Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0J013206.65ON33433414580.0
NCAS0F003306.65ON2812566861e-88
KAFR0G025006.65ON2893006513e-83
Skud_15.3366.65ON2862176357e-81
YOR174W (MED4)6.65ON2842116341e-80
KNAG0M010206.65ON2792226243e-79
Smik_15.3526.65ON2882116226e-79
Suva_8.2276.65ON2872516192e-78
CAGL0L04620g6.65ON2642916136e-78
Kpol_1042.116.65ON2922976158e-78
ZYRO0D14190g6.65ON2952146114e-77
AGR270W6.65ON2943045836e-73
SAKL0A08426g6.65ON2991825837e-73
TBLA0G005506.65ON3181895787e-72
Kwal_56.232426.65ON2562165232e-64
TPHA0F025906.65ON3062855239e-64
Ecym_31246.65ON2742745209e-64
KLTH0G15444g6.65ON2632235163e-63
KLLA0F20185g6.65ON2851674783e-57
TDEL0G040606.65ON2201794714e-57
Ecym_70448.551ON22276740.60
TPHA0D037406.311ON231738741.3
TPHA0N006805.206ON1977123685.9
KNAG0A071606.47ON57264686.3
CAGL0F03333g8.825ON41685677.3
KNAG0B008803.472ON26362667.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0J01320
         (334 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {...   566   0.0  
NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65 Y...   268   1e-88
KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...   255   3e-83
Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W...   249   7e-81
YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subuni...   248   1e-80
KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {O...   244   3e-79
Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W...   244   6e-79
Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W (...   243   2e-78
CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} simila...   240   6e-78
Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON} (21260.....   241   8e-78
ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} simil...   239   4e-77
AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic h...   229   6e-73
SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {O...   229   7e-73
TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65...   227   7e-72
Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W...   206   2e-64
TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65...   206   9e-64
Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON} ...   204   9e-64
KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa] ...   203   3e-63
KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa] ...   188   3e-57
TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON...   186   4e-57
Ecym_7044 Chr7 (89781..90449) [669 bp, 222 aa] {ON} similar to A...    33   0.60 
TPHA0D03740 Chr4 complement(784729..791682) [6954 bp, 2317 aa] {...    33   1.3  
TPHA0N00680 Chr14 (149893..155826) [5934 bp, 1977 aa] {ON} Anc_5...    31   5.9  
KNAG0A07160 Chr1 (1123790..1125508) [1719 bp, 572 aa] {ON} Anc_6...    31   6.3  
CAGL0F03333g Chr6 complement(331850..333100) [1251 bp, 416 aa] {...    30   7.3  
KNAG0B00880 Chr2 (162193..162984) [792 bp, 263 aa] {ON} Anc_3.47...    30   7.4  

>NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {ON}
           Anc_6.65 YOR174W
          Length = 334

 Score =  566 bits (1458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/334 (86%), Positives = 288/334 (86%)

Query: 1   MSLQDTTKFSNDFIXXXXXXXXXXXXXXXNPNTRTTSANHLRASSVSLLAEAVTNGTPSS 60
           MSLQDTTKFSNDFI               NPNTRTTSANHLRASSVSLLAEAVTNGTPSS
Sbjct: 1   MSLQDTTKFSNDFITETTTTAADTTTVAANPNTRTTSANHLRASSVSLLAEAVTNGTPSS 60

Query: 61  SEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSRLIDSVDKFKPNLNIAQELIQADKSLF 120
           SEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSRLIDSVDKFKPNLNIAQELIQADKSLF
Sbjct: 61  SEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSRLIDSVDKFKPNLNIAQELIQADKSLF 120

Query: 121 DTLNSFIQYDEIDLHLKALETKASKIDELTQSTLQTLNECHDDLNKLPTLPQIEFELNTI 180
           DTLNSFIQYDEIDLHLKALETKASKIDELTQSTLQTLNECHDDLNKLPTLPQIEFELNTI
Sbjct: 121 DTLNSFIQYDEIDLHLKALETKASKIDELTQSTLQTLNECHDDLNKLPTLPQIEFELNTI 180

Query: 181 LNQRTKINSTILLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDSLRRGMLAMASLKAD 240
           LNQRTKINSTILLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDSLRRGMLAMASLKAD
Sbjct: 181 LNQRTKINSTILLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDSLRRGMLAMASLKAD 240

Query: 241 QLTYIPGQAQSMSKEKALPXXXXXXXXXXXXXXXXXXXXPRRESFVFSGKNKXXXXXXXX 300
           QLTYIPGQAQSMSKEKALP                    PRRESFVFSGKNK        
Sbjct: 241 QLTYIPGQAQSMSKEKALPTEVQETQEQTQTQQQDQEEQPRRESFVFSGKNKEEEEETTH 300

Query: 301 XXXDSKRKQEEKDHESGDEDAMDIDLDLFNPDEF 334
              DSKRKQEEKDHESGDEDAMDIDLDLFNPDEF
Sbjct: 301 THEDSKRKQEEKDHESGDEDAMDIDLDLFNPDEF 334

>NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65
           YOR174W
          Length = 281

 Score =  268 bits (686), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 179/256 (69%), Gaps = 21/256 (8%)

Query: 35  TTSANHLRASSVSLLAEAVTNGTPSSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSR 94
           TTS  H+R+SSVSLLAE   N          S  ND  +D +S+V+IY D+ +YE+ L+ 
Sbjct: 12  TTSMGHIRSSSVSLLAEVNPN----------SISND--EDDISKVQIYSDLCSYEQKLAN 59

Query: 95  LIDSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTL 154
           L++SVDKFKP++N A+ELI+ D+ LF TL+SF +YD+ID  LK L  ++ ++D  T+  L
Sbjct: 60  LVNSVDKFKPDMNAARELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEIL 119

Query: 155 QTLNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDYATKLSKFTKIPPTFDKGSI 214
             LNECHD+LN LP L Q+EFE+ TIL QR+KINS++LLDYATKLSKFTKIPPTFDKGSI
Sbjct: 120 GILNECHDELNALPMLKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSI 179

Query: 215 GPNNFIWPAEDSLRRGMLAMASLKADQLTYIPGQAQSMSKEKALPXXXXXXXXXXXXXXX 274
           GPNNFIWPAED+LRRGMLA+ASL AD+LT  PG  +   +E+ +P               
Sbjct: 180 GPNNFIWPAEDALRRGMLALASLHADELTKAPGAHE--GEEELIPKGSEPIAQEEPVTT- 236

Query: 275 XXXXXPRRESFVFSGK 290
                 RRESF FSGK
Sbjct: 237 ------RRESFTFSGK 246

>KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON}
           Anc_6.65 YOR174W
          Length = 289

 Score =  255 bits (651), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 139/300 (46%), Positives = 191/300 (63%), Gaps = 21/300 (7%)

Query: 39  NHLRASSVSLLAEAVTNGTPSSSEFNRSYDNDSSKDV---LSEVRIYDDIITYEKALSRL 95
            H ++SS+SLL E      P S+    S + DS+      +++V IY D+  YE+ LSRL
Sbjct: 7   GHRKSSSLSLLGE------PPSTSITNSNNIDSASGASPAITKVGIYSDLSQYEETLSRL 60

Query: 96  IDSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTLQ 155
           I S+D +KP+  IAQELI  D  LF++L+SF+QYD I   LK  E +  +    T+  L+
Sbjct: 61  IQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSRLKDFEKQEKESTLKTKEILE 120

Query: 156 TLNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDYATKLSKFTKIPPTFDKGSIG 215
           TLNECH+ LN LPT+ Q+ FE+NT+L QR KINS++LLDYATKLSKFTKIPPTFDKGSIG
Sbjct: 121 TLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDYATKLSKFTKIPPTFDKGSIG 180

Query: 216 PNNFIWPAEDSLRRGMLAMASLKADQLTYIPGQAQSMSKEKALPXXXXXXXXXXXX-XXX 274
           PNNF+WPAED+LRRGMLA+A+   D+LT I G   S+S + ++                 
Sbjct: 181 PNNFVWPAEDALRRGMLALAASHTDELTKIAGVEMSLSDDNSIALDEIKSVDAGEGPIPE 240

Query: 275 XXXXXPRRESFVFSGKNKXXXXXXXXXXXDSKRKQEEKDHESGDEDAMDIDLDLFNPDEF 334
                 RR S++F+G++            +++ K  E++ E  D +A+D+DLDLFNPD+F
Sbjct: 241 KKDSSSRRGSYIFAGQS----------GKNAEHKNNEENKEEAD-NAVDLDLDLFNPDDF 289

>Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W
           (REAL)
          Length = 286

 Score =  249 bits (635), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 166/217 (76%), Gaps = 14/217 (6%)

Query: 39  NHLRASSVSLLAEAVTNGTPSSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSRLIDS 98
            H+++SSVSL+AEA +N               +S+D LS+V++Y+D+  YE  LS+L++S
Sbjct: 14  GHIKSSSVSLVAEAASNM--------------NSEDKLSKVQLYEDLCRYEGVLSKLVES 59

Query: 99  VDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTLQTLN 158
           VD+FKP+L++A++LI AD+SLF+ +     YD ID +L+ ++  + ++D  ++  L+ LN
Sbjct: 60  VDRFKPDLDVARDLISADESLFNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILN 119

Query: 159 ECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDYATKLSKFTKIPPTFDKGSIGPNN 218
           ECHD+L+ LPTL Q+EFE NTIL QR+KINST LLDYATKLSKFTKIPPTFDKG++GPNN
Sbjct: 120 ECHDELSGLPTLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTKIPPTFDKGTVGPNN 179

Query: 219 FIWPAEDSLRRGMLAMASLKADQLTYIPGQAQSMSKE 255
           FIWPAED+LRRGMLAMASL + +LT +PG+ +  ++E
Sbjct: 180 FIWPAEDALRRGMLAMASLHSKELTRVPGEDEQETEE 216

>YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subunit
           of the RNA polymerase II mediator complex; associates
           with core polymerase subunits to form the RNA polymerase
           II holoenzyme; essential for transcriptional regulation
          Length = 284

 Score =  248 bits (634), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 160/211 (75%), Gaps = 14/211 (6%)

Query: 37  SANHLRASSVSLLAEAVTNGTPSSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSRLI 96
           S  H+R+SSVSL+AEA +N               +S+D LS+V++Y+D+  YE  LS+L+
Sbjct: 12  SMGHIRSSSVSLVAEATSNT--------------NSEDKLSKVQLYEDLCRYEDTLSKLV 57

Query: 97  DSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTLQT 156
           +SVD+FKPNL+IA++LI+ D++LF+ +    +YD I  +L+ ++  + ++D  T+  L+ 
Sbjct: 58  ESVDRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEI 117

Query: 157 LNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDYATKLSKFTKIPPTFDKGSIGP 216
           LNECHD+L  LP L Q+EFE NTIL QR+KINST LLDYATKLSKFTKIPPTFDKG++GP
Sbjct: 118 LNECHDELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGP 177

Query: 217 NNFIWPAEDSLRRGMLAMASLKADQLTYIPG 247
           NNFIWPAED+LRRGMLAMASL + +LT IPG
Sbjct: 178 NNFIWPAEDALRRGMLAMASLHSKELTRIPG 208

>KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {ON}
           Anc_6.65 YOR174W
          Length = 279

 Score =  244 bits (624), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 159/222 (71%), Gaps = 14/222 (6%)

Query: 35  TTSANHLRASSVSLLAEAVTNGTPSSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSR 94
             SA H RASSVSLL E    GT          D  +  + L +VRIY  I+ YE  L+ 
Sbjct: 13  AVSAGHKRASSVSLLQE----GT----------DAAALAEDLKKVRIYSGIVEYEDTLAA 58

Query: 95  LIDSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTL 154
           L++SVD +KP++ +AQ L+ ADK LF +L+ F +YDEI   L  L+ K++ +D  T+  L
Sbjct: 59  LVESVDSYKPDMAVAQRLVDADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDIL 118

Query: 155 QTLNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDYATKLSKFTKIPPTFDKGSI 214
           + LNECHD+LNKLP L Q++FE++TIL QR KINS+ LLDYATKLSKFT+IPPTFDKGSI
Sbjct: 119 EKLNECHDELNKLPYLEQVQFEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSI 178

Query: 215 GPNNFIWPAEDSLRRGMLAMASLKADQLTYIPGQAQSMSKEK 256
           GPNNFIWPAED+LR+GMLA+A+L + +LT IPGQ  +  K+K
Sbjct: 179 GPNNFIWPAEDALRKGMLAIAALHSRELTRIPGQDDAEDKKK 220

>Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W
           (REAL)
          Length = 288

 Score =  244 bits (622), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 160/211 (75%), Gaps = 14/211 (6%)

Query: 37  SANHLRASSVSLLAEAVTNGTPSSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSRLI 96
           S  H+++SSVSL+ EA +N               +S+D LS+V++Y+D+  YE  L +L+
Sbjct: 12  SMGHMKSSSVSLVVEATSNM--------------NSEDKLSKVQLYEDLCRYEDTLKKLV 57

Query: 97  DSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTLQT 156
           +SVD+FKP++++A++LI+ D+SLF+ ++   +YD ID +L+ ++  + ++D  T+  L+ 
Sbjct: 58  ESVDRFKPDIDVARDLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEI 117

Query: 157 LNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDYATKLSKFTKIPPTFDKGSIGP 216
           +NECHD+L  LP L Q+EFE NTIL QR+KINST LLDYATKLSKFT+IPPTFDKGSIGP
Sbjct: 118 MNECHDELGALPMLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGP 177

Query: 217 NNFIWPAEDSLRRGMLAMASLKADQLTYIPG 247
           NNFIWPAED+LRRGMLAMASL + +LT +PG
Sbjct: 178 NNFIWPAEDALRRGMLAMASLHSKELTRVPG 208

>Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W
           (REAL)
          Length = 287

 Score =  243 bits (619), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 122/251 (48%), Positives = 171/251 (68%), Gaps = 14/251 (5%)

Query: 39  NHLRASSVSLLAEAVTNGTPSSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSRLIDS 98
           N +R+SSVSL+AEA       +S  N  + +       S+V++Y+D+  YE  L +L++S
Sbjct: 14  NQIRSSSVSLVAEA-------TSSMNSEHKS-------SKVQLYEDLCRYEDILGKLVES 59

Query: 99  VDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTLQTLN 158
           VD+FKPNL IA++LI+ D+SLF+ +     YD+IDL+L+ ++  + ++D  T+  L+ LN
Sbjct: 60  VDRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILN 119

Query: 159 ECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDYATKLSKFTKIPPTFDKGSIGPNN 218
           ECHD+L+ LP L Q+EFE  TIL QR+KINST LLDYATKLSKFT+IPPTFDKG++GPNN
Sbjct: 120 ECHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNN 179

Query: 219 FIWPAEDSLRRGMLAMASLKADQLTYIPGQAQSMSKEKALPXXXXXXXXXXXXXXXXXXX 278
           FIWPAED+LRRGMLAMASL + +LT IPG+ +  ++E                       
Sbjct: 180 FIWPAEDALRRGMLAMASLHSKELTRIPGEEEQETEEVPTDTLSQPQKEKKESSENSPQN 239

Query: 279 XPRRESFVFSG 289
            P ++SF+F+G
Sbjct: 240 SPTKDSFIFNG 250

>CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174w MED4
          Length = 264

 Score =  240 bits (613), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 133/291 (45%), Positives = 181/291 (62%), Gaps = 29/291 (9%)

Query: 46  VSLLAEAVTNGTPSSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSRLIDSVDKFKPN 105
           +SL+AE+  +GT S  E ++             V++Y D+  YE+AL++L+DSVD FKP 
Sbjct: 1   MSLVAES-NSGTISEQELDK-------------VQLYSDLCLYEEALTKLVDSVDNFKPQ 46

Query: 106 LNIAQELIQADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTLQTLNECHDDLN 165
           L I ++LI+ADK L+ TL+   QYD +   L+ L+ + SK+D+ T++ L  LNECHDDLN
Sbjct: 47  LEIGKQLIEADKKLYSTLDLLPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLN 106

Query: 166 KLPTLPQIEFELNTILNQRTKINSTILLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAED 225
            LP L ++EFE   IL QR KI S +LL+YATKL+KFTKIPPTFDKG+IGPNNFIWPAED
Sbjct: 107 ALPLLEEVEFEKKMILKQREKIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAED 166

Query: 226 SLRRGMLAMASLKADQLTYIPGQAQSMSKEKALPXXXXXXXXXXXXXXXXXXXXPRRE-- 283
           +LR+GMLAMASL   +LT +PGQ +   ++ +                       ++E  
Sbjct: 167 ALRKGMLAMASLHGKELTKLPGQ-EDGEEDGSTANEDKNIVKDAEGAEGEIRQDDKKEDD 225

Query: 284 SFVFSGKNKXXXXXXXXXXXDSKRKQEEKDHESGDEDAMDIDLDLFNPDEF 334
           SFVF G N            +     E+K+    +++AMD DLDLFNPDEF
Sbjct: 226 SFVF-GAN-----------ANDAEGDEDKNAGEDEDEAMDSDLDLFNPDEF 264

>Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON}
           (21260..22138) [879 nt, 293 aa]
          Length = 292

 Score =  241 bits (615), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 136/297 (45%), Positives = 187/297 (62%), Gaps = 14/297 (4%)

Query: 40  HLRA-SSVSLLAEAVTNGTPSSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSRLIDS 98
           H+++ SSVSL+ +  TN   ++S     Y+N+S+   LS+V+IY+DI  YE  L +L++S
Sbjct: 8   HVKSISSVSLMTDN-TNSISTNSLNMIDYNNESND--LSKVQIYNDISEYENTLFKLVES 64

Query: 99  VDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTLQTLN 158
           VDKFKP++ +A +LI  D+ LF +L+SF++YD+I   L+  + +A+++D  T+  L TLN
Sbjct: 65  VDKFKPDVKLAHQLIDVDERLFKSLDSFVEYDKISTKLEECDKEAAELDTKTKEILGTLN 124

Query: 159 ECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDYATKLSKFTKIPPTFDKGSIGPNN 218
           ECH  LN LP L Q+EFE + IL QR+KINS +LLDYATKLSKFTKIPPTF+KGSIGPNN
Sbjct: 125 ECHGLLNSLPMLEQVEFEKDIILKQRSKINSKLLLDYATKLSKFTKIPPTFNKGSIGPNN 184

Query: 219 FIWPAEDSLRRGMLAMASLKADQLTYIPGQAQSMSK-EKALPXXXXXXXXXXXXXXXXXX 277
           FIWPAED+LRRGMLAMASL + +LT +P + +  S+ +K+                    
Sbjct: 185 FIWPAEDALRRGMLAMASLHSKELTKLPNEPEEASEPDKSTEPDKSTEPIEEEKITVDNE 244

Query: 278 XXPRRESFVFSGKNKXXXXXXXXXXXDSKRKQEEKDHESGDEDAMDIDLDLFNPDEF 334
                 S V+ G +K                         + D MD+DLDLFNPDEF
Sbjct: 245 GDISMGSIVYDGSHKVKENEKAEENEKGSE---------AEADNMDLDLDLFNPDEF 292

>ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 295

 Score =  239 bits (611), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 113/214 (52%), Positives = 163/214 (76%), Gaps = 13/214 (6%)

Query: 37  SANHLRASSVSLLAEAVTNGTPSSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSRLI 96
           S  H+R+SS SL+++A+++G           +ND   D LS+V+IY D+  YE+ L+ L+
Sbjct: 17  SRGHVRSSSTSLISDAMSSGN----------NND---DELSKVQIYADLTQYEEKLAALV 63

Query: 97  DSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTLQT 156
           +SVD FKP++ I  ELI+ DKSL+ +L+SF +YD ID  L  L+ +++++D  T+  L+T
Sbjct: 64  ESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLET 123

Query: 157 LNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDYATKLSKFTKIPPTFDKGSIGP 216
           L+EC++ LN LP L Q+EFE  +IL QR+K+NS++LL+YATKLSKFTKIPPTFDKG+IGP
Sbjct: 124 LSECYEMLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGP 183

Query: 217 NNFIWPAEDSLRRGMLAMASLKADQLTYIPGQAQ 250
           NNF+WPAED+LRRGMLA+ASL + ++T IPG+ +
Sbjct: 184 NNFVWPAEDALRRGMLAIASLHSKEMTRIPGEPE 217

>AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR174W (MED4)
          Length = 294

 Score =  229 bits (583), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 129/304 (42%), Positives = 178/304 (58%), Gaps = 17/304 (5%)

Query: 37  SANHL-RASSVSLLAEAVTNGTPSSS--EFNRSYDNDSS---KDVLSEVRIYDDIITYEK 90
           SAN L +A++          G  S+S   F      D+S   ++ L  V IY+D+  YE+
Sbjct: 2   SANQLSKAATPKATPLGAAQGASSTSLHSFTSFQPQDASHVEQNKLHSVAIYEDLCQYEE 61

Query: 91  ALSRLIDSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELT 150
           +L RL+ SVDKF+P+L  AQELI+ D  L+  L    +YD ID  LK LE ++  IDE T
Sbjct: 62  SLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLIDSQLKKLEEESKDIDERT 121

Query: 151 QSTLQTLNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDYATKLSKFTKIPPTFD 210
              L  L EC++DLN LP + Q+EFE+ T+  Q+ K+NS++LL+YA KLSKFT++PPTF+
Sbjct: 122 AKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVLLEYAMKLSKFTRVPPTFN 181

Query: 211 KGSIGPNNFIWPAEDSLRRGMLAMASLKADQLTYIPGQAQSMSKEKALPXXXXXXXXXXX 270
           K +IGPNNFIWPAED++RRGMLAMASLK+ +LT +PGQ+   +++ +             
Sbjct: 182 KDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPGQSDQEAEQASAGKEADTAGPGVS 241

Query: 271 XXXXXXXXXPRRESFVFSGKNKXXXXXXXXXXXDSKRKQEEKDHESGDEDAMDIDLDLFN 330
                     RR SF F+G  K                      + GD  +MD+DL+LFN
Sbjct: 242 TLEPANGGHNRRGSFEFTGIRKPPPASDADSSV----------VDDGDA-SMDLDLNLFN 290

Query: 331 PDEF 334
           PDEF
Sbjct: 291 PDEF 294

>SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {ON}
           similar to gnl|GLV|KLLA0F20185g Kluyveromyces lactis
           KLLA0F20185g and weakly similar to YOR174W
           uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 299

 Score =  229 bits (583), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 135/182 (74%)

Query: 67  YDNDSSKDVLSEVRIYDDIITYEKALSRLIDSVDKFKPNLNIAQELIQADKSLFDTLNSF 126
           + +D  +D+LS V +Y DI  YE+ L +L+ SVDKFKP+L +AQELI+ DK LF  L  F
Sbjct: 35  HQHDQDQDLLSRVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEF 94

Query: 127 IQYDEIDLHLKALETKASKIDELTQSTLQTLNECHDDLNKLPTLPQIEFELNTILNQRTK 186
            +YD+ID  L  LE ++ ++D+ T   L+ LN CH  LN LP L Q+  E +T+L QR K
Sbjct: 95  PKYDKIDGRLNDLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREK 154

Query: 187 INSTILLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDSLRRGMLAMASLKADQLTYIP 246
           I S +LLDYA KL+KFT++PPTFDKG +GPNNFIWPAED++RRGMLAMASLK+ +LT IP
Sbjct: 155 IYSGVLLDYAMKLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIP 214

Query: 247 GQ 248
           GQ
Sbjct: 215 GQ 216

>TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65
           YOR174W
          Length = 318

 Score =  227 bits (578), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 109/189 (57%), Positives = 143/189 (75%)

Query: 59  SSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSRLIDSVDKFKPNLNIAQELIQADKS 118
           S SE +   DN+   D LS+++ Y+D+I YE+ LS+L  SVDK+KP+L  A +LI  D+ 
Sbjct: 20  SISEGDVLQDNNDKNDELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDIDRK 79

Query: 119 LFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTLQTLNECHDDLNKLPTLPQIEFELN 178
           L+ TL+SF++YDEI   LK LE     +DE T+S L +LN+CH+ LN LP L Q+EFE N
Sbjct: 80  LYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVEFEKN 139

Query: 179 TILNQRTKINSTILLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDSLRRGMLAMASLK 238
           T+L QR KINS +LLDYATKL+KFTKIPPTF+K ++GPNNFIWPAED+LRRGMLA+AS  
Sbjct: 140 TMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAVASAH 199

Query: 239 ADQLTYIPG 247
            ++LT +PG
Sbjct: 200 TEELTALPG 208

>Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W
           (MED4) - Stoichiometric member of mediator complex
           [contig 183] FULL
          Length = 256

 Score =  206 bits (523), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 105/216 (48%), Positives = 137/216 (63%), Gaps = 10/216 (4%)

Query: 76  LSEVRIYDDIITYEKALSRLIDSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLH 135
           LS+ +IY DI  +E+ L +L+ SVDKF P+L IA+ LI+ DK L  TL S  +YDEIDL 
Sbjct: 22  LSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRYDEIDLR 81

Query: 136 LKALETKASKIDELTQSTLQTLNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDY 195
            K L+ K  + DE     L+TL EC  DLN LP L Q+EFE  T+L QR K+ + +LLDY
Sbjct: 82  AKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFTNVLLDY 141

Query: 196 ATKLSKFTKIPPTFDKGSIGPNNFIWPAEDSLRRGMLAMASLKADQLTYIP--GQAQSMS 253
           A KL+KFT +PPTFDKG++GPNNF+WPAED++RRGMLA+ASL+A +    P  G AQ+  
Sbjct: 142 AMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASEDAKKPETGAAQTAE 201

Query: 254 KEKALPXXXXXXXXXXXXXXXXXXXXPRRESFVFSG 289
           +    P                     RR+SF F+G
Sbjct: 202 ETTKQPQSSPQLKVEEPMQ--------RRDSFEFNG 229

>TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65
           YOR174W
          Length = 306

 Score =  206 bits (523), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 121/285 (42%), Positives = 169/285 (59%), Gaps = 16/285 (5%)

Query: 50  AEAVTNGTPSSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSRLIDSVDKFKPNLNIA 109
           A  ++ GT S+        N ++ D L+ V IY+DI  YE  L +L+ S+D F+P++ +A
Sbjct: 38  ANNISQGTASNM-------NTAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVA 90

Query: 110 QELIQADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTLQTLNECHDDLNKLPT 169
           + LI+ DK L+  L SF +YDEID  +  ++  + K+D  T+  L  LN+  + LN LP 
Sbjct: 91  KTLIEVDKRLYKNLGSFKEYDEIDTKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPM 150

Query: 170 LPQIEFELNTILNQRTKINSTILLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDSLRR 229
           L +I FE + +  ++ KINS ILLDYATK+SKFTKIPPTF+KGSIGPNNFIWPAED+LRR
Sbjct: 151 LEEIYFERDVMHEKQKKINSKILLDYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRR 210

Query: 230 GMLAMASLKADQLTYIPGQAQSMSKEKALPXXXXXXXXXXXXXXXXXXXXPRRESFVFSG 289
           GMLA+AS+   +LT +P    S   +K L                      + ESFVF G
Sbjct: 211 GMLAVASIHRSELTKLPNDT-SYDSDKELEEQQEQEQHGTENTREADVEQEQEESFVFDG 269

Query: 290 KNKXXXXXXXXXXXDSKRKQEEKDHESGDEDAMDIDLDLFNPDEF 334
           K+K            ++   E   ++  + D MD+DL+LFNPDEF
Sbjct: 270 KHKNEEK--------TENSNEANSNDDNENDNMDLDLELFNPDEF 306

>Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON}
           similar to Ashbya gossypii AGR270W
          Length = 274

 Score =  204 bits (520), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 120/274 (43%), Positives = 168/274 (61%), Gaps = 21/274 (7%)

Query: 70  DSSKDVLSEVR---IYDDIITYEKALSRLIDSVDKFKPNLNIAQELIQADKSLFDTLNSF 126
           DS+ D L+ V+   +Y D+  +E+ L +L+ SVDKF P+L  AQ+LI +D  L+ TL   
Sbjct: 13  DSNNDELNHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQL 72

Query: 127 IQYDEIDLHLKALETKASKIDELTQSTLQTLNECHDDLNKLPTLPQIEFELNTILNQRTK 186
             YD ID+ LK L+ ++ +IDE T   L  L++C+++LNKLP + Q+EFE+  +  Q+ K
Sbjct: 73  PLYDSIDIQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPMVEQVEFEMKMMKKQKEK 132

Query: 187 INSTILLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDSLRRGMLAMASLKADQLTYIP 246
           I S +LL+YA KL+KFT++PPTF+K +IGPNNFIWPAED++RRGMLAMASLK+++LT IP
Sbjct: 133 IKSGVLLEYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIP 192

Query: 247 GQAQSMSKEKALPXXXXXXXXXXXXXXXXXXXXP------RRESFVFSGKNKXXXXXXXX 300
            +    S+E   P                    P      + ESF F+GK K        
Sbjct: 193 VELN--SEEPQEPPQKGQSQEEDEVTPTHSSDTPSSKPDSKSESFEFTGKAKNQQ----- 245

Query: 301 XXXDSKRKQEEKDHESGDEDAMDIDLDLFNPDEF 334
               S +  E   HE  D  ++D+DLDLFNPDEF
Sbjct: 246 ----STQYSETGAHEEAD-GSIDLDLDLFNPDEF 274

>KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa]
           {ON} some similarities with uniprot|Q12343 Saccharomyces
           cerevisiae YOR174W MED4 Member of RNA Polymerase II
           transcriptional regulation mediator Stoichiometric
           member of mediator complex
          Length = 263

 Score =  203 bits (516), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 102/223 (45%), Positives = 142/223 (63%), Gaps = 3/223 (1%)

Query: 69  NDSSKDVLSEVRIYDDIITYEKALSRLIDSVDKFKPNLNIAQELIQADKSLFDTLNSFIQ 128
           +DS ++ LS++++Y+DI  +E  L +L+ SVD+F P+L +A+ LI+ADK L+ +L    +
Sbjct: 15  SDSVENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPK 74

Query: 129 YDEIDLHLKALETKASKIDELTQSTLQTLNECHDDLNKLPTLPQIEFELNTILNQRTKIN 188
           YDEID   K L+ +    DE T   L+TL EC  DLN LP L Q+EFE  T+L QR K+ 
Sbjct: 75  YDEIDTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVF 134

Query: 189 STILLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDSLRRGMLAMASLKADQLTYIPGQ 248
           + +LLDYA KL+KFT +PPTFDKG++GPNNF+WPAED++RRGMLA+ASL+A +      Q
Sbjct: 135 TDVLLDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLRASEGANAQEQ 194

Query: 249 AQSMSKEKALPXXXXXXXXXXXXXXXXXXXXP--RRESFVFSG 289
            Q+ S++K                       P  RR SF F G
Sbjct: 195 -QASSEQKTSEKSSENEEAQTDIRSPDTKEEPVARRPSFGFDG 236

>KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa]
           {ON} similar to uniprot|Q12343 Saccharomyces cerevisiae
           YOR174W MED4 Member of RNA Polymerase II transcriptional
           regulation mediator Stoichiometric member of mediator
           complex
          Length = 285

 Score =  188 bits (478), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 120/167 (71%)

Query: 76  LSEVRIYDDIITYEKALSRLIDSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLH 135
           L  V IY D+  YE+ + +L  SVD FKP+L++  ++I+ DK L++TL  F +Y +I+  
Sbjct: 32  LQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLEEFDEYYKIEEE 91

Query: 136 LKALETKASKIDELTQSTLQTLNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDY 195
           L  L+ +   ID  T+  L+TLN C++ LN+LP L Q+EFE   +L QR KI+S ++LDY
Sbjct: 92  LSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVLDY 151

Query: 196 ATKLSKFTKIPPTFDKGSIGPNNFIWPAEDSLRRGMLAMASLKADQL 242
           A KL+KFT+ PPTFDK  IGPNNFIWPAEDSLR+GMLAMASLK  +L
Sbjct: 152 AMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMASLKKKEL 198

>TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON}
           Anc_6.65 YOR174W
          Length = 220

 Score =  186 bits (471), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 130/179 (72%), Gaps = 3/179 (1%)

Query: 81  IYDDIITYEKALSRLIDSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLHLKALE 140
           +Y D+  YE+AL RL++SVD+F+P+L+ A+EL++AD++L  +L+ F  YDE+D  L+ L+
Sbjct: 4   VYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRLD 63

Query: 141 TKASKIDELTQSTLQTLNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDYATKLS 200
            ++ +++  T  TL+TL+EC+  L+ LP L Q++FE   +L QR ++NS +LL+YATKLS
Sbjct: 64  RESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKLS 123

Query: 201 KFTKIPPTFDKGSIGPNNFIWPAEDSLRRGMLAMASLKADQLTYIPGQAQSMSKEKALP 259
           KFTK P      ++GPNNF+WPAED+LRRG LA+A+L ++++T      +S S E + P
Sbjct: 124 KFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEITLGSTGERSGSVESSEP 179

>Ecym_7044 Chr7 (89781..90449) [669 bp, 222 aa] {ON} similar to
           Ashbya gossypii AEL252C
          Length = 222

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 42/76 (55%), Gaps = 6/76 (7%)

Query: 118 SLFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTLQTLNECHDDLNK--LPTLPQIEF 175
           +L D L S  +YD  ++ ++A +    K+ +LT S    L++  DDL+K  LP    ++ 
Sbjct: 6   ALTDPLGSVPKYDFSNVPVQAFDAVRMKLAQLTHS----LSKIRDDLSKADLPQWYSLQS 61

Query: 176 ELNTILNQRTKINSTI 191
           +L   L Q + +NST+
Sbjct: 62  QLTVTLTQLSSLNSTL 77

>TPHA0D03740 Chr4 complement(784729..791682) [6954 bp, 2317 aa] {ON}
            Anc_6.311 YMR207C
          Length = 2317

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 27/38 (71%)

Query: 93   SRLIDSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYD 130
            S+ ++++D  +P+L I +ELI+ D ++FD+L  F+  D
Sbjct: 1138 SKFLNNIDHPQPDLKILEELIECDFAIFDSLFPFLVND 1175

>TPHA0N00680 Chr14 (149893..155826) [5934 bp, 1977 aa] {ON} Anc_5.206
            YJL005W
          Length = 1977

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 56/123 (45%), Gaps = 24/123 (19%)

Query: 102  FKPNLNIAQELI-------QADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTL 154
              PN  I++ L+       Q D S++  LNSF        +LK L    + + +L+   L
Sbjct: 1110 LNPNTKISKSLMFFIGADNQFDDSVWSVLNSFA-------NLKILNLSYNNLTDLSGMKL 1162

Query: 155  QTLNECHDDLNKLPTLPQIEFELNTILNQRT----KINSTILLDYATKLSKFTKIPPTFD 210
              LNE +   NK+  L       +T+L  ++     +N   LL   T+LS+ +++   FD
Sbjct: 1163 ANLNELYLSGNKISNLAS-----DTVLKWQSVRTLMLNGNNLLSLPTELSQLSQL-TIFD 1216

Query: 211  KGS 213
             GS
Sbjct: 1217 VGS 1219

>KNAG0A07160 Chr1 (1123790..1125508) [1719 bp, 572 aa] {ON} Anc_6.47
           YLR259C
          Length = 572

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 34/64 (53%)

Query: 51  EAVTNGTPSSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSRLIDSVDKFKPNLNIAQ 110
           EA  +GT S++   R+   +S K+V +     D     + A+S++ID + K K  +  A+
Sbjct: 106 EAAGDGTTSATVLGRAIFTESVKNVAAGCNPMDLRRGSQMAVSKVIDFLSKNKKEITTAE 165

Query: 111 ELIQ 114
           E+ Q
Sbjct: 166 EIAQ 169

>CAGL0F03333g Chr6 complement(331850..333100) [1251 bp, 416 aa] {ON}
           similar to uniprot|P53437 Saccharomyces cerevisiae
           YMR270c RRN9 RNA polymerase I specific transcription
           initiation factor
          Length = 416

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 44/85 (51%), Gaps = 3/85 (3%)

Query: 130 DEIDLHLKALETKASKID--ELTQS-TLQTLNECHDDLNKLPTLPQIEFELNTILNQRTK 186
           +++D  L  L TK +KI+  ++ QS + + L     D+ +L +   IEF+ + I+++  +
Sbjct: 230 NKLDHFLAGLNTKIAKINKFDVKQSDSEKKLTLIQKDIGQLKSNRHIEFDYHDIISRGCE 289

Query: 187 INSTILLDYATKLSKFTKIPPTFDK 211
           +   +   Y   L  +  IP  FDK
Sbjct: 290 MGIDMRNIYMKSLELYNDIPSKFDK 314

>KNAG0B00880 Chr2 (162193..162984) [792 bp, 263 aa] {ON} Anc_3.472
           YGR120C
          Length = 263

 Score = 30.0 bits (66), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 34  RTTSANHLRASSVSLLAEAVTNGTPSSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALS 93
           RT S   L + S+  L + +T+  P   EF R+YD + ++  L   +  +DI  + + L+
Sbjct: 64  RTVSG--LTSDSIKHLLDQITSNYPKYLEFFRTYDQEDNEAYLELQKTNNDIGVFTEMLA 121

Query: 94  RL 95
           +L
Sbjct: 122 KL 123

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,667,144
Number of extensions: 1247220
Number of successful extensions: 5629
Number of sequences better than 10.0: 117
Number of HSP's gapped: 5792
Number of HSP's successfully gapped: 123
Length of query: 334
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 224
Effective length of database: 40,868,139
Effective search space: 9154463136
Effective search space used: 9154463136
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)