Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0J013508.265ON42240417970.0
YDR113C (PDS1)8.265ON3733652102e-17
NCAS0B038308.265ON3251402046e-17
Skud_4.3748.265ON3733831969e-16
SAKL0H16962g8.265ON3363081711e-12
Smik_4.3588.265ON3713011613e-11
TDEL0F039208.265ON3221431471e-09
Suva_2.2738.265ON3762101426e-09
KLLA0F19206g8.265ON263621131e-05
AGR083W8.265ON2951611095e-05
ZYRO0C01584g8.265ON2821231096e-05
KLTH0G13618g8.265ON3022911033e-04
Kwal_56.237818.265ON293351024e-04
KAFR0B055108.265ON27570970.002
KNAG0H032308.265ON281145950.003
Kpol_543.418.265ON306156940.004
Ecym_43058.265ON311150940.004
TPHA0A017808.265ON35227920.007
CAGL0L12298g8.265ON28660760.63
TBLA0E044608.265ON27732731.3
SAKL0G08448g5.368ON115556704.7
Smik_8.1875.419ON60032696.7
ADR069C7.330ON57564687.1
CAGL0J01419g2.476ON100639688.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0J01350
         (422 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8....   696   0.0  
YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...    86   2e-17
NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.26...    83   6e-17
Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...    80   9e-16
SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...    70   1e-12
Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON...    67   3e-11
TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...    61   1e-09
Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...    59   6e-09
KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...    48   1e-05
AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...    47   5e-05
ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly ...    47   6e-05
KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakl...    44   3e-04
Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C...    44   4e-04
KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8....    42   0.002
KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.26...    41   0.003
Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON} ...    41   0.004
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...    41   0.004
TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.2...    40   0.007
CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]...    34   0.63 
TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {...    33   1.3  
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    32   4.7  
Smik_8.187 Chr8 (306643..308445) [1803 bp, 600 aa] {ON} YHR109W ...    31   6.7  
ADR069C Chr4 complement(828649..830376) [1728 bp, 575 aa] {ON} S...    31   7.1  
CAGL0J01419g Chr10 complement(130812..133832) [3021 bp, 1006 aa]...    31   8.6  

>NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8.265
           YDR113C
          Length = 422

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/404 (87%), Positives = 353/404 (87%)

Query: 1   MSSTNGNNKVNPDEDKENASTFYDHHQHFRSGKPILFPQTPAHLLKRSSSILSKQKPDIK 60
           MSSTNGNNKVNPDEDKENASTFYDHHQHFRSGKPILFPQTPAHLLKRSSSILSKQKPDIK
Sbjct: 1   MSSTNGNNKVNPDEDKENASTFYDHHQHFRSGKPILFPQTPAHLLKRSSSILSKQKPDIK 60

Query: 61  PGNLELQLQSDAGAGAVPPNISPRRQLLQLQNRFPLSKKDNNNSFILKQQQQQFDHKRLK 120
           PGNLELQLQSDAGAGAVPPNISPRRQLLQLQNRFPLSKKDNNNSFILKQQQQQFDHKRLK
Sbjct: 61  PGNLELQLQSDAGAGAVPPNISPRRQLLQLQNRFPLSKKDNNNSFILKQQQQQFDHKRLK 120

Query: 121 KYGSVLGLGTDGNNHNNLTRIKSLVLKDIDDDDNAGSHTDNSTNGNIRGSLNYSAIPNLD 180
           KYGSVLGLGTDGNNHNNLTRIKSLVLKDIDDDDNAGSHTDNSTNGNIRGSLNYSAIPNLD
Sbjct: 121 KYGSVLGLGTDGNNHNNLTRIKSLVLKDIDDDDNAGSHTDNSTNGNIRGSLNYSAIPNLD 180

Query: 181 FNIDTIQERRKGSXXXXXXXXXXXXXLFGLKLKHAMXXXXXXXXSDGSGLLFHDSNHGLH 240
           FNIDTIQERRKGS             LFGLKLKHAM        SDGSGLLFHDSNHGLH
Sbjct: 181 FNIDTIQERRKGSDDDSEDDDTGADDLFGLKLKHAMNNNNNNNNSDGSGLLFHDSNHGLH 240

Query: 241 QLINFNKKNMPEKNSISQSVKLDNKKXXXXXXXXXXXXAPIREDSLPYIPQGYTPFTNED 300
           QLINFNKKNMPEKNSISQSVKLDNKK            APIREDSLPYIPQGYTPFTNED
Sbjct: 241 QLINFNKKNMPEKNSISQSVKLDNKKEDTYDEEDDIEYAPIREDSLPYIPQGYTPFTNED 300

Query: 301 INKLKVYHSPFAIHHDHSDYQQSPSTLGDPEMLLSLQSFDXXXXXXXXXXXXXXXXXXTP 360
           INKLKVYHSPFAIHHDHSDYQQSPSTLGDPEMLLSLQSFD                  TP
Sbjct: 301 INKLKVYHSPFAIHHDHSDYQQSPSTLGDPEMLLSLQSFDTQTATTSSSCASPSLYPTTP 360

Query: 361 IHKDTNINTTDQKHNTVILNVHNNDNESEGEYGGEHDQEIDKIY 404
           IHKDTNINTTDQKHNTVILNVHNNDNESEGEYGGEHDQEIDKIY
Sbjct: 361 IHKDTNINTTDQKHNTVILNVHNNDNESEGEYGGEHDQEIDKIY 404

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 107/365 (29%), Positives = 147/365 (40%), Gaps = 127/365 (34%)

Query: 14  EDKENASTFYDHHQHFRSGKPILFPQTPAHLLKRS-SSILSKQKPDIKPGNLELQLQSDA 72
           EDKEN   +  +     SG  I FPQTPAHLLKRS S+IL   KP ++   L+    S+ 
Sbjct: 6   EDKENNIVYTGNES---SG--INFPQTPAHLLKRSHSNIL---KPPVRLDQLKRDANSNN 57

Query: 73  G-------AGAVPPNISPRRQL---LQLQNRFPLSKKDNNNS--FILKQQQQQF------ 114
           G        G     +SP ++L    Q Q R PL+ KDNN S  FI  +   Q       
Sbjct: 58  GNTLKYIQGGK---EVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLP 114

Query: 115 ----------------------------------DHKRLKKYGSVLGLGTDGNNHNNLTR 140
                                             + ++L+KYGSVLG       +N L +
Sbjct: 115 QLQNTLSIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLG-------YNALPK 167

Query: 141 IKSLVLKDI-DDDDNAGSHTDNSTNGNIRGSLNYSAIPNLDFNIDTIQERRKGSXXXXXX 199
           +KSLVLKD+ D   N  S  D+  N +    L                            
Sbjct: 168 MKSLVLKDLADSGKNEESSDDDEGNEDSESKL---------------------------- 199

Query: 200 XXXXXXXLFGLKLKHAMXXXXXXXXSDGS-----GLLFHDSNHGLHQLINFNKKNMPEKN 254
                    G KL+ A+        SDG      GL   +   GL QLI  + KN  +K 
Sbjct: 200 ---------GKKLQSALLKQDS---SDGENELNGGLGLFNEQGGLQQLIKNSTKN-EQKT 246

Query: 255 SISQSVKLDNKKXXXXXXXXXXXXAPIREDSLPYIPQGYTPFTNEDINKLKVYHSPFAIH 314
              +S K D+              AP R++ LPY+P+GY+PF  +DI KLK ++SP+ + 
Sbjct: 247 KNDKSDKTDD---------YDIEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLD 297

Query: 315 HDHSD 319
            +  D
Sbjct: 298 LEDED 302

>NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.265
           YDR113C
          Length = 325

 Score = 83.2 bits (204), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 64/140 (45%), Positives = 84/140 (60%), Gaps = 25/140 (17%)

Query: 10  VNPDEDKENASTFYDHHQHFRSGKPILFPQTPAHLL-KRSSSILSKQKPDIKPGNLELQL 68
           ++ +EDKEN +T Y+ H H  + +  L P+TPAHLL KRS S +      +KP ++    
Sbjct: 3   LDTNEDKENKTT-YESHVH-STKQSHLMPETPAHLLLKRSLSTV------LKPNSV---- 50

Query: 69  QSDAGAGAVPPNISPRR-QLLQLQNRFPLSKKDNNNSFILKQQQQQFDHKRLKKYGSVLG 127
                A     NISPRR QLLQLQNR PL+KKDNNNS    ++    + K+LKKYGSVLG
Sbjct: 51  ----NATDELGNISPRRRQLLQLQNRLPLAKKDNNNSSFSSRKNGLNNIKKLKKYGSVLG 106

Query: 128 LGTDGNNHNNLTRIKSLVLK 147
           +       + L R KSL+LK
Sbjct: 107 M-------DALPRTKSLILK 119

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/154 (35%), Positives = 73/154 (47%), Gaps = 39/154 (25%)

Query: 208 FGLKLKHAMXXXXXXXXSDG----SGL---LFHDSNH-------GLHQLINFNKKNMPEK 253
           FGLKL++AM         +     SGL   LFHD+         GL QLI  N K     
Sbjct: 137 FGLKLRNAMKQHENNSNEEENEGMSGLGIGLFHDNEDNSKSKLGGLQQLIRENTKERSTS 196

Query: 254 N------SISQSVKLDNKKXXXXXXXXXXXXAPIREDSLPYIPQGYTPFTNEDINKLKVY 307
                  +I Q    D +             APIRE+ LP++P GYTPFT EDINKLK +
Sbjct: 197 KIRSPLKTIGQDTDSDRE----------IEYAPIREEPLPFVPFGYTPFTPEDINKLKTF 246

Query: 308 HSPFAIHHDHSDYQQSP-STLGDPEMLLSLQSFD 340
           HS + +         SP ST+ D + LL+L++ +
Sbjct: 247 HSSYKL--------DSPVSTVEDADKLLALETIE 272

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score = 80.1 bits (196), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 109/383 (28%), Positives = 155/383 (40%), Gaps = 124/383 (32%)

Query: 13  DEDKENASTFYDHHQHFRSGKPILFPQTPAHLLKRS-SSILSKQKPDIKPGNLELQLQSD 71
           +EDKEN   +  +     SG  I FPQTPAHLLKRS S++L   KP ++   L+  L S+
Sbjct: 4   NEDKENNIVYTGNES---SG--INFPQTPAHLLKRSHSNVL---KPPVRLDQLKKDLNSN 55

Query: 72  AGAGAV----PPNISPRRQL---LQLQNRFPLSKKDNNNS----FI------------LK 108
            G G         +SP ++L    Q Q R PL+ KDNN S    F+            + 
Sbjct: 56  NGKGLKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIP 115

Query: 109 QQQQQF----------------------------DHKRLKKYGSVLGLGTDGNNHNNLTR 140
           QQQ                               + ++L+KYGSVLG       +N L +
Sbjct: 116 QQQNTLSIRKNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLG-------YNALPK 168

Query: 141 IKSLVLKDIDDDDNAGSHTDNSTNGNIRGSLNYSAIPNLDFNIDTIQERRKGSXXXXXXX 200
           +KSLVLKD+     AG   +  ++ +  GS                              
Sbjct: 169 MKSLVLKDL-----AGPAKNQESSDDDDGS------------------------------ 193

Query: 201 XXXXXXLFGLKLKHAMXXXXXXX---XSDGSGLLFHDSNHGLHQLINFNKKNMPEKNSIS 257
                   G+KL++A            S+G   LF++   GL QLI    K         
Sbjct: 194 -EGPESKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQG-GLQQLIKNTTKG-------- 243

Query: 258 QSVKLDNKKXXXXXXXXXXXXAPIREDSLPYIPQGYTPFTNEDINKLKVYHSPFAIHHDH 317
              K  +K+            AP R++ LPY+P GY  F  EDI KL+ ++SP+ +  D 
Sbjct: 244 ---KQGSKEEDDDDDDYEIEIAPQRQEPLPYVPDGYPSFQREDIEKLRTFNSPYEL--DL 298

Query: 318 SDYQQSPSTLGDPEMLLSLQSFD 340
            D+  S   +G    LLSL+  D
Sbjct: 299 EDHGDSVDRVG----LLSLEVID 317

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 336

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 85/308 (27%), Positives = 119/308 (38%), Gaps = 82/308 (26%)

Query: 37  FPQTPAHLLKRSSSI---LSKQKPDIKPGNLELQLQS----------DAGAGAVPPNISP 83
            P TP+HLLKRS S    L+   P  K G   L L S          + G  +   N++P
Sbjct: 17  LPTTPSHLLKRSQSFMKPLASNSPTKKSGK-RLPLASKDNNKSNTLINNGQKSALVNLAP 75

Query: 84  RRQLL---QLQNRFPLSKKDNNNSFI----LKQQQQQFDHKRLKKYGSVLGLGTDGNNHN 136
              LL   +L+   P+    N  SFI     K         RLKKYGSVLG       +N
Sbjct: 76  NNSLLHGGKLKRNRPVV--SNTGSFINTNTSKSSFPLLPDSRLKKYGSVLG-------YN 126

Query: 137 NLTRIKSLVLKDIDDDDNAGSHTDNSTNGNIRGSLNYSAIPNLDFNIDTIQERRKGSXXX 196
            L R+KSLVLKD+D +   G   +                P                   
Sbjct: 127 GLPRVKSLVLKDVD-ERKVGKSEEGEEEEEDDDEEEEEDNP------------------- 166

Query: 197 XXXXXXXXXXLFGLKLKHAMXXXXXXXXSDGS-GLLFHDSNHGLHQLINFNKKNMPEKNS 255
                         KL  A+         +GS GLL   SN GL QL+    +N+ E  +
Sbjct: 167 -----------LAAKLLKALNNHNEDDKEEGSIGLL--GSNTGLQQLLKH--RNVEEGEN 211

Query: 256 ISQSVKLDNKKXXXXXXXXXXXXAPIREDSLPYIPQGYTPFTNEDINKLKVYHSPFAIHH 315
               +++                 P   + LP++P GY+PF   D+ KL  + SPF++H 
Sbjct: 212 SDFEIEI----------------VPPHSEELPHVPNGYSPFKESDVIKLNTFTSPFSMHK 255

Query: 316 DHSDYQQS 323
           + SD ++ 
Sbjct: 256 EDSDCEEC 263

>Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON}
           YDR113C (REAL)
          Length = 371

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 87/301 (28%), Positives = 126/301 (41%), Gaps = 53/301 (17%)

Query: 37  FPQTPAHLLKRSSSILSKQKPDIKPGNLELQLQSDAGAGAVPP--------NISPRRQL- 87
           FPQTPAHLLKRS S +      +KP     QL+ D  +              +SP ++L 
Sbjct: 23  FPQTPAHLLKRSHSNV------LKPPTRLDQLKKDVNSNNCNALKYIQGGKEVSPTKRLH 76

Query: 88  --LQLQNRFPLSKKDNNNS----FILKQQQQQFDHKRLKKYGSVLGLGTDGNNHNNLTRI 141
              Q Q R PL+ KDNN +    FI +   Q  D   + +  + L +       N+  R 
Sbjct: 77  THAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNTLSI-----RKNDQLR- 130

Query: 142 KSLVLKDIDDDDNAGSHTD---NSTNGNIRGS-LNYSAIPNLDFNI--DTIQERRKGSXX 195
               L  I  + N  +H+D   N+      GS L Y+A+P +   +  D +   +     
Sbjct: 131 ---KLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLVDPGKNEESS 187

Query: 196 XXXXXXXXXXXLFGLKLKHAMXXXXXXXXS---DGSGLLFHDSNHGLHQLINFNKKNMPE 252
                          KL++A+             G   LF++   GL QLI    KN  +
Sbjct: 188 DDDDGSEGSENKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQG-GLQQLI----KNSVQ 242

Query: 253 KNSISQSVKLDNKKXXXXXXXXXXXXAPIREDSLPYIPQGYTPFTNEDINKLKVYHSPFA 312
             S S+S   D  +            AP R D LPY+P GY+PF  EDI KLK ++SP+ 
Sbjct: 243 NESKSKSDNADGYEIEI---------APQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPYE 293

Query: 313 I 313
           +
Sbjct: 294 L 294

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 70/143 (48%), Gaps = 41/143 (28%)

Query: 35  ILFPQTPAHLLKRSSSILSKQKPDIKPGNLELQLQSDAGAGAVPPNISPRRQLLQLQNRF 94
           + FPQTPAHLLKRS S + K   +  P NL  +        A     SP R++   Q R 
Sbjct: 21  VSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYR-----DCDAPVKRASPSRRV--QQGRP 73

Query: 95  PLSKKDNNNS--FI---------------LKQQQQQ----------FDHKRLKKYGSVLG 127
           PL+ KDNN S  F+               L Q +++           + +RLKKYGSVLG
Sbjct: 74  PLASKDNNRSTGFLPQLQKLQQQPSLKRNLSQSKKRNANVVDGQLLTNPRRLKKYGSVLG 133

Query: 128 LGTDGNNHNNLTRIKSLVLKDID 150
                  +N L ++KSLVLKD+D
Sbjct: 134 -------YNALPKMKSLVLKDVD 149

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%)

Query: 263 DNKKXXXXXXXXXXXXAPIREDSLPYIPQGYTPFTNEDINKLKVYHSPFAIH 314
           D+KK             P R + LPYIP+G+     ED +KLK + SP+ I 
Sbjct: 201 DSKKDEDDWEDREIEYGPQRHEPLPYIPEGHLSLAQEDYDKLKTFRSPYLIE 252

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 90/210 (42%), Gaps = 76/210 (36%)

Query: 13  DEDKENASTFYDHHQHFRSGKPILFPQTPAHLLKRS-SSILSKQKPDIKPGNLELQLQSD 71
           +EDKEN   +  +     S     FPQTPAHLLKRS S++L   KP ++   L+  + S+
Sbjct: 4   NEDKENNIVYTGNESSSTS-----FPQTPAHLLKRSHSNVL---KPPVRLDQLKKDVNSN 55

Query: 72  AGAGAV----PPNISPRRQL---LQLQNRFPLSKKDNNNS----------------FILK 108
           +G           +SP ++L    Q Q R PL+ KDNN S                 I+ 
Sbjct: 56  SGKNLKYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVP 115

Query: 109 QQQQQF----------------------------DHKRLKKYGSVLGLGTDGNNHNNLTR 140
           QQQ                               + ++L+KYGSVLG       +N L +
Sbjct: 116 QQQNTLSTRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLG-------YNALPK 168

Query: 141 IKSLVLKDI---------DDDDNAGSHTDN 161
           +KSLVLKD+          DDD+    TDN
Sbjct: 169 MKSLVLKDLADPAKNQESSDDDDGSEGTDN 198

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%)

Query: 279 APIREDSLPYIPQGYTPFTNEDINKLKVYHSPFAI 313
           AP R++ LPY+P GY PF  EDI KLK ++SP+ +
Sbjct: 260 APQRQEPLPYVPDGYPPFQQEDILKLKTFNSPYGL 294

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113C PDS1 Securin that inhibits anaphase
           by binding separin Esp1p also blocks cyclin destruction
           and mitotic exit essential for cell cycle arrest in
           mitosis in the presence of DNA damage or aberrant
           mitotic spindles also present in meiotic nuclei
          Length = 263

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 35/62 (56%), Gaps = 6/62 (9%)

Query: 279 APIREDSLPYIPQGYTPFTNEDINKLKVYHSPFAIHHDHSDYQQSPSTLGDPEMLLSLQS 338
           AP R+  LPYIP GY PF  E I KL+ + SPF +     D ++      DPE L+SL +
Sbjct: 160 APKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEER-----DPE-LISLAA 213

Query: 339 FD 340
            D
Sbjct: 214 TD 215

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 42/94 (44%), Gaps = 26/94 (27%)

Query: 77  VPPNISPRRQLLQLQNRFPLSKKDNN----------NSFI------LKQQQQQF----DH 116
            P N   R   L   NR PL+ KDNN          N+ +      LK+    F      
Sbjct: 23  TPLNQMKRTDSLVRGNRRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASSFMKNMPE 82

Query: 117 KRLKKYGSVLGLGTDGNNHNNLTRIKSLVLKDID 150
            +LKKYGSVLG+ T       + R KSLVLKD +
Sbjct: 83  NKLKKYGSVLGMNT------FMPRTKSLVLKDTE 110

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 61/161 (37%), Gaps = 70/161 (43%)

Query: 14  EDKENASTFYDHHQHFRSGKPILFPQTPAHLLKRSSSILSKQKPDIKPGNLELQLQSDAG 73
           EDKEN  T         +G+  + P+TP H LKRSSS                       
Sbjct: 5   EDKENLVT--------SAGRGAMMPRTPIHQLKRSSS----------------------- 33

Query: 74  AGAVPPNISPRRQLLQLQNRFPLSKKDNNNS---FILKQQ-------------------- 110
                 N++ R        R PL+ KD N S   F LK                      
Sbjct: 34  ------NLAGRN-----STRMPLASKDRNQSQGVFGLKTSGAGGAGGAQAQSKRPASSSI 82

Query: 111 QQQFDHKRLKKYGSVLGLGTDGNNHNNLTRIKSLVLKDIDD 151
            +     +LKKYGSVLG+G     + +L + KSLVLKD  D
Sbjct: 83  AKNMPDSKLKKYGSVLGVG-----YGSLAKAKSLVLKDTSD 118

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 279 APIREDSLPYIPQGYTPFTNEDINKLKVYHSPFAIHHDHSDYQQSPSTLGDPEMLLSLQ 337
           AP +   LP++P GY    + D+ KL  YHSPF    D  D + +    GD + L+ L+
Sbjct: 183 APEKLPELPHVPNGYESLKSADLAKLAKYHSPFLRFGDKEDEENTEP--GDSQQLIPLE 239

>ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 282

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 60/123 (48%), Gaps = 34/123 (27%)

Query: 35  ILFPQTPAHLLKRSSSILSKQKPDIKPGNLELQLQSDAGAGAVPPNISPRRQLLQLQNRF 94
           +  PQTP HLLKRS           +P  L+ +  +         ++SP R     Q R 
Sbjct: 23  LALPQTPIHLLKRS-----------QPNVLKPEENTPVKKSR---SVSPVRG----QRRL 64

Query: 95  PLSKKDNNNSFI---LKQQQQQF------DHKRLKKYGSVLGLGTDGNNHNNLTRIKSLV 145
           PL+ KD+N S     +K++Q         + ++L+KYGSVLG       + +L R KSLV
Sbjct: 65  PLASKDHNKSSAAGPVKKRQPTLQGELLSNPRKLQKYGSVLG-------YTDLPRTKSLV 117

Query: 146 LKD 148
           LKD
Sbjct: 118 LKD 120

>KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1
          Length = 302

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 67/291 (23%), Positives = 103/291 (35%), Gaps = 91/291 (31%)

Query: 37  FPQTPAHLLKRSSSILSKQKPDIKPGNLELQLQSDAGAGAVPPNISPRRQLLQLQNRFPL 96
            P TP HLL RS S +                           N SP+R     + R PL
Sbjct: 17  VPVTPRHLLSRSQSFMK--------------------------NKSPKRA----EARRPL 46

Query: 97  SKKDNNNSFI---LKQQQQQFDHKRLKKYGSVLGLGTDGN----NHNNLTRIKSLVLKDI 149
           + KDNN S      K+  ++     +   GS +G    G     N +   +IKSLVLKD 
Sbjct: 47  ASKDNNRSVSYLGTKEPLRKRTRPGVNHAGSFVGNARLGPAPTLNASGAPKIKSLVLKDG 106

Query: 150 DDDDNAGSHTDNSTNGNIRGSLNYSAIPNLDFNIDTIQERRKGSXXXXXXXXXXXXXLFG 209
            +++ + S        +   S   +A                                  
Sbjct: 107 IEEEGSQSEGAEVDEDDDDDSNRLAA---------------------------------- 132

Query: 210 LKLKHAMXXXXXXXXSDGSGLLFHDSNHGLHQLINFNKKNMPEKNSISQSVKLDNKKXXX 269
            KL+  +         + +GLL   +  GL  L+        E++   Q V++       
Sbjct: 133 -KLRTKLLSRDRDAEGEQTGLL--GATGGLQSLLGPKLSQRAEESDSDQEVEV------- 182

Query: 270 XXXXXXXXXAPIREDSLPYIPQGYTPFTNEDINKLK-VYHSPFAIHHDHSD 319
                     P R + LP++P+GYTPF  ++I KL+ V  SPF ++    D
Sbjct: 183 ---------IPPRPEPLPHVPEGYTPFGEQEIAKLQGVDVSPFQLNFSGVD 224

>Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C
           (PDS1) - 42-kDa nuclear protein [contig 173] FULL
          Length = 293

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 25/35 (71%), Gaps = 1/35 (2%)

Query: 280 PIREDSLPYIPQGYTPFTNEDINKLK-VYHSPFAI 313
           P R + LP+IP GYTPFT+EDI KL+    SPF +
Sbjct: 181 PPRPEPLPHIPHGYTPFTDEDIGKLQDTEASPFQL 215

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 64/150 (42%), Gaps = 44/150 (29%)

Query: 37  FPQTPAHLLKRSSSILSKQKPDIKPGNLELQLQSDAGAGAVPPNISPRRQLLQLQNRFPL 96
            P TP HLL RS S +                           NISP+R     + R PL
Sbjct: 17  VPVTPTHLLSRSQSFMK--------------------------NISPKRA----EQRKPL 46

Query: 97  SKKDNNNS--FI-LKQQQQQFDHKRLKKYGSVLGLGTDGN----NHNNLTRIKSLVLK-D 148
           + KDNN S  F+  K+  ++     +   GS +G    G     N N   RIKSLVLK D
Sbjct: 47  ASKDNNKSTGFLGAKEPLRKRTRPTVNHAGSFIGNTRPGVVPILNTNGAPRIKSLVLKDD 106

Query: 149 IDDD---DNAGSHTDNSTN---GNIRGSLN 172
           I+++    + G   D+ +N     +RG LN
Sbjct: 107 IEEEQSQSDGGEAEDDESNSLAAKLRGKLN 136

>KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8.265
           YDR113C
          Length = 275

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 43/70 (61%), Gaps = 8/70 (11%)

Query: 81  ISPRRQLLQLQNRFPLSKKDNN--NSFILKQQQQQFDHKRLKKYGSVLGLGTDGNNHNNL 138
           ISP ++L Q Q + PL  K+ N  NS ++  +    ++ R+KKYGS+LGL   GN    L
Sbjct: 36  ISPLKRLQQ-QGKLPLQSKNGNKSNSILISHKG---NNTRIKKYGSILGLENPGNFK--L 89

Query: 139 TRIKSLVLKD 148
            + KSL+LKD
Sbjct: 90  PKTKSLILKD 99

>KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.265
           YDR113C
          Length = 281

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 61/145 (42%), Gaps = 48/145 (33%)

Query: 14  EDKENASTFYDHHQHFRSGKPILFPQTPAHLLKRSSSILSKQKPDIKPGNLELQLQSDAG 73
           EDKENA               +  PQTPA      S+IL      +KP           G
Sbjct: 5   EDKENA---------------VAVPQTPA------SNILDGSGVVLKP-------VGSRG 36

Query: 74  AGAVPPNISPRRQLLQLQNRFPLSKKDNNNSFIL----------KQQQQQFDHKRLKKYG 123
             +     SP R       R PL+ KDNN S ++           Q ++    ++LK+YG
Sbjct: 37  KQSFSVRKSPTRG-----GRLPLASKDNNASGLVVSGKLGRQPADQVREANSSRKLKRYG 91

Query: 124 SVLGLGTDGNNHNNLTRIKSLVLKD 148
           S+LG      ++  LTR KSL+LKD
Sbjct: 92  SLLGY-----DNRQLTRSKSLILKD 111

>Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON}
           complement(90836..91756) [921 nt, 307 aa]
          Length = 306

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 61/156 (39%), Gaps = 65/156 (41%)

Query: 29  FRSGKPILFPQTPAHLLKRSSSIL-SKQKPDIKPGNLELQLQSDAGAGAVPPNISPRRQL 87
           FR       PQTP +LLKR+ S L +    DI+ GN+               N SP    
Sbjct: 10  FRHAMLKDMPQTPNNLLKRTHSKLKTGIAKDIQGGNV--------------INTSP---- 51

Query: 88  LQLQNRFPLSKKDNNNS----------------------------------FILKQQQQQ 113
              Q R PL+ KDNN S                                   I +Q +  
Sbjct: 52  ---QKRLPLASKDNNRSNSFLNNSNVNLNFNINNNNNNNNNNINNNNIKKQHIFQQNKSG 108

Query: 114 F--DHKRLKKYGSVLGLGTDGNNHNNLTRIKSLVLK 147
              D ++LKKYGSVLG       +N L ++KSLVLK
Sbjct: 109 ILADDRKLKKYGSVLG-------YNALPKVKSLVLK 137

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%)

Query: 288 YIPQGYTPFTNEDINKLKVYHSPFAIHHDHSDYQQSPSTL 327
           YIP  + PF   DI KLK ++SPF +   +SD ++  S L
Sbjct: 206 YIPDDHLPFDENDIAKLKTFNSPFKLEQSNSDDEEDSSEL 245

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 72/150 (48%), Gaps = 42/150 (28%)

Query: 14  EDKENASTFYDHHQHFRSGKPILFPQTPAHLLKRSSS-----------ILSKQKPDIKPG 62
           EDKEN  T  +      SG   + P+TP H LKRS+S           + SK +   + G
Sbjct: 5   EDKENIPTGSEP-----SGS--IVPRTPMHQLKRSTSNVHLKNNSRLPLASKDRNRSQSG 57

Query: 63  -NLELQLQSDAGAGAVPPNISPRRQLLQLQNRFPLSKKDNNNSFILKQQQQQFDHKRLKK 121
            NL+ QL      G V          +  QN+   SK+  +NSF+     +     +LKK
Sbjct: 58  FNLKQQLVQGHVGGGV----------MVGQNK---SKRPASNSFV-----KNMPDSKLKK 99

Query: 122 YGSVLGLGTDGNNHNNLTRIKSLVLKDIDD 151
           YGSVLG+     N+ +LT+ KSLVLKD  D
Sbjct: 100 YGSVLGV-----NYPHLTKTKSLVLKDASD 124

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 22/41 (53%)

Query: 279 APIREDSLPYIPQGYTPFTNEDINKLKVYHSPFAIHHDHSD 319
           AP +   L +IP GY  F +E+I KL  Y SPF    D  +
Sbjct: 197 APEKVPELEHIPNGYEQFEDEEIVKLATYTSPFLRFADREE 237

>TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.265
           YDR113C
          Length = 352

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 286 LPYIPQGYTPFTNEDINKLKVYHSPFA 312
           L Y P+GY PF NEDI KL  + SP++
Sbjct: 244 LSYSPEGYIPFNNEDIKKLNTFKSPYS 270

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 43/75 (57%), Gaps = 17/75 (22%)

Query: 92  NRFPLSKKDNNNS-----FILKQQQQQFDHK-----------RLKKYGSVLGLGTDGNNH 135
           NR PL+ KDNNNS     FIL+  +   + +           +L+KYGS+LG+  +GNN 
Sbjct: 75  NRLPLASKDNNNSRRSNSFILQNNKLVLNKQLSLLNNNQTSNKLRKYGSILGVNNNGNNT 134

Query: 136 NNLTR-IKSLVLKDI 149
           N     +KSL+LKDI
Sbjct: 135 NKTLNPVKSLILKDI 149

>CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113c cell cycle regulator
          Length = 286

 Score = 33.9 bits (76), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 9/60 (15%)

Query: 279 APIREDSLPYIPQGYTPFTNEDINKLKVYHS---PFAIHHDHSDYQQSPSTLGD--PEML 333
           A +RE   PY P+GY P  + D+ KLK+ ++   P  I     D  ++ S +GD  P++L
Sbjct: 164 ASVREPEKPYEPEGYEPLDDSDLEKLKLKNAINRPTFIM----DSPRAISIVGDDSPQLL 219

>TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {ON}
           Anc_8.265 YDR113C
          Length = 277

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 21/32 (65%), Gaps = 3/32 (9%)

Query: 118 RLKKYGSVLGLGTDGNNHNNLTRIKSLVLKDI 149
           RLKKYGSVLG     NN  N    K+L+LKDI
Sbjct: 102 RLKKYGSVLGY---SNNTINSNASKTLILKDI 130

>SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} similar
           to uniprot|P32361 Saccharomyces cerevisiae YHR079C IRE1
           Serine-threonine kinase and endoribonuclease
           transmembrane protein that initiates the unfolded
           protein response signal by regulating synthesis of Hac1p
           through HAC1 mRNA splicing
          Length = 1155

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 124 SVLGLGTDGNNHNNLTRIKSLVLKDIDDDDNAGSHTDNSTNGNIRGSLNYSAIPNL 179
           S+L L T+  N  +LT  + L++ DI+     G H  N  NG +  S+N +  P L
Sbjct: 143 SMLSLSTNRKNLESLTLAQLLIVTDIE----GGIHALNRQNGEVLWSINNTNFPPL 194

>Smik_8.187 Chr8 (306643..308445) [1803 bp, 600 aa] {ON} YHR109W
           (REAL)
          Length = 600

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 4/32 (12%)

Query: 280 PIREDSLPYIPQGYTPFTNEDINKLKVYHSPF 311
           PI ED + Y P  +T F  E+IN+    HSPF
Sbjct: 569 PICEDPVSYTPDKFTDFFQEEINQ----HSPF 596

>ADR069C Chr4 complement(828649..830376) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL153C
           (SAS10)
          Length = 575

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%)

Query: 86  QLLQLQNRFPLSKKDNNNSFILKQQQQQFDHKRLKKYGSVLGLGTDGNNHNNLTRIKSLV 145
           Q+L+ +   P  KKDN NS + K+++ +   K+LK   +V   G +G      T I+  V
Sbjct: 508 QILKNKGLTPKRKKDNRNSRVKKRKKFEKAQKKLKSVRAVYSGGQNGAYEGEQTGIRKNV 567

Query: 146 LKDI 149
            K +
Sbjct: 568 TKSV 571

>CAGL0J01419g Chr10 complement(130812..133832) [3021 bp, 1006 aa]
           {ON} weakly similar to uniprot|Q04279 Saccharomyces
           cerevisiae YMR086w
          Length = 1006

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 100 DNNNSFILKQQQQQFDHKRLKKYGSVLGLGTDGNNHNNL 138
           DNN+S +LKQQ+  F+  +LK+     G G +  N NN+
Sbjct: 457 DNNDSPLLKQQK--FEENKLKESIEAFGKGANEGNENNV 493

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.131    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,344,251
Number of extensions: 2118799
Number of successful extensions: 8717
Number of sequences better than 10.0: 116
Number of HSP's gapped: 8922
Number of HSP's successfully gapped: 131
Length of query: 422
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 310
Effective length of database: 40,638,807
Effective search space: 12598030170
Effective search space used: 12598030170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)