKVLETLAQDPTIK-----LIFITSPGNPTAALIDTAEIEKVLN--NWTGGLVVVD 201

Query: 279 EVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHSTSKGLFGECGQRGG 333
           E Y            C      L  ++P       LA + + SK  FG  G R G
Sbjct: 202 EAY---------IDFCGGSTTPLVNKYP------NLAVIQTMSKS-FGLAGVRLG 240

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 57/135 (42%), Gaps = 27/135 (20%)

Query: 160 DIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYP----------LYTALLALHNATMLP 209
           DI  TTG+T A    L I  N   T VLL    Y           L    + + N  ++P
Sbjct: 133 DIITTTGSTQAWDASLRIFCNKGDT-VLLEEFTYSSSVEAADAQGLNCIPVPMDNQGIIP 191

Query: 210 YYLEEE-SGWSIDTNEIEKTIKKNAMTKGI-QPKVMVIINPG-NPTGSILSEDSLIKIFN 266
             LEE  S W+                 GI  PK++  I  G NPTG  LSE     I+ 
Sbjct: 192 EKLEEMLSNWT-------------DRYPGIPMPKLLYTIPTGQNPTGCTLSECRKPCIYR 238

Query: 267 IAAKYGIVIIADEVY 281
           +A KY I+I+ D+ Y
Sbjct: 239 LAQKYDILIVEDDPY 253

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 78/164 (47%), Gaps = 17/164 (10%)

Query: 130 YSASQGVYGIRKTIANYITQRDLGESASPN----DIFMTTGATAASSYLLSILSNGPQTG 185
           YS +QG+  +   I  +IT+  L  +   N    DI +  G++ +   +   L +   T 
Sbjct: 137 YSETQGMKPLLDFIKTFITK--LNNTPPYNETLYDIMLANGSSDSMFKVFETLCDESTTV 194

Query: 186 VLLPIPQYPLYTALLALHNATMLPYYLE---EESGWSIDTNEIEKTIKK---NAMTKGI- 238
           ++      P+ + ++A   A  +P  L    E+ G  ID   +E  +      + TK + 
Sbjct: 195 LMEEFTFVPVISNVMAT-GAKCIPLKLNLNYEDQG--IDIEYLENLLDNWGGKSNTKHLS 251

Query: 239 QPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVIIADEVY 281
           +PK++  I+ G NP G  LS +   KI+ IA ++ ++I+ D+ Y
Sbjct: 252 KPKILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDDPY 295

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 30/44 (68%)

Query: 250 NPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHS 293
           NP+G+  S++  +K+ ++A +Y I+II+D+VY    F+G +  S
Sbjct: 200 NPSGATYSQECRLKLLDLARRYDILIISDDVYDLLGFHGQRTDS 243

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 57/123 (46%), Gaps = 6/123 (4%)

Query: 160 DIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWS 219
           D  +TTG T      L I  N    G ++    +   ++L +     ++ + +  +S   
Sbjct: 132 DSILTTGNTNGWESTLRIFCN---KGDVILAEAHSFSSSLASAEAQGVITFPVPIDSDGI 188

Query: 220 IDTNEIEKTIKKNAMTKGIQPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVIIAD 278
           I   E  ++I  N      +PK++  I  G NPTGS LS++    I+ IA K+  +II D
Sbjct: 189 IP--EKLESILDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDFIIIED 246

Query: 279 EVY 281
           E Y
Sbjct: 247 EPY 249

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 38.1 bits (87), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 24/32 (75%)

Query: 250 NPTGSILSEDSLIKIFNIAAKYGIVIIADEVY 281
           NPTG+  S ++ +K+  IA KY ++IIAD+VY
Sbjct: 202 NPTGTTYSTETKLKLIEIARKYDMLIIADDVY 233

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 38.1 bits (87), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 83/193 (43%), Gaps = 27/193 (13%)

Query: 160 DIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLALHNA---TMLPYYLEEES 216
           D+  T G T A    L +  N  +  V+L   +   +++ LA   A   T  P  ++++ 
Sbjct: 133 DVVATAGNTNAWESTLRVFCN--RGDVILA--EAHSFSSCLAAAQAQGITTFPVPIDDKG 188

Query: 217 GWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVI 275
              I   ++E  I  N      +PK++  I  G NPTG+ L+++   +IF IA K+  +I
Sbjct: 189 ---IIPAKLE-AILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLI 244

Query: 276 IADEVY-------------QENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHSTSK 322
           I D  Y             +  +       S K  L SL K F +   + ++  L S SK
Sbjct: 245 IEDAPYYFLQMDKYERDLQKRAVTRAQPRESHKDFLASLDKTFLSVDTDGRVIRLDSFSK 304

Query: 323 GLFGECGQRGGYM 335
            L    G R G++
Sbjct: 305 VL--APGSRLGWI 315

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 37.7 bits (86), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 82/188 (43%), Gaps = 17/188 (9%)

Query: 160 DIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWS 219
           D+  T G T+A    L +  N    G  +   +Y   ++L+A     +  Y +  +    
Sbjct: 132 DVLATVGNTSAWESTLRVFCN---RGDTILAEEYTFSSSLVAAEAQGVRAYPVPLDENGM 188

Query: 220 IDTNEIEKTIKKNAMTKGI-QPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVIIA 277
           +     E          G+ +PK++  +  G NPTG+ LS D    ++ +A ++ ++I+ 
Sbjct: 189 VPERLGELLDNWERWHDGVPRPKLLYTVPTGQNPTGTCLSNDRRQAVYRLAQQHDLLIVE 248

Query: 278 DEVY---QENLFNGNK-------FHSCKKVLRSLQKQFPTQYNNVQLASLHSTSKGLFGE 327
           DE Y   Q + +  +        F S ++ + SL + F +   + ++  L S SK L   
Sbjct: 249 DEPYYFLQLDPYEADAGRRAPRVFASHEEFVGSLVRSFLSLDTDGRVLRLDSFSKVL--A 306

Query: 328 CGQRGGYM 335
            G R G++
Sbjct: 307 PGTRLGWI 314

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 37.4 bits (85), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 75/150 (50%), Gaps = 24/150 (16%)

Query: 186 VLLPIPQYPLYTALLALHNA--TMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVM 243
           +L+  P Y +Y+    +++     +P  +E+ S + +DT ++ +T++ +   K     ++
Sbjct: 115 ILIMPPTYGMYSICTDINDVEYVKVPLVVEDNS-FQMDTEKVIETLQNDPSIK-----LV 168

Query: 244 VIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQK 303
            I +PGNPTG+++  +++ K+ +   + G V++ DE Y +       F +    +  L  
Sbjct: 169 FITSPGNPTGALIKPENIEKLLS-QWQSGFVVV-DEAYID-------FCTTGGSVAPLVN 219

Query: 304 QFPTQYNNVQLASLHSTSKGLFGECGQRGG 333
           ++P       LA L + SK  FG  G R G
Sbjct: 220 KYP------NLAVLQTLSKS-FGLAGIRLG 242

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 37.0 bits (84), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 65/144 (45%), Gaps = 24/144 (16%)

Query: 191 PQYPLYTALLALHNATMLPYYL-EEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPG 249
           P Y +Y+   ++++  ++   L   ++ + +DT  +  T+KK+ + K     ++ I +PG
Sbjct: 117 PTYGMYSVCASVNDVEIVKCPLVTSDNSFQVDTEAVLDTLKKDPLIK-----LVFITSPG 171

Query: 250 NPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQY 309
           NPTG+ +    + KI       GI+++ DE Y            C      L  ++P   
Sbjct: 172 NPTGAKIETSRIEKILQ-NWDQGILVV-DEAY---------IDFCGGSTAPLVNKYP--- 217

Query: 310 NNVQLASLHSTSKGLFGECGQRGG 333
               + +L + SK  FG  G R G
Sbjct: 218 ---NICTLQTLSKS-FGLAGIRVG 237

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 37.4 bits (85), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 75/328 (22%), Positives = 136/328 (41%), Gaps = 38/328 (11%)

Query: 160 DIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLALHNA---TMLPYYLEEES 216
           DI  T G T A    L +  N  +  V+L   +   +++ LA   A   T  P  +++  
Sbjct: 133 DIIATAGNTNAWESTLRVFCN--RGDVILA--EAHSFSSCLAAAQAQGITTFPIPIDDNG 188

Query: 217 GWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVI 275
              I   ++EK I  N      +PK++  I  G NPTG+ L    + +I+ IA K+  +I
Sbjct: 189 ---IIPEKLEK-ILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHDFLI 244

Query: 276 IADEVY--------------QENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHSTS 321
           + D  Y              +  L +  K  + ++ L++L K F +  N+ ++  L S S
Sbjct: 245 VEDAPYYFLQMDKYVKDVNERTALRSQVKKQTHEEFLKALDKTFLSCDNDGRVIRLDSFS 304

Query: 322 KGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPPKQGDQSYQ 381
           K L    G R G+  I G  + +++ +         P    Q+ +   +   + G   Y 
Sbjct: 305 KVL--APGTRLGW--ITGCKSILKSFVSLHEMTIQAPSGMIQSFVSGTLH--RWGQNGY- 357

Query: 382 LDCIE--RQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTKVIDEAKKF 439
           LD ++  R +      N    L++     +      P   M+ F   + ++   +   K+
Sbjct: 358 LDWLQGLRHEYTLKRDNAIDALHEFLPKSDAFVINPPIAGMF-FTVNIDASAHPEFKTKY 416

Query: 440 EMEPD--EFYCHELLNETGICTVPGSGF 465
           E +P   E   +E + + G+  VPG+ F
Sbjct: 417 ESDPAKVENAIYEKVIQYGVLIVPGAWF 444

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 57/124 (45%), Gaps = 6/124 (4%)

Query: 160 DIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWS 219
           D+  T G+T A    L +  N  +T VL+    Y              +   ++++    
Sbjct: 128 DLITTAGSTQAWDACLRLFCNRGET-VLMEEYTYSSSLEAAVAQGLNCVAMKMDKDG--- 183

Query: 220 IDTNEIEKTIKK-NAMTKGIQPKVMVII-NPGNPTGSILSEDSLIKIFNIAAKYGIVIIA 277
           I  +++ + ++  +   +G  PK++  I N  NPTG  L E+   ++  +A++Y  +II 
Sbjct: 184 IKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIE 243

Query: 278 DEVY 281
           D+ Y
Sbjct: 244 DDPY 247

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 76/336 (22%), Positives = 134/336 (39%), Gaps = 43/336 (12%)

Query: 160 DIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWS 219
           D+F T G T A    L +  N    G ++    +   ++L +     ++ + +       
Sbjct: 134 DVFATAGNTNAWESTLRLFCN---RGDVILAEAHSFSSSLASAEAQGVITFPV------P 184

Query: 220 IDTNEI--EKTIK--KNAMTKGIQPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIV 274
           ID + I  EK  K   N      +PK++  I  G NPTG+ ++      I+ IA K+  +
Sbjct: 185 IDADGIIPEKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFL 244

Query: 275 IIADEVYQ--------ENLFNGNKFHSCKK-----VLRSLQKQFPTQYNNVQLASLHSTS 321
           I+ DE Y         ++L    K  +C K      L+SL   F +     ++  + S S
Sbjct: 245 IVEDEPYYFLQMNPYIKDLKEREKAQNCPKQDHDEFLKSLANTFLSLDTEGRVIRMDSFS 304

Query: 322 KGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPPKQGDQSYQ 381
           K L    G R G+  I G +  +++ +         P    Q ++   +   + G + Y 
Sbjct: 305 KVL--APGTRLGW--ITGSSRILKHYLSLHEMTVQSPAGFTQVLVSSTL--SRWGQKGY- 357

Query: 382 LDCIERQQIHNDMLNR---AKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTKVIDEAKK 438
           LD +   + H   L R      LY      +      P   M+    +  ST   + + K
Sbjct: 358 LDWLLGLR-HEYTLKRDCAIDALYKYLPQCDAFVINPPIAGMFFTVNIDASTHP-EFSTK 415

Query: 439 FEMEP---DEFYCHELLNETGICTVPGSGFGQKPNT 471
           +  +P   ++   H+++ E G+  VPGS F  +  T
Sbjct: 416 YNSDPYQLEQSIYHKVV-ERGVLVVPGSWFKSEGET 450

>TDEL0A02510 Chr1 (449069..450349) [1281 bp, 426 aa] {ON} Anc_2.475
           YKL106W
          Length = 426

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 82/177 (46%), Gaps = 12/177 (6%)

Query: 165 TGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNE 224
           TGA A +S LL++  +     V +  P +P +  +   +  T L  Y   ++G  +    
Sbjct: 122 TGALAVASKLLALFLS---RTVWISEPSWPNHQNIFRSNGFTDLRTYPYYQNGRLVVDEW 178

Query: 225 IEKTIKKNAMTKGIQPKVMVIINPG--NPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQ 282
           +EK   K  + K  + +  +I++    NPTG   + +  ++I +   + G++ I D  YQ
Sbjct: 179 LEKL--KTEVRKDPETRHSIILHACCHNPTGLDPTREEWVRILDTVHELGMIPILDMAYQ 236

Query: 283 ENLFNGNKFHSCKKVLRSL-QKQFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEII 338
             L +GN       +  +L +K++    N + +    + + GL+GE   R G + ++
Sbjct: 237 -GLESGNPPADAYVLRMALDEKRYKCWPNGLFVCQSFAKNMGLYGE---RVGSLSVV 289

>TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2.102
           YHR137W
          Length = 503

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 239 QPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLF 286
           +PK++  I  G NPTG  LS +   KI+ I  K+ I+I+ D+ Y   LF
Sbjct: 208 KPKMLYTIATGQNPTGMTLSMEKRRKIYEICQKHDIIILEDDPYGYLLF 256

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 34/54 (62%), Gaps = 1/54 (1%)

Query: 229 IKKNAMTKGIQPKVMVII-NPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVY 281
           I+  A+TK I   V+  I    NP+G+  S ++  ++ +IA KY +++I+D+VY
Sbjct: 174 IQGPALTKKIYKYVLYCIPTFANPSGNTYSLETRRRLIDIARKYDMLVISDDVY 227

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 77/337 (22%), Positives = 135/337 (40%), Gaps = 45/337 (13%)

Query: 160 DIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWS 219
           D+  T G T A    L +  N    G ++ +  +   ++L +     ++ + +       
Sbjct: 134 DVLATAGNTNAWESTLRVFCN---RGDVILVEAHSFSSSLASAEAQGVITFPV------P 184

Query: 220 IDTNEI--EKTIK--KNAMTKGIQPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIV 274
           ID + I  EK  K  +N      +PK++  I  G NPTG+ +++     I+ IA KY  +
Sbjct: 185 IDADGIIPEKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFL 244

Query: 275 IIADEVYQ--------ENLFNGNKFHSCKK-----VLRSLQKQFPTQYNNVQLASLHSTS 321
           I+ DE Y         ++L    K  S  K      L+SL   F +     ++  + S S
Sbjct: 245 IVEDEPYYFLQMNPYIKDLKEREKAQSSPKQDHDEFLKSLANTFLSLDTEGRVIRMDSFS 304

Query: 322 KGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPPKQGDQSYQ 381
           K L    G R G+  I G +  ++  +         P    Q +++  +   + G + Y 
Sbjct: 305 KVL--APGTRLGW--ITGSSKILKPYLSLHEMTIQAPAGFTQVLVNATL--SRWGQKGY- 357

Query: 382 LDCIERQQIHNDMLNR---AKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTKVIDEAK- 437
           LD +   + H   L R      LY      +      P   M+    + +   V  E K 
Sbjct: 358 LDWLLGLR-HEYTLKRDCAIDALYKYLPQSDAFVINPPIAGMFF--TVNIDASVHPEFKT 414

Query: 438 KFEMEP---DEFYCHELLNETGICTVPGSGFGQKPNT 471
           K+  +P   ++   H+++ E G+  VPGS F  +  T
Sbjct: 415 KYNSDPYQLEQSLYHKVV-ERGVLVVPGSWFKSEGET 450

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 239 QPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVIIADEVY 281
           +PK++  I  G NPTGS L+ +   +I+ IA K+  +II DE Y
Sbjct: 206 KPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIEDEPY 249

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 53/112 (47%), Gaps = 18/112 (16%)

Query: 239 QPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVIIADEVY--------------QE 283
           +PK++  I  G NPTG+ L  D    I+ IA K+  +I+ DE Y              +E
Sbjct: 205 KPKLLYTIPTGQNPTGTSLPNDRREAIYRIAQKHDFLIVEDEPYYFLQVGDYIEDLKKRE 264

Query: 284 NLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHSTSKGLFGECGQRGGYM 335
            +++  K  S ++  +SL K F +     ++  L S SK L    G R G++
Sbjct: 265 QVYSAPK-QSHEEFKKSLVKSFLSLDTEGRVIRLDSFSKVL--GPGTRLGWI 313

>Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,
           443 aa] {ON} complement(37728..38465,38468..39061) [1332
           nt, 444 aa]
          Length = 443

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 63/312 (20%), Positives = 127/312 (40%), Gaps = 28/312 (8%)

Query: 165 TGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNE 224
           TGA A +S LLS   +     V +P P +P +  +  ++    L YY     G       
Sbjct: 138 TGAIAVASKLLSSFISDT---VWIPNPSWPNHDNIFHMNGFKNLKYYSYYNDGKITIDRW 194

Query: 225 IEKTIKKNAMTKGIQPKVMVI-INPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQE 283
           +E T  +   +    P+ +++     NPTG   + D   +I +   +  ++ I D  YQ 
Sbjct: 195 LESTETEVRSSNSKLPQSIILHACCHNPTGFDPTIDQWNEIIDTVYELDMIPIIDMAYQ- 253

Query: 284 NLFNGNKFHSCKKVLRSL-QKQFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEII---- 338
            L +G+ +     +   L + ++    + + L    + + GL+GE   R G + I+    
Sbjct: 254 GLESGSLYDDAYLLRHCLDESRYKGWKHGLFLCQSFAKNMGLYGE---RVGSLSIVVPPN 310

Query: 339 ------GFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPPKQGDQSYQLDCIERQQIHN 392
                   ++ ++ ++  +      P   G  + +L++  P+  +Q +Q    +   I  
Sbjct: 311 LEKAKLSIDSQLKKIVRGIYS---SPPGYGCRIANLVLSQPELRNQWHQ----DVHSIVG 363

Query: 393 DMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLS-TKVIDEAKKFEMEPDEFYCHEL 451
            + N  K++YD      G+     Q  M+ F RL +   +++ +     +  D       
Sbjct: 364 RLTNVRKQMYDKLG-WSGLVDSSQQHGMFYFTRLDIDQVQLLKDKYSIYLTSDGRLSLSG 422

Query: 452 LNETGICTVPGS 463
           +N++ I  V GS
Sbjct: 423 INDSNIDYVCGS 434

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 55/121 (45%), Gaps = 16/121 (13%)

Query: 229 IKKNAMTKGIQPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVIIADE-------- 279
           I  N      +PK++  I  G NPTG+ +++     I+ IA K+  +I+ DE        
Sbjct: 198 IMDNWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFLIVEDEPYYFLQMN 257

Query: 280 VYQENLFNGNKFHSCKK-----VLRSLQKQFPTQYNNVQLASLHSTSKGLFGECGQRGGY 334
            Y ++L    K  S  K      L+SL K F +   + ++  + S SK L    G R G+
Sbjct: 258 AYIKDLKEREKAQSSPKQDHDEFLKSLSKTFLSLDTDGRVIRMDSFSKVL--APGTRLGW 315

Query: 335 M 335
           +
Sbjct: 316 I 316

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 54/102 (52%), Gaps = 9/102 (8%)

Query: 182 PQTG-VLLPIPQYPLYTALLALHNATMLPY-YLEEESGWSIDTNEIEKTIKKNAMTKGIQ 239
           P+T  VL+  P Y +Y+    +++  ++    + E++ + +D + + +T+  +   K   
Sbjct: 110 PKTDKVLVLPPTYSMYSVFAMINDTEVVECPLITEDNSFDMDLDNVLETLSNDDSIK--- 166

Query: 240 PKVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVY 281
             ++ I  PGNPTG+ +S   +  + N  +  GIV++ DE Y
Sbjct: 167 --LLFITTPGNPTGASISTQKIEMLLNNWSA-GIVVV-DEAY 204

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
           YER152C (REAL)
          Length = 450

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 229 IKKNAMTKGIQPKVMVII-NPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQ 282
           I+ + +TK I   VM  I    NP+G+  S ++  ++  IA KY +++I D+VY 
Sbjct: 181 IQGSKLTKKIYKYVMYCIPTFANPSGNTYSLETRRRLIEIARKYDMLVITDDVYD 235

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 27/133 (20%), Positives = 65/133 (48%), Gaps = 8/133 (6%)

Query: 150 RDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATMLP 209
           +DL +  +  ++ +  G+  +   ++       +  +L+  P Y +Y+    +++  ++ 
Sbjct: 78  KDLPQPLTAENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVK 137

Query: 210 YYL-EEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILSEDSLIKIFNIA 268
             L   ++ +  +T+E+ KT + +   K     ++ I +PGNPTG+ +    + KI    
Sbjct: 138 CPLITSDNSFQANTDEVIKTAQNDPSIK-----LIFITSPGNPTGAKVETSRIEKILQNW 192

Query: 269 AKYGIVIIADEVY 281
            + G+V++ DE Y
Sbjct: 193 DR-GMVVV-DEAY 203

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 71/147 (48%), Gaps = 17/147 (11%)

Query: 182 PQTGVLLPIP-QYPLYTALLALHNATMLPY-YLEEESGWSIDTNEIEKTIKKNAMTKGIQ 239
           P+   +L +P  Y +Y+    +++  ++    + E++ + ++  E+  T+K +      +
Sbjct: 107 PEVDKILTLPPTYSMYSVCANINDVEIVECPLITEDNSFQMNVPEVLSTLKNDP-----K 161

Query: 240 PKVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLR 299
            K++ I +PGNPTG ++++  +  I       G+V++ DE Y +       F   +    
Sbjct: 162 IKLLFITSPGNPTGKLVNKKDIEFILENWTN-GLVVV-DEAYID-------FADAEGTTY 212

Query: 300 SLQKQFPTQYNNVQLASLHSTSKGLFG 326
           S+ K   T+Y N+ +    S S GL G
Sbjct: 213 SMAK-LVTKYPNLTVLQTLSKSFGLAG 238

>Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar to
           Ashbya gossypii AGR167W
          Length = 488

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 60/125 (48%), Gaps = 7/125 (5%)

Query: 160 DIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWS 219
           D+ +T G+T A    L +  N P   VLL   +   Y++ +    A  +     E  G  
Sbjct: 129 DVLITAGSTQAWDASLRLFCN-PGDSVLL---ESWTYSSSVEAAEAQGMYCVGVEIDGHG 184

Query: 220 IDTNEIEKTIKK-NAMTKGIQ-PKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVII 276
           +   ++E  ++  + +  G   PK++ +I  G NP G  L+++    I+NI  KY +V+I
Sbjct: 185 VVPEKLEWLLQNWDDLHPGRSLPKLLYVIPTGQNPMGVTLADERKPLIYNIIQKYDMVLI 244

Query: 277 ADEVY 281
            D+ Y
Sbjct: 245 EDDPY 249

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 71/154 (46%), Gaps = 25/154 (16%)

Query: 181 GPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESG-WSIDTNEIEKTIKKNAMTKGIQ 239
           G +  ++LP P Y +Y+    +++  ++   L    G + +DT  +   +K +++ K   
Sbjct: 111 GKEKILVLP-PTYSMYSVCANINDIEVVQCPLTVSDGSFQMDTEAVLTILKNDSLIK--- 166

Query: 240 PKVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLR 299
             +M + +PGNPTG+ + + SLI+        G+V++ DE Y +          C     
Sbjct: 167 --LMFVTSPGNPTGAKI-KTSLIEKVLQNWDNGLVVV-DEAYVD---------FCGGSTA 213

Query: 300 SLQKQFPTQYNNVQLASLHSTSKGLFGECGQRGG 333
            L  ++P       L +L + SK  FG  G R G
Sbjct: 214 PLVTKYP------NLVTLQTLSKS-FGLAGIRLG 240

>Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar to
           Ashbya gossypii AGR141C
          Length = 446

 Score = 34.3 bits (77), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 51/113 (45%), Gaps = 5/113 (4%)

Query: 233 AMTKGIQPKVMVII-NPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKF 291
           + TK +   VM ++    NP+G   S  + +K+  +A KY I++I+D+VY   +++    
Sbjct: 181 SRTKKVYRYVMYLVPTFSNPSGKTYSVSTRLKLVELARKYDILLISDDVYDLLVYD-QPC 239

Query: 292 HSCKKVLRSLQKQFPTQYNNVQLASLHSTSKGLFGEC---GQRGGYMEIIGFN 341
            +  K L  L       Y   +    ++ S   F +    G R GY E +  N
Sbjct: 240 DALPKCLPRLTHLDRASYEYGENGYGNTISNATFSKVIAPGLRCGYQESVNMN 292

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 34.3 bits (77), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 239 QPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVIIADEVY 281
           +P ++  I+ G NPTG  +S ++  +I+ +A KY  +I+ D+ Y
Sbjct: 225 RPSILYTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPY 268

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 69/154 (44%), Gaps = 25/154 (16%)

Query: 181 GPQTGVLLPIPQYPLYTALLALHNATMLPY-YLEEESGWSIDTNEIEKTIKKNAMTKGIQ 239
           G +  + LP P Y +Y+    +++  +L    + E++ +  D+ ++   +  + + K   
Sbjct: 110 GKEKILTLP-PTYSMYSVCANINDVEVLECPLIYEDNSFQPDSQKVISILSSDPLIK--- 165

Query: 240 PKVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLR 299
             ++ + +PGNPTG+ +  + +IKI  + +  G  ++ DE Y            C     
Sbjct: 166 --LVFLTSPGNPTGAKIDSNIIIKI--LESWDGGFVVVDEAY---------IDFCGGSTA 212

Query: 300 SLQKQFPTQYNNVQLASLHSTSKGLFGECGQRGG 333
            L  ++P       L +L + SK  FG  G R G
Sbjct: 213 PLVTKYP------NLITLQTLSKS-FGLAGIRLG 239

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 111/264 (42%), Gaps = 32/264 (12%)

Query: 229 IKKNAMTKGIQPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQ----- 282
           I  N      +PK++  I  G NPTG+ +++     I+ IA K+  +I+ DE Y      
Sbjct: 198 IMDNWTAGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVEDEPYYFLQMN 257

Query: 283 ---ENLFNGNKFHSCKK-----VLRSLQKQFPTQYNNVQLASLHSTSKGLFGECGQRGGY 334
              ++L    K  S  K      L+SL   F +   + ++  + S SK L    G R G+
Sbjct: 258 PYIKDLKEREKAQSSPKQDHDEFLKSLANTFLSLDTDGRVIRMDSFSKVL--APGTRLGW 315

Query: 335 MEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPPKQGDQSYQLDCIERQQIHNDM 394
             I G +  ++  +         P    Q +++  +   + G + Y LD +   + H   
Sbjct: 316 --ITGSSKILKPYLSLHEMTIQAPAGFTQVLVNATL--SRWGQKGY-LDWLLGLR-HEYT 369

Query: 395 LNRAKKLYDMFSHMEGIQCQ----KPQGAMYLFPRLLLSTKVIDEAKKFEMEP---DEFY 447
           L R + +  ++ ++   QC      P  A   F   + ++   +   K+  +P   ++  
Sbjct: 370 LKRDRAIDALYKYLP--QCDTFVINPPIAGMFFTVNIDASAHPEFKTKYNSDPYQLEQAI 427

Query: 448 CHELLNETGICTVPGSGFGQKPNT 471
            H++++  G+  VPGS F  +  T
Sbjct: 428 YHKVVDR-GVLVVPGSWFKSEGET 450

>YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON}
           Protein with 2-aminoadipate transaminase activity;
           shares amino acid similarity with the aminotransferases
           Aro8p and Aro9p; YER152C is not an essential gene
          Length = 443

 Score = 33.9 bits (76), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 229 IKKNAMTKGIQPKVMVII-NPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVY 281
           I+   +TK +   VM  I    NP+G+  S ++  ++ +IA KY ++II D+VY
Sbjct: 174 IQGPKLTKKVYRYVMYCIPTFANPSGNTYSLETRRRLIDIARKYDMLIITDDVY 227

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 33.9 bits (76), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 69/149 (46%), Gaps = 25/149 (16%)

Query: 186 VLLPIPQYPLYTALLALHNATMLPY-YLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMV 244
           ++LP P Y +Y+    +++  ++    + E++ + ID  EI   +  + + K     ++ 
Sbjct: 115 LVLP-PTYSMYSVCANINDVDVVTCPLITEDNSFQIDATEILNILANDPLIK-----LVF 168

Query: 245 IINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQ 304
           I +PGNPTG+ +  D +  +       G+VI+ DE Y +  F+G                
Sbjct: 169 ITSPGNPTGAKIEIDRIEYLLK-NWDQGLVIV-DEAYID--FSGGS-----------TAP 213

Query: 305 FPTQYNNVQLASLHSTSKGLFGECGQRGG 333
             T+Y N  L +L + SK  FG  G R G
Sbjct: 214 LVTKYPN--LVTLQTLSKS-FGLAGIRLG 239

>Kpol_1035.30 s1035 (69909..71414) [1506 bp, 501 aa] {ON}
           (69909..71414) [1506 nt, 502 aa]
          Length = 501

 Score = 33.9 bits (76), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 239 QPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVIIADEVY 281
           +P V+  I  G NPTG  LS +   KI+ I  K+ I+I+ D+ Y
Sbjct: 208 KPTVLYTIATGQNPTGMTLSMEKRRKIYKICQKHDIIIVEDDPY 251

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 71/149 (47%), Gaps = 25/149 (16%)

Query: 186 VLLPIPQYPLYTALLALHNATMLPY-YLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMV 244
           ++LP P Y +Y+    +++  ++    + E++ + +D++++   +  +      + K++ 
Sbjct: 116 LVLP-PTYSMYSVCAKINDVEVVTCPLITEDNSFQMDSDKVLDILNNDQ-----EIKLLF 169

Query: 245 IINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQ 304
           I +PGNPTG+ +    + K+     + G+V++ DE Y +  F G                
Sbjct: 170 ITSPGNPTGAQIETARIEKVLQNWDR-GLVVV-DEAYVD--FCGGS-----------TAP 214

Query: 305 FPTQYNNVQLASLHSTSKGLFGECGQRGG 333
             T+Y N  L +L + SK  FG  G R G
Sbjct: 215 LVTKYQN--LVTLQTLSKS-FGLAGIRLG 240

>KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 445

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 35/61 (57%)

Query: 221 DTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEV 280
           +++E++     NA  K  +  + ++    NP G   S ++ +K+  +A K+ ++I++D+V
Sbjct: 168 NSSELQLITAPNANKKVYRYVIYLVPTYSNPGGQTYSLETRVKLIELARKHDMLIVSDDV 227

Query: 281 Y 281
           Y
Sbjct: 228 Y 228

>NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON}
           Anc_2.102
          Length = 510

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 239 QPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVIIADEVY 281
           +PK++  I+ G NP G  LS +   KI+ IA ++ ++I+ D+ Y
Sbjct: 223 KPKILYTISTGQNPMGMTLSMEKREKIYQIAQQHDLIILEDDPY 266

>KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {ON}
           Anc_8.204 YER152C
          Length = 443

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 3/67 (4%)

Query: 219 SIDTNEIEKTIKKNAMTKG--IQPKVMVII-NPGNPTGSILSEDSLIKIFNIAAKYGIVI 275
           SI  +   + I KN  +KG  I   V+  +    NP+G   S  + +++  +A KY I+I
Sbjct: 166 SIKADVGTQCITKNENSKGKKIYRYVLYCVPTYSNPSGHTYSLTTKLRLLELARKYDILI 225

Query: 276 IADEVYQ 282
           I D+VY 
Sbjct: 226 ITDDVYD 232

>CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152c
          Length = 436

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 232 NAMTKGIQPKVMVII-NPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQ 282
           N  TK +   VM  +    NP+G   S ++  K+  IA +Y ++II D+VY 
Sbjct: 175 NKPTKKVYKYVMYCVPTFANPSGKSYSLETRTKLIEIARRYDMLIICDDVYD 226

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 75/190 (39%), Gaps = 40/190 (21%)

Query: 130 YSASQGVYGIRKTIANYITQ------RDLGESASPNDIFMTTGATAASSYLLSIL--SNG 181
           Y +++G   +R  I  ++ +      RD    + P  + +T+GA+     +L+IL  +  
Sbjct: 51  YGSNEGALWVRTAITEFVNEKAFKFDRDDKARSKPEYLNLTSGASYG---VLNILLQATL 107

Query: 182 PQTGV----LLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKK------ 231
           P TGV     +  P Y L                ++E+   SID   +E  +K       
Sbjct: 108 PHTGVTKQAFIVSPTYFLINDCFIDAGFGGKLTAIDEKGEESIDLELLEAKLKHFESIDP 167

Query: 232 -------------------NAMTKGIQPKVMVIINPGNPTGSILSEDSLIKIFNIAAKYG 272
                              + + K  +  + VI    NP+G   + ++  K+  +A KY 
Sbjct: 168 NPVNENGKELSIIKNPIDISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKYD 227

Query: 273 IVIIADEVYQ 282
           ++II D+VY 
Sbjct: 228 MLIITDDVYD 237

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%)

Query: 249 GNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQ 282
            NP+G   S ++  K+ ++A KY ++IIAD+VY 
Sbjct: 205 ANPSGMSFSLETKKKLLDLARKYDMLIIADDVYD 238

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 71/154 (46%), Gaps = 25/154 (16%)

Query: 183 QTGVLLPIPQYPLYTALLALHNATMLPY-YLEEESGWSIDTNEIEKTIKKNAMTKGIQPK 241
           Q  +LLP P Y +Y     +++   +    +  ++ + ID + I + +    + K I  K
Sbjct: 113 QKVMLLP-PTYGMYKVCADINDVGYVEVPLISSDNSFQIDEDRILEQLN---LDKSI--K 166

Query: 242 VMVIINPGNPTGSILSEDSLIKIF-NIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRS 300
           V+ I +PGNPTG+ +    + K+  N  A  GIV++ DE Y +       F + K  L  
Sbjct: 167 VVFITSPGNPTGACIEVGRVEKLLRNWTA--GIVVV-DEAYID-------FSADKPSLSP 216

Query: 301 LQKQFPTQYNNVQLASLHSTSKGLFGECGQRGGY 334
           L  + P   N V L +L   S    G  G R G+
Sbjct: 217 LVNKHP---NLVVLQTLSKAS----GLAGIRLGF 243

>KLTH0B06270g Chr2 (508642..510219) [1578 bp, 525 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 525

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 239 QPKVMVIINPG-NPTGSILSEDSLIKIFNIAAKYGIVIIADEVY 281
           +PK++  I  G NPTG  LS +   +I+ +A K+  +II D+ Y
Sbjct: 239 KPKLLYTIPTGQNPTGMTLSFEKRKQIYALAEKHDFIIIEDDPY 282

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 81/185 (43%), Gaps = 25/185 (13%)

Query: 150 RDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALLALHNATMLP 209
           RDL    + N + +  G+  +   ++       +  +L+  P Y +Y+    +++  ++ 
Sbjct: 80  RDLATLTNEN-LCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCANINDIEVVE 138

Query: 210 Y-YLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILSEDSLIKIFNIA 268
              + E++ + ++++++   +K + + K     ++ I +PGNPTG  +    + K+    
Sbjct: 139 CPLIYEDNSFQLNSDKVLDILKNDPLIK-----LVFITSPGNPTGVKIETKRIEKVLQ-N 192

Query: 269 AKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHSTSKGLFGEC 328
              G+V++ DE Y +  F G                  TQY N  L  L + SK  FG  
Sbjct: 193 WDNGLVVV-DEAYID--FCGGSLAP-----------LVTQYQN--LIVLQTLSKS-FGLA 235

Query: 329 GQRGG 333
           G R G
Sbjct: 236 GIRLG 240

>Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 229 IKKNAMTKGIQPKVMVII-NPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVY 281
           I+ + ++K I   VM  I    NP+G+  S ++  ++ +IA +Y +++I D+VY
Sbjct: 174 IQGSKLSKKIFKYVMYCIPTFANPSGNTYSLETRRRLIDIARQYDMLVITDDVY 227

>NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204
          Length = 446

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 53/108 (49%), Gaps = 13/108 (12%)

Query: 250 NPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKF-----HSCKKVLRSLQKQ 304
           NP+G+  S  + +K+  +A +Y ++II+D+VY  +L +  +F     H  K+ +  L ++
Sbjct: 199 NPSGNTYSLKTKLKLIELARRYDMLIISDDVY--DLLDYEQFLDVLPHVPKRFVH-LDRE 255

Query: 305 FPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLA 352
             T   N    +L + +       G R GY E I        L+L+L+
Sbjct: 256 TSTHPENSFGNTLSNATFSKIIAPGLRFGYTESIS-----NKLVLQLS 298

>AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER152C
          Length = 438

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 47/101 (46%), Gaps = 5/101 (4%)

Query: 242 VMVII-NPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRS 300
           VM +I    NP+GS  S ++  ++  +A +Y +++I+D++Y + L          + L S
Sbjct: 182 VMYLIPTYSNPSGSTYSLETRTRLVELARRYDMLLISDDIY-DLLAYDQPSDQLPRALPS 240

Query: 301 LQKQFPTQYNNVQLASLHSTSKGLFGEC---GQRGGYMEII 338
           L        N  Q +  H+ +   F +    G R GY E +
Sbjct: 241 LVHVDRATLNEEQDSWGHTVANASFSKIVAPGLRCGYQESV 281

>KAFR0D03160 Chr4 (618891..620198) [1308 bp, 435 aa] {ON} Anc_2.475
           YKL106W
          Length = 435

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 79/196 (40%), Gaps = 15/196 (7%)

Query: 150 RDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYPLYTALL---ALHNA- 205
           +DL    +    F T   T A +     LS      + LP   +  +  +      HN+ 
Sbjct: 109 KDLKHFNNGVSFFQTLSGTGAIAITARFLSKFISNKIWLPNYSWANHINIFEKNGFHNSI 168

Query: 206 TMLPYYLEEESGWSIDT--NEIEKTIKKNAMTKGIQPKVMVI-INPGNPTGSILSEDSLI 262
               YY +     ++D   N++   + K+   K   P  +V+     NPTG   +++   
Sbjct: 169 NYYSYYNDTTGKLAVDKWLNDLRINVSKD---KSNVPHCIVLHACCHNPTGIDPTKEEWT 225

Query: 263 KIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQLASLHSTSK 322
           KI +   +  ++ I D  YQ  L +G+       VLRS  +     +N + L    + + 
Sbjct: 226 KIIDTVHELNMIPIIDMAYQ-GLESGDVVEDA-YVLRSCLQDNRKWHNGLYLCQSFAKNM 283

Query: 323 GLFGECGQRGGYMEII 338
           GL+GE   R G + II
Sbjct: 284 GLYGE---RVGSLSII 296

>KAFR0I00910 Chr9 (178296..180131) [1836 bp, 611 aa] {ON} Anc_4.78
           YGR009C
          Length = 611

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 8/67 (11%)

Query: 6   IQTDLHDFEPAPKLSIK-------DLNPNVIKAE-FAVRGTIPMKAQELQTQLNKNPHSL 57
           + TD+  F   P  S K       D N NV  AE  A+R   P    + +T  +++P+S+
Sbjct: 117 VNTDVESFASNPYTSFKTNMMKSNDTNKNVSNAERTAIRSQDPYSMSDRRTAPSQDPYSM 176

Query: 58  PFNEITV 64
           P    TV
Sbjct: 177 PDRRTTV 183

>KAFR0B06830 Chr2 complement(1421910..1423913) [2004 bp, 667 aa]
           {ON} Anc_4.354 YJR130C
          Length = 667

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 53/127 (41%), Gaps = 17/127 (13%)

Query: 193 YP-LYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIK-KNAMTKGIQPKVMVIINPGN 250
           YP  Y  L  L+N   LPY            +EI+   K KN +  G Q   ++I  P  
Sbjct: 369 YPDTYKMLKTLNNVYCLPY-----------VSEIDCMNKLKNILHSGEQILAVLIEAPST 417

Query: 251 PTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYN 310
           P   +L   +L+++  ++  +G +II DE      FN +       V  SL K F     
Sbjct: 418 P---LLKMGNLLELKELSNLFGFIIIVDETVG-GFFNVDALVHADVVCTSLTKIFSGDVG 473

Query: 311 NVQLASL 317
           NV   ++
Sbjct: 474 NVMAGAM 480

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 68/154 (44%), Gaps = 25/154 (16%)

Query: 181 GPQTGVLLPIPQYPLYTALLALHNATMLPY-YLEEESGWSIDTNEIEKTIKKNAMTKGIQ 239
           G +  ++LP P Y +Y+    +++  ++    L + + + +DT  +   ++ + + K   
Sbjct: 112 GKEKILVLP-PTYSMYSVCAEINDIEIVECPLLYKNNSFQMDTESVLTVLQNDPLIK--- 167

Query: 240 PKVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLR 299
             ++ I +PGNPTG+ +  + +  +       G+V++ DE Y            C     
Sbjct: 168 --LLFITSPGNPTGARIETERIETVLQNWTD-GLVVV-DEAY---------IDFCGGSTA 214

Query: 300 SLQKQFPTQYNNVQLASLHSTSKGLFGECGQRGG 333
            L  ++P       L +L + SK  FG  G R G
Sbjct: 215 PLVTKYP------NLVTLQTLSKS-FGLAGIRLG 241

>Ecym_5125 Chr5 complement(266853..268550) [1698 bp, 565 aa] {ON}
           similar to Ashbya gossypii ABL104C
          Length = 565

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 3/64 (4%)

Query: 223 NEIEKTIKKNAMTKGIQPKVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQ 282
           N +E   K  AM    QPKV+   +  + +GS+     + KI ++A KYG +   DEV+ 
Sbjct: 252 NNLEHLEKLLAMYPKSQPKVIAFESVYSMSGSVAD---IRKICDLAEKYGALTFLDEVHS 308

Query: 283 ENLF 286
             L+
Sbjct: 309 VGLY 312

>NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa]
           {ON} Anc_8.204 YER152C
          Length = 478

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%)

Query: 232 NAMTKGIQPKVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQ 282
           N+M K  +  +  + +  NP+G   S  +  K+ ++A  Y I+II D+VY+
Sbjct: 208 NSMKKIYKYVLYCVPSFANPSGKSYSLKTKRKLIDLACLYDILIITDDVYE 258

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,438,626
Number of extensions: 2475872
Number of successful extensions: 6746
Number of sequences better than 10.0: 140
Number of HSP's gapped: 6861
Number of HSP's successfully gapped: 140
Length of query: 501
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 387
Effective length of database: 40,409,475
Effective search space: 15638466825
Effective search space used: 15638466825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)