Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0J013308.268ON31431416600.0
NCAS0B038108.268ON3142628751e-117
KLTH0G13552g8.268ON2812497881e-104
YDR116C (MRPL1)8.268ON2852467861e-104
Smik_4.3608.268ON2852617791e-103
SAKL0H16896g8.268ON2852937741e-102
Suva_2.2758.268ON2852467591e-100
Kwal_56.237758.268ON2812487581e-100
Kpol_392.38.268ON2812937581e-100
TPHA0J007708.268ON2782917501e-98
Skud_4.3768.268ON2852707441e-97
KLLA0F19272g8.268ON2662457316e-96
TDEL0F039508.268ON2762467161e-93
Ecym_43028.268ON2752567049e-92
ZYRO0C01518g8.268ON2772446979e-91
KNAG0H032108.268ON2852426874e-89
CAGL0B01815g8.268ON2902476814e-88
KAFR0B054808.268ON2802456752e-87
AGR080W8.268ON2752476535e-84
TBLA0I031908.268ON2412224271e-50
Kpol_1052.262.548ON31464750.52
Kpol_1054.571.529ON18543730.65
KNAG0A074603.408ON1040183750.71
KNAG0D024308.90ON38372731.0
Skud_12.364.28ON101679712.2
Kwal_27.101998.849ON57253712.4
Skud_1.197.32ON85161703.5
Kwal_27.99241.521ON322150684.0
Suva_1.247.32ON84961669.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0J01330
         (314 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.2...   644   0.0  
NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.26...   341   e-117
KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} simil...   308   e-104
YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}  M...   307   e-104
Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}...   304   e-103
SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} simil...   302   e-102
Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}...   296   e-100
Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C...   296   e-100
Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519) ...   296   e-100
TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {O...   293   1e-98
Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}...   291   1e-97
KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa] ...   286   6e-96
TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON...   280   1e-93
Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to...   275   9e-92
ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar...   273   9e-91
KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.26...   269   4e-89
CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {O...   266   4e-88
KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8....   264   2e-87
AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic hom...   256   5e-84
TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON...   169   1e-50
Kpol_1052.26 s1052 complement(86331..87275) [945 bp, 314 aa] {ON...    33   0.52 
Kpol_1054.57 s1054 (143198..143755) [558 bp, 185 aa] {ON} (14319...    33   0.65 
KNAG0A07460 Chr1 (1170179..1173301) [3123 bp, 1040 aa] {ON} Anc_...    33   0.71 
KNAG0D02430 Chr4 (431696..432847) [1152 bp, 383 aa] {ON} Anc_8.9...    33   1.0  
Skud_12.36 Chr12 complement(68300..71350) [3051 bp, 1016 aa] {ON...    32   2.2  
Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284...    32   2.4  
Skud_1.19 Chr1 (38703..41258) [2556 bp, 851 aa] {ON} YAL041W (REAL)    32   3.5  
Kwal_27.9924 s27 (121448..122416) [969 bp, 322 aa] {ON} YJR070C ...    31   4.0  
Suva_1.24 Chr1 (39893..42442) [2550 bp, 849 aa] {ON} YAL041W (REAL)    30   9.7  

>NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/314 (100%), Positives = 314/314 (100%)

Query: 1   MMLHSLKITRNTRMCALRLPSNNYGVITRMLNTRSFHISRTSSLAAVAATEDASESKSTT 60
           MMLHSLKITRNTRMCALRLPSNNYGVITRMLNTRSFHISRTSSLAAVAATEDASESKSTT
Sbjct: 1   MMLHSLKITRNTRMCALRLPSNNYGVITRMLNTRSFHISRTSSLAAVAATEDASESKSTT 60

Query: 61  SGTNMPPANATKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGR 120
           SGTNMPPANATKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGR
Sbjct: 61  SGTNMPPANATKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGR 120

Query: 121 PEGQQTITLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVG 180
           PEGQQTITLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVG
Sbjct: 121 PEGQQTITLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVG 180

Query: 181 GNETVEGIKDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLM 240
           GNETVEGIKDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLM
Sbjct: 181 GNETVEGIKDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLM 240

Query: 241 NAKMGNIPFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTT 300
           NAKMGNIPFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTT
Sbjct: 241 NAKMGNIPFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTT 300

Query: 301 LSSTHGPGIVIDFV 314
           LSSTHGPGIVIDFV
Sbjct: 301 LSSTHGPGIVIDFV 314

>NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  341 bits (875), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 164/262 (62%), Positives = 213/262 (81%), Gaps = 2/262 (0%)

Query: 53  ASESKSTTSGTNMPPANATKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRF 112
           A E+ STT+   +P      LSKEQLKKRE+RRLSQRK +A++PA+ HPLYM VV+ALR+
Sbjct: 55  AEEAASTTTSATIPVVPT--LSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRY 112

Query: 113 IRAAEVGRPEGQQTITLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKS 172
           IRAAEVGRP GQQTITLT+L+V+EKG + LNG++ L RPLK LK+AVFS ++ELL  +K 
Sbjct: 113 IRAAEVGRPSGQQTITLTSLVVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKE 172

Query: 173 QFNCQLVGGNETVEGIKDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTV 232
           +++C LVGG E +  IK+G ++ +FD AFA+ ++   +++QLGK LGRRG+LPN KKGTV
Sbjct: 173 KYHCHLVGGVELINKIKNGEVKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTV 232

Query: 233 SDDLVTLMNAKMGNIPFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKR 292
           SDDL +L+  K+G++PF+QTGN ISI IGKC+FSD++IL NIIAAR A  +AL+ QK+K+
Sbjct: 233 SDDLESLLADKIGSLPFRQTGNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKK 292

Query: 293 PSILSKTTLSSTHGPGIVIDFV 314
           PSIL KTTLSSTHGPGIVIDF+
Sbjct: 293 PSILGKTTLSSTHGPGIVIDFI 314

>KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 281

 Score =  308 bits (788), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 146/249 (58%), Positives = 195/249 (78%), Gaps = 1/249 (0%)

Query: 66  PPANAT-KLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQ 124
           P  NAT KLSK+QLKKRE+RR +Q+K  AR+PA+ HPLYM V  ALRF+RAAEVG+P+ Q
Sbjct: 32  PVGNATSKLSKDQLKKREVRRFAQKKAAARRPASEHPLYMPVDKALRFLRAAEVGQPQSQ 91

Query: 125 QTITLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNET 184
           QT+++TT+++SE+G  LL+GN+     LKELKIAVF+ D++  +  + +FNC +VGG+E 
Sbjct: 92  QTLSVTTIVISERGAPLLSGNVSFPNALKELKIAVFTNDEQQAQIAREKFNCHVVGGSEL 151

Query: 185 VEGIKDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKM 244
           VE IK G +  +FD +FATPEI   + SQLG+ LG RG+LP  KKGTVS++L +L+   M
Sbjct: 152 VEKIKQGQVPLDFDKSFATPEIATLLASQLGRILGPRGLLPAAKKGTVSENLESLIKDSM 211

Query: 245 GNIPFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSST 304
           G +PF+Q GNNISI +G+C F+DK +L NI+AA+ + KEALANQKAK+PS+L +TTL+ST
Sbjct: 212 GTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSVKEALANQKAKKPSLLGQTTLTST 271

Query: 305 HGPGIVIDF 313
            GPGIVIDF
Sbjct: 272 RGPGIVIDF 280

>YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}
           MRPL1Mitochondrial ribosomal protein of the large
           subunit
          Length = 285

 Score =  307 bits (786), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 142/246 (57%), Positives = 195/246 (79%)

Query: 68  ANATKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTI 127
           +NA  L+K+Q KKRE++RL QRK +A++PA + PLYM V  ALR++RAAEVGRP+ QQTI
Sbjct: 39  SNAPSLTKDQAKKRELKRLVQRKAEAKRPATASPLYMPVTKALRYLRAAEVGRPQSQQTI 98

Query: 128 TLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEG 187
            LTTL+V E+GT+ L+G++   +PL+ +KIA F+ D+  LEE++ ++   L+GG + V  
Sbjct: 99  NLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAFTNDESKLEELREKYPNHLIGGADLVAK 158

Query: 188 IKDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNI 247
           IK G I  +FD AFATP+IVP + SQ+ + LG RG+LP+ KKGTVSDD+ +L+   +G++
Sbjct: 159 IKSGEISVDFDKAFATPDIVPALQSQVARILGPRGVLPSVKKGTVSDDISSLLQESLGSM 218

Query: 248 PFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGP 307
           PF+Q GN+ISI +GKCYF+D++IL NII+AR AFK A+ NQK+K+P+ILSKTTLSSTHGP
Sbjct: 219 PFRQRGNSISIGVGKCYFTDREILQNIISARAAFKTAVDNQKSKKPNILSKTTLSSTHGP 278

Query: 308 GIVIDF 313
           GIVIDF
Sbjct: 279 GIVIDF 284

>Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  304 bits (779), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 144/261 (55%), Positives = 201/261 (77%), Gaps = 5/261 (1%)

Query: 53  ASESKSTTSGTNMPPANATKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRF 112
           A E K T   +N P      L+K+Q KKRE++RL+QRK +A++PA ++PLYM V  ALR+
Sbjct: 29  AEEYKPTAMSSNAP-----SLTKDQAKKRELKRLAQRKAEAKRPAATNPLYMPVTMALRY 83

Query: 113 IRAAEVGRPEGQQTITLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKS 172
           +RAAEVGRP+ QQTI LTTL+V E+GT+ L+G++   +PL+ +K+A F+ D+  LEE++ 
Sbjct: 84  LRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAAFTNDENKLEELRK 143

Query: 173 QFNCQLVGGNETVEGIKDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTV 232
           ++   L+GG + V  IK G I  +FD AFATP+IVP + SQ+ + LG RG+LP+ KKGTV
Sbjct: 144 KYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVARILGPRGVLPSLKKGTV 203

Query: 233 SDDLVTLMNAKMGNIPFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKR 292
           SDD+ +L+   +G++PF+Q GN+IS+ +GKCYFSD++IL NII+AR AFK A+ NQK+K+
Sbjct: 204 SDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARSAFKAAVNNQKSKK 263

Query: 293 PSILSKTTLSSTHGPGIVIDF 313
           P++LSKTTLSSTHGPGIVIDF
Sbjct: 264 PNLLSKTTLSSTHGPGIVIDF 284

>SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 285

 Score =  302 bits (774), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 160/293 (54%), Positives = 213/293 (72%), Gaps = 16/293 (5%)

Query: 21  SNNYGVITRMLNTRSFHISRTSSLAAVAATEDASESKSTTSGTNMPPANATKLSKEQLKK 80
           S++YG+IT  ++      +RTS      A +  SE  ST          ATKLSK+QLK+
Sbjct: 8   SSSYGIITLPISC-----TRTSLFHTFTALK--SEEPSTI---------ATKLSKDQLKR 51

Query: 81  REIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTITLTTLIVSEKGTS 140
           RE+RRL QRK  AR+PA  HPLYM V  ALRF+RAAEVG+P+ QQTI+LTTL++SE+G  
Sbjct: 52  RELRRLVQRKAAARKPAADHPLYMPVTQALRFLRAAEVGQPQSQQTISLTTLVISERGAP 111

Query: 141 LLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEGIKDGTIRANFDVA 200
            LNGN+   +PLK++KIAVF+ D++ L+  + QFNC LVGG+E +E IK G +  +FD A
Sbjct: 112 QLNGNISFPKPLKDVKIAVFTNDEDKLKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKA 171

Query: 201 FATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNIPFKQTGNNISIPI 260
           FATP+I   + SQLG+ LG RG+LPN KKGTV++D+ +L+   MG +PF+Q GN ISI +
Sbjct: 172 FATPDIAISLTSQLGRILGPRGLLPNAKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAV 231

Query: 261 GKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGPGIVIDF 313
            KC F+D  +L NI+AA+ +FK ALANQKAK+PSIL +TTL++THGPG+VIDF
Sbjct: 232 AKCSFTDTQVLENILAAQKSFKLALANQKAKKPSILGQTTLTTTHGPGLVIDF 284

>Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  296 bits (759), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 195/246 (79%)

Query: 68  ANATKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTI 127
           +NA  L+K+Q KKRE++RL+QR+ +A++PA + PL+M V  ALR++RAAEVGRP+ QQTI
Sbjct: 39  SNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSPLHMPVTMALRYLRAAEVGRPQSQQTI 98

Query: 128 TLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEG 187
            LTTL+V E+GT+ ++GN+   +PL+ +K+AVF+ D+  L+E++ ++   +VGG + V  
Sbjct: 99  NLTTLVVGERGTAPISGNVTFSKPLRYVKVAVFTNDEVKLKELREKYPNLIVGGTDLVAK 158

Query: 188 IKDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNI 247
           IK+     +FD AFATP+IVP + SQ+ + LG RG+LP+ KKGTVSDD+ +L+   +G++
Sbjct: 159 IKNNESPVDFDKAFATPDIVPTLQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSM 218

Query: 248 PFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGP 307
           PF+Q GN IS+ IGKCYF+D+++L NII+AR AF+ A+ NQKAK+PS+LSKTTLSSTHGP
Sbjct: 219 PFRQRGNAISLGIGKCYFTDRELLQNIISARTAFRAAVDNQKAKKPSLLSKTTLSSTHGP 278

Query: 308 GIVIDF 313
           GIVIDF
Sbjct: 279 GIVIDF 284

>Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C -
           Hypothetical ORF [contig 173] FULL
          Length = 281

 Score =  296 bits (758), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 136/248 (54%), Positives = 188/248 (75%)

Query: 66  PPANATKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQ 125
           P    +KLSK+QL+KREIR+L+Q+K  AR+PA  HPLYM V  ALRF+RAAE G+P  QQ
Sbjct: 33  PSPVVSKLSKDQLRKREIRKLAQKKAAARRPATDHPLYMPVDKALRFLRAAEAGQPHSQQ 92

Query: 126 TITLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNETV 185
           T+++TT+++SE+G   L+GN+   +PLK+LKIAVF+ D++  +  + +F C LVGG++ V
Sbjct: 93  TLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIAREKFGCHLVGGSDLV 152

Query: 186 EGIKDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMG 245
           E IK+G +  +FD +FATPEI   + SQLG+ LG RG+LP  KKGTV+++L  L+   MG
Sbjct: 153 EKIKEGAVSLDFDKSFATPEITTLLASQLGRILGPRGLLPAAKKGTVAENLEPLLKNSMG 212

Query: 246 NIPFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTH 305
            +PF+Q GN +S+ +GKC F+DK +L NI+AA+   KEALA QK K+PS+L +TTL+STH
Sbjct: 213 TLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKTKKPSLLGQTTLTSTH 272

Query: 306 GPGIVIDF 313
           GPGIVIDF
Sbjct: 273 GPGIVIDF 280

>Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519)
           [846 nt, 282 aa]
          Length = 281

 Score =  296 bits (758), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 147/293 (50%), Positives = 203/293 (69%), Gaps = 15/293 (5%)

Query: 21  SNNYGVITRMLNTRSFHISRTSSLAAVAATEDASESKSTTSGTNMPPANATKLSKEQLKK 80
           S ++G+++R      +H  R     AVAA+E AS                +K  K++LK+
Sbjct: 3   SRSFGILSRRCE---YHSGRVLLAEAVAASETASAKP------------VSKSVKDKLKR 47

Query: 81  REIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTITLTTLIVSEKGTS 140
           RE+RR S+RK  AR+PA+S+PLYM +  ALR++RAAEVG+P  QQ IT+TT +VSE+G  
Sbjct: 48  RELRRHSKRKADARKPASSYPLYMPISQALRYLRAAEVGQPISQQIITITTDVVSERGNL 107

Query: 141 LLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEGIKDGTIRANFDVA 200
            LNGN+    P+K++KIAVFS D E L ++K + NC L+GG + VE IK G    +FD A
Sbjct: 108 NLNGNISYNTPIKDVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKA 167

Query: 201 FATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNIPFKQTGNNISIPI 260
           FATP+I P + SQL + LG RG+LP  KKGTVS+D+ +L+   +G +PF+QTGN+IS+ +
Sbjct: 168 FATPDISPMLTSQLARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSV 227

Query: 261 GKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGPGIVIDF 313
           G+C FSDK IL NIIA R A+   L++QK+K+PS+L KTT++STHGPGI IDF
Sbjct: 228 GRCNFSDKQILENIIAVRSAYNTTLSSQKSKKPSLLGKTTITSTHGPGITIDF 280

>TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {ON}
           Anc_8.268 YDR116C
          Length = 278

 Score =  293 bits (750), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 148/291 (50%), Positives = 203/291 (69%), Gaps = 18/291 (6%)

Query: 23  NYGVITRMLNTRSFHISRTSSLAAVAATEDASESKSTTSGTNMPPANATKLSKEQLKKRE 82
           N+  +TR     +FH+SR                +   +G   P A  +KLSK+QLKKRE
Sbjct: 5   NFLQVTR---KNAFHVSRII--------------REEITGAEGPIAQVSKLSKDQLKKRE 47

Query: 83  IRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTITLTTLIVSEKGTSLL 142
           +RR + RK++A+ PA SHPLYM+V  ALRF+RAAEVG+P  QQTI LTTL+VSEKG+  L
Sbjct: 48  LRRFTIRKREAKMPATSHPLYMQVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNL 107

Query: 143 NGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEGIKDGTIRANFDVAFA 202
            G++    PLKE+KIA+F+ D+  ++  K +FNC +VGG+E +  IK+G I  +FD AFA
Sbjct: 108 AGDIAFVTPLKEVKIAIFTNDETQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFA 167

Query: 203 TPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNIPFKQTGNNISIPIGK 262
           TP+IV  + S + + LG RG+ P+ KKGTVS+++  L+   +G+IPF+Q GN IS+ IGK
Sbjct: 168 TPDIVQELGS-VARILGPRGVFPSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGK 226

Query: 263 CYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGPGIVIDF 313
           C FSD+ IL N+I+ R AFK++++ QK K+PSIL KT LS+THGPGIVIDF
Sbjct: 227 CNFSDRQILENLISVRKAFKDSVSTQKTKKPSILGKTILSTTHGPGIVIDF 277

>Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  291 bits (744), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 145/270 (53%), Positives = 208/270 (77%), Gaps = 5/270 (1%)

Query: 44  LAAVAATEDASESKSTTSGTNMPPANATKLSKEQLKKREIRRLSQRKQQARQPANSHPLY 103
           L+  A+   A E KST   +N P      L+KEQ KKRE++RL+QR+ +A++PA ++PLY
Sbjct: 20  LSHTASKLYAEEYKSTAMSSNAP-----SLTKEQAKKRELKRLAQRRAEAKRPAATNPLY 74

Query: 104 MEVVDALRFIRAAEVGRPEGQQTITLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTD 163
           M V  ALR++RAAEVGRP+ QQTI LTTL+V E+GT+ L+G++   +PL+ +K+AVF+ D
Sbjct: 75  MPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAVFTND 134

Query: 164 KELLEEVKSQFNCQLVGGNETVEGIKDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGI 223
           +  L+E++ ++   L+GG + V  IK+G I  +FD A+AT +IVP + SQ+ + LG RG+
Sbjct: 135 ENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVARILGPRGV 194

Query: 224 LPNTKKGTVSDDLVTLMNAKMGNIPFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKE 283
           LP+ KKGTVSDD+ +L+   +G++PF+Q GN+IS+ IGKCYF+D+++L NIIAAR AFK 
Sbjct: 195 LPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIAARAAFKA 254

Query: 284 ALANQKAKRPSILSKTTLSSTHGPGIVIDF 313
           A+++QK+K+P+ILSKTTLSSTHGPGIVIDF
Sbjct: 255 AVSDQKSKKPNILSKTTLSSTHGPGIVIDF 284

>KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa]
           {ON} similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116C MRPL1 Mitochondrial ribosomal protein of the
           large subunit
          Length = 266

 Score =  286 bits (731), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 188/245 (76%)

Query: 69  NATKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTIT 128
             TKL+KEQL+KRE+R++ QR+ QA+ PA+ HPLYM V  ALR++RA EVG+P  QQTIT
Sbjct: 21  TGTKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRYLRAIEVGQPASQQTIT 80

Query: 129 LTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEGI 188
           LTTL+V+E+G   L GN+   +PLK++K+AVF+ D+     +K +++  LVGG++ V  I
Sbjct: 81  LTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKDKYSVHLVGGSDLVSQI 140

Query: 189 KDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNIP 248
           K G +  +FD AFATP+IVP + SQ+G+ LG RG+LP  KKGTV++DL  L+   M ++P
Sbjct: 141 KAGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGTVAEDLEPLIKDSMSSVP 200

Query: 249 FKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGPG 308
           F+Q GN+IS+ + K +F+DK++L N++A + AFK+++ NQ+ K+PSILS+TTL+STHGPG
Sbjct: 201 FRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTKKPSILSQTTLTSTHGPG 260

Query: 309 IVIDF 313
           IVIDF
Sbjct: 261 IVIDF 265

>TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON}
           Anc_8.268 YDR116C
          Length = 276

 Score =  280 bits (716), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 147/246 (59%), Positives = 186/246 (75%)

Query: 68  ANATKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTI 127
           AN +KLSK+QLKKREIRRL+QRK  A++  + HPLYM +  ALRF+RAAEVG+P+ QQTI
Sbjct: 30  ANVSKLSKDQLKKREIRRLAQRKAAAKKSPSDHPLYMSIPMALRFLRAAEVGQPQTQQTI 89

Query: 128 TLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEG 187
           TLTT +V+E+G   L G++   +PLKE+KIAVFS D++ L+  + +FNC LVGG E +E 
Sbjct: 90  TLTTAVVAERGVPALAGSVSFPKPLKEVKIAVFSGDEDQLKVAREKFNCHLVGGTEIIEK 149

Query: 188 IKDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNI 247
           IK G I  +FD AFATP+I P + SQL + LG RG+LP  KKGTV+ D+  L+   MG++
Sbjct: 150 IKSGEIPVDFDKAFATPDIAPALTSQLARILGPRGVLPTVKKGTVATDVSRLVQDSMGSM 209

Query: 248 PFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGP 307
           PF+Q GN ISI +GK  FSD+ IL N IA  DA KEALANQ +K+ S+L KTTLSSTHGP
Sbjct: 210 PFRQRGNAISIAVGKSSFSDRQILENAIATHDAVKEALANQVSKKTSLLGKTTLSSTHGP 269

Query: 308 GIVIDF 313
           GIVIDF
Sbjct: 270 GIVIDF 275

>Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to
           Ashbya gossypii AGR080W
          Length = 275

 Score =  275 bits (704), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 133/256 (51%), Positives = 182/256 (71%)

Query: 58  STTSGTNMPPANATKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAE 117
           S     N  P++ TKLSKEQ+KK+E+R L Q++  A++    HPLYM V  A RF+RAAE
Sbjct: 19  SVRCAANNSPSSTTKLSKEQMKKKELRALLQKRAAAKKSPFEHPLYMPVQQAFRFLRAAE 78

Query: 118 VGRPEGQQTITLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQ 177
           VG+P  QQTI+LTT++VS+KG  LL+GN+    PL+++K+AVF+ +KE  E  + QF C 
Sbjct: 79  VGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAVFTNNKEQEEVAREQFKCH 138

Query: 178 LVGGNETVEGIKDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLV 237
           LVGG E +E IK+G    +FD A ATP++V  + SQL   LG R +LP  KKGTVS+++ 
Sbjct: 139 LVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLGPRRLLPAVKKGTVSENIA 198

Query: 238 TLMNAKMGNIPFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILS 297
            L+   M  +PF+Q G  +S+ +GKC FSDK +L NI+A + AFK+ALA+Q+ K+ SIL 
Sbjct: 199 NLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQKAFKQALADQQGKKSSILG 258

Query: 298 KTTLSSTHGPGIVIDF 313
           KTT++STHGPGIVIDF
Sbjct: 259 KTTVTSTHGPGIVIDF 274

>ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar to
           uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 277

 Score =  273 bits (697), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 126/244 (51%), Positives = 181/244 (74%)

Query: 71  TKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTITLT 130
           +KL+KEQL+KRE+RR ++RK +A++PA++HPLYM    ALR++RA EVG P  QQ IT+T
Sbjct: 34  SKLTKEQLRKREVRRAARRKVEAKKPAHTHPLYMPTPLALRYLRAVEVGYPASQQVITVT 93

Query: 131 TLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEGIKD 190
           T +V+++G   + GN+ L  PLK++ +AVFS D++ L   + +F C LVGG++ +  IK 
Sbjct: 94  TSVVADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQLSMARDKFRCHLVGGSDIIAKIKQ 153

Query: 191 GTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNIPFK 250
           G I  +FD AFATP+I   + SQ+ + LG + +LP  K+GTV+ DL  L+    G+IPF+
Sbjct: 154 GEIPVDFDKAFATPDIAQELTSQVARILGPKQVLPMAKRGTVASDLEPLIKDSFGSIPFR 213

Query: 251 QTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGPGIV 310
           Q GN+IS+ + KC FSD+ +L N++A + AFKEA++NQKAKRPSIL +TTL++THGPGIV
Sbjct: 214 QKGNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVSNQKAKRPSILGRTTLTTTHGPGIV 273

Query: 311 IDFV 314
           ID V
Sbjct: 274 IDLV 277

>KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.268
           YDR116C
          Length = 285

 Score =  269 bits (687), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 125/242 (51%), Positives = 182/242 (75%)

Query: 72  KLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTITLTT 131
           KL+KEQL++RE+R++ + K  A++PA+   +Y+ V +A+R +RA EVG+P  QQTITLTT
Sbjct: 43  KLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTT 102

Query: 132 LIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEGIKDG 191
           ++VSEKG   L+G++ L  PLK ++IA FS D ELL+ ++ +   ++VGG E ++ +K G
Sbjct: 103 MVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSG 162

Query: 192 TIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNIPFKQ 251
            +   FD AFATP+I P +NS+LG  LGRRG+LPN KKGTV  DL+ ++ +K+G +PF+Q
Sbjct: 163 EVPVQFDKAFATPDIAPQLNSKLGALLGRRGLLPNIKKGTVGPDLLAMIRSKVGAMPFRQ 222

Query: 252 TGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGPGIVI 311
              N++  I KC+FSD+ +L N+IAAR+AF+ A+ NQK+K+ SIL ++TLSSTHGPGIVI
Sbjct: 223 RAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVI 282

Query: 312 DF 313
           D 
Sbjct: 283 DL 284

>CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {ON}
           similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116c
          Length = 290

 Score =  266 bits (681), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 130/247 (52%), Positives = 189/247 (76%), Gaps = 6/247 (2%)

Query: 73  LSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTITLTTL 132
           L+KEQ KKRE++RL+ +K +A++PAN HPLYM +  ALR++R+AEVGRP   QTIT+TTL
Sbjct: 43  LTKEQAKKREMKRLALKKAEAKKPANIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTL 102

Query: 133 IVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQ--LVGGNETVEGIKD 190
           +V++KG + L GN+    PLK++KIA+FS++KE L+E+KS+++ Q  + GG + +  IK 
Sbjct: 103 VVADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKS 162

Query: 191 GTIRAN-FDVAFATPEIVPFINSQLGKQLGRRGILPNTKK---GTVSDDLVTLMNAKMGN 246
           G I+ +  +  FATPEI P I SQLG+ LG +G++PN KK    TV +DL +L+   +G 
Sbjct: 163 GKIKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQ 222

Query: 247 IPFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHG 306
           + F+Q GN++S+ +G+C FSD+DIL NIIA R+AFK+++++Q AK+PSIL KTT+S+T G
Sbjct: 223 VSFRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAG 282

Query: 307 PGIVIDF 313
           PGIVIDF
Sbjct: 283 PGIVIDF 289

>KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8.268
           YDR116C
          Length = 280

 Score =  264 bits (675), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 132/245 (53%), Positives = 176/245 (71%), Gaps = 1/245 (0%)

Query: 71  TKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTITLT 130
           +K +K+Q KK+ +R   + ++QAR+PA++HPLYM+V DALRF+RA EVG+P  QQTITLT
Sbjct: 36  SKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFLRAVEVGQPRSQQTITLT 95

Query: 131 TLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQF-NCQLVGGNETVEGIK 189
           TL++SEKG   + GN++L  PL+  K+ V S D + LEEV+  F N  LVGG E V+  K
Sbjct: 96  TLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDNFKNVHLVGGRELVDKFK 155

Query: 190 DGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNIPF 249
           +  I  +FD   ATP+I+ + N  LGK  G +G+LPN KKGTVS++L+ LMN  + ++PF
Sbjct: 156 NEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGTVSENLIELMNENVSSMPF 215

Query: 250 KQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGPGI 309
           +Q    IS+ IGK  FSDK IL NIIA R+AF   L+NQK K+ S L KTTL+STHGPGI
Sbjct: 216 RQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKKQSTLGKTTLTSTHGPGI 275

Query: 310 VIDFV 314
           VIDF+
Sbjct: 276 VIDFI 280

>AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR116C (MRPL1)
          Length = 275

 Score =  256 bits (653), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 186/247 (75%)

Query: 68  ANATKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTI 127
           A ++KLSK+QLKKRE+RRL+QRK  AR+PA++ PLYM V  ALRF+RAAEVG+P  QQTI
Sbjct: 28  ATSSKLSKDQLKKRELRRLAQRKAAARRPASASPLYMPVQQALRFLRAAEVGQPATQQTI 87

Query: 128 TLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEG 187
           ++ T+++ +KG +LL+G + L  P++E K+AVF+ D E  E  ++++ C LVGG E VE 
Sbjct: 88  SVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTNDPEQAETARTKYGCYLVGGAELVEQ 147

Query: 188 IKDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNI 247
           +K G ++ +FD AFATP+I P + ++LG+ LG +G+LP+ KKGTV+ DL  L+   + + 
Sbjct: 148 LKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKGLLPSVKKGTVAGDLSELLGDDINST 207

Query: 248 PFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGP 307
           PFKQ  N IS+ IGKC+FSD+ I+ N++A + AF+ A+ +QK K+ S+   TTL+STHGP
Sbjct: 208 PFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFRAAMTSQKTKKTSLFGTTTLTSTHGP 267

Query: 308 GIVIDFV 314
           GIVIDF+
Sbjct: 268 GIVIDFL 274

>TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON}
           Anc_8.268 YDR116C
          Length = 241

 Score =  169 bits (427), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 86/222 (38%), Positives = 141/222 (63%), Gaps = 2/222 (0%)

Query: 92  QARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTITLTTLIVSEKGTSLLNGNMKLFRP 151
           +AR  + +HPL MEV  ALR++RA E GR   +QT+TL T++ + +G + L G +     
Sbjct: 21  KARILSKNHPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHML 80

Query: 152 LKELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEGIKDGTIRANFDVAFATPEIVPFIN 211
           +++  IAVF+ D E   ++  +    ++GG+E ++ I  G  +  F  AFAT ++V  + 
Sbjct: 81  IRKPVIAVFTEDPEQ-HKIAKEMGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDL- 138

Query: 212 SQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNIPFKQTGNNISIPIGKCYFSDKDIL 271
           +++ ++LG++ +LP  KK TV D++  L+  K+  +PF +  + IS P+GKC F+D++IL
Sbjct: 139 ARVAQKLGKQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEIL 198

Query: 272 LNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGPGIVIDF 313
            N+I AR+  ++AL  Q  K+PS + K TL+STHGPGI ID 
Sbjct: 199 RNLIKAREGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240

>Kpol_1052.26 s1052 complement(86331..87275) [945 bp, 314 aa] {ON}
           complement(86331..87275) [945 nt, 315 aa]
          Length = 314

 Score = 33.5 bits (75), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 43  SLAAVAATEDASESKSTTSGTNMPPANATKLSKEQLKKREIRRLSQRKQQARQPANSHPL 102
           S+      E  S++ S+T+ TN P  +  +  KE+L KR+ +++ + K++AR+ A + P 
Sbjct: 90  SIETKQQDESKSDTLSSTANTNQPRKSRNR-QKERLAKRQ-QKIEKIKEEAREEAANQPN 147

Query: 103 YMEV 106
           Y E+
Sbjct: 148 YQEI 151

>Kpol_1054.57 s1054 (143198..143755) [558 bp, 185 aa] {ON}
           (143198..143755) [558 nt, 186 aa]
          Length = 185

 Score = 32.7 bits (73), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 2/43 (4%)

Query: 256 ISIPIGKCYFSDKDILL--NIIAARDAFKEALANQKAKRPSIL 296
           I+IP+GK    D+DIL   NI+AA D  +E +   K   PS+ 
Sbjct: 142 INIPLGKTINEDQDILEHPNIMAAYDLLREMVKQFKVVDPSLF 184

>KNAG0A07460 Chr1 (1170179..1173301) [3123 bp, 1040 aa] {ON}
           Anc_3.408 YPR097W
          Length = 1040

 Score = 33.5 bits (75), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 78/183 (42%), Gaps = 22/183 (12%)

Query: 8   ITRNTRMCALRLPSNNYGVITRMLNTR-------------SFHISRTSSLAAVAATEDAS 54
           +TRN  +   R+PSN    I     T              S + SR  +   V + +D  
Sbjct: 365 VTRNETLPDGRVPSNPTEQIVHSFETETQSLLASANQSAESLNKSRAQNAVDVFSNDDED 424

Query: 55  ESKSTTSG-TNMPPANATKLSKEQLK---KREIRRLSQRKQQARQPANSHPLYMEVVDAL 110
           E ++T     +       KL+ E+++   ++ +R LS+ K  +  P  S   ++   D +
Sbjct: 425 EDETTFEDFEDAMDTKTNKLAHEKMRTSLRQYLRSLSKDKDTSVNPLFSS--FLTTDDVV 482

Query: 111 RFIRAAEVGRPE--GQQTITLTTLIVSEKGTSL-LNGNMKLFRPLKELKIAVFSTDKELL 167
            F +  E  R +   +Q + +  L+   K   L L  ++KL   +K+LK ++   +K LL
Sbjct: 483 EFEKFKEEVREDIRNRQLVDINVLVTQLKFQKLALEKSLKLQDSMKDLKTSLLQDEKALL 542

Query: 168 EEV 170
             V
Sbjct: 543 SYV 545

>KNAG0D02430 Chr4 (431696..432847) [1152 bp, 383 aa] {ON} Anc_8.90
           YPL001W
          Length = 383

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 153 KELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEGIKDGTIRANFDVAFATPEIVPFINS 212
           + LK+++   DK +++    QF   + G +ET+ G KD  I   FD    TP +    ++
Sbjct: 18  EHLKVSLVDGDKPVIQ-FSPQFTYPIFGTDETIFGFKDLLIHLAFDSVTLTPFVNVKFSA 76

Query: 213 QLGKQLGRRGIL 224
           ++   +  R +L
Sbjct: 77  KMDDSVDERKVL 88

>Skud_12.36 Chr12 complement(68300..71350) [3051 bp, 1016 aa] {ON}
           YLL031C (REAL)
          Length = 1016

 Score = 32.0 bits (71), Expect = 2.2,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 40/79 (50%), Gaps = 12/79 (15%)

Query: 1   MMLHSLKITRNT------RMCALRLPSNNYGVITRMLNTRSFHISRTSSLAAVAATEDAS 54
           M++H+L  T N+      R+ A  L S  +G++T  L    F   R S+ A + AT   S
Sbjct: 562 MIVHALLFTSNSFTIWEDRIVAFLLSS--FGMLT--LYEFVFLPKRQSTTALLTAT--IS 615

Query: 55  ESKSTTSGTNMPPANATKL 73
           E + TTSG N   AN+  L
Sbjct: 616 EKEGTTSGVNSSTANSNYL 634

>Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284W
           (YKU70) - DNA binding protein [contig 39] FULL
          Length = 572

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%)

Query: 34  RSFHISRTSSLAAVAATEDASESKSTTSGTNMPPANATKLSKEQLKKREIRRL 86
           + F  S  S +  + A + AS+  ST +G +  P NA  +    L+K+EI+R+
Sbjct: 196 KPFDQSFYSDILKLGAKKTASQGGSTFNGPSTAPINANLIKARALRKKEIKRI 248

>Skud_1.19 Chr1 (38703..41258) [2556 bp, 851 aa] {ON} YAL041W (REAL)
          Length = 851

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 8/61 (13%)

Query: 234 DDLVTLMNAKMGNIPFKQTGNNISIPIGKCYFSDKDILLNIIAARDAF---KEALANQKA 290
           D+L+T +N+K+ N     T NN  +PI K  + D+D    I+ + + +   KE LA    
Sbjct: 789 DNLITAINSKISN-----THNNTVLPITKIKYQDEDGDFVILGSDEDWSVAKEMLAENNE 843

Query: 291 K 291
           K
Sbjct: 844 K 844

>Kwal_27.9924 s27 (121448..122416) [969 bp, 322 aa] {ON} YJR070C -
           Hypothetical ORF [contig 43] FULL
          Length = 322

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 63/150 (42%), Gaps = 21/150 (14%)

Query: 152 LKELKIAVFSTDKELLEEVKSQFNCQLVGGNETV----EGIKDGTIRANFDVAFATPEIV 207
           ++ELK  +   +K L E  ++ F  + +G NE       G  D +     ++A+   +I 
Sbjct: 187 IEELKQILLDQEKPLFERYRAMFRLRDIGNNEACFALAAGFDDPSALFKHEIAYVFGQIG 246

Query: 208 -PFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNIPFKQTGNNISIPIGKCYFS 266
            P I S+L + L R    P  +               +G+I       +  +PI K +  
Sbjct: 247 NPVIVSKLVEVLAREHEAPMVRHEAAE---------ALGSI-----ATDDVLPILKGHLD 292

Query: 267 DKDILL--NIIAARDAFKEALANQKAKRPS 294
           DKD ++  + I A D ++   +N+    P+
Sbjct: 293 DKDDVVRESAIVALDMYEYENSNELEYAPA 322

>Suva_1.24 Chr1 (39893..42442) [2550 bp, 849 aa] {ON} YAL041W (REAL)
          Length = 849

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 8/61 (13%)

Query: 234 DDLVTLMNAKMGNIPFKQTGNNISIPIGKCYFSDKDILLNIIAARDAF---KEALANQKA 290
           DDL+T +N+K+ N     T ++ ++PI K  + D+D    I+ + + +   KE LA    
Sbjct: 787 DDLITAINSKISN-----THSSSALPINKIKYQDEDGDFVILGSDEDWNVAKEMLAENNE 841

Query: 291 K 291
           K
Sbjct: 842 K 842

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,107,573
Number of extensions: 1234448
Number of successful extensions: 6008
Number of sequences better than 10.0: 62
Number of HSP's gapped: 6237
Number of HSP's successfully gapped: 62
Length of query: 314
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 205
Effective length of database: 40,982,805
Effective search space: 8401475025
Effective search space used: 8401475025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)