Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0J013108.269ON57956929250.0
NCAS0B038008.269ON56557917700.0
Suva_2.2768.269ON56557415690.0
YDR117C (TMA64)8.269ON56558015570.0
Skud_4.3778.269ON56257115170.0
TDEL0F039608.269ON55856914900.0
ZYRO0C01496g8.269ON56757214910.0
Smik_4.3618.269ON56558014830.0
TPHA0J007808.269ON58357414570.0
KLTH0G13530g8.269ON57458213890.0
CAGL0B01837g8.269ON56957713760.0
KAFR0B054708.269ON56257413720.0
SAKL0H16874g8.269ON56357613670.0
Kwal_56.237718.269ON56257813560.0
Kpol_392.28.269ON56657712661e-168
KLLA0F19294g8.269ON57058311201e-146
KNAG0H032008.269ON56158110511e-136
TBLA0I032008.269ON56357810441e-135
Ecym_43018.269ON56458110341e-133
AGR079W8.269ON5425749181e-116
ZYRO0G06776g8.189ON9759800.063
TPHA0P006503.166ON44047742.0
SAKL0G06226g5.582ON43232732.6
Ecym_72432.543ON32075723.1
TPHA0A039203.295ON956134733.4
NCAS0A041002.408ON48453714.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0J01310
         (579 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8....  1131   0.0  
NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.2...   686   0.0  
Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON...   608   0.0  
YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}  ...   604   0.0  
Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON...   588   0.0  
TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {O...   578   0.0  
ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} simila...   578   0.0  
Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON...   575   0.0  
TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {...   565   0.0  
KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} simi...   539   0.0  
CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {...   534   0.0  
KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON} Anc_8...   533   0.0  
SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} simi...   531   0.0  
Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117...   526   0.0  
Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)...   492   e-168
KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]...   436   e-146
KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.2...   409   e-136
TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {O...   406   e-135
Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar t...   402   e-133
AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic ho...   358   e-116
ZYRO0G06776g Chr7 (543464..543757) [294 bp, 97 aa] {ON} similar ...    35   0.063
TPHA0P00650 Chr16 complement(134232..135554) [1323 bp, 440 aa] {...    33   2.0  
SAKL0G06226g Chr7 (518015..519313) [1299 bp, 432 aa] {ON} weakly...    33   2.6  
Ecym_7243 Chr7 complement(511468..512430) [963 bp, 320 aa] {ON} ...    32   3.1  
TPHA0A03920 Chr1 complement(867407..870277) [2871 bp, 956 aa] {O...    33   3.4  
NCAS0A04100 Chr1 complement(827360..828814) [1455 bp, 484 aa] {O...    32   4.4  

>NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8.269
           YDR117C
          Length = 579

 Score = 1131 bits (2925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/569 (97%), Positives = 553/569 (97%)

Query: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60
           MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF
Sbjct: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60

Query: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120
           TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP
Sbjct: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120

Query: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180
           FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI
Sbjct: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180

Query: 181 FKCNDLKPDEFVKEQLNTEHPQDNDVADEDTTRKKEENRESNEPDFEVLDHFKTEDVDYF 240
           FKCNDLKPDEFVKEQLNTEHPQDNDVADEDTTRKKEENRESNEPDFEVLDHFKTEDVDYF
Sbjct: 181 FKCNDLKPDEFVKEQLNTEHPQDNDVADEDTTRKKEENRESNEPDFEVLDHFKTEDVDYF 240

Query: 241 ITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTAKFLKHXXX 300
           ITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTAKFLKH   
Sbjct: 241 ITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTAKFLKHFEK 300

Query: 301 XXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKSDTKGMMYS 360
                        TVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKSDTKGMMYS
Sbjct: 301 EGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKSDTKGMMYS 360

Query: 361 ETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKMILLDDLLF 420
           ETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKMILLDDLLF
Sbjct: 361 ETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKMILLDDLLF 420

Query: 421 NMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVEPLFKSPQR 480
           NMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVEPLFKSPQR
Sbjct: 421 NMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVEPLFKSPQR 480

Query: 481 GHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGETMTSPKTPE 540
           GHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGETMTSPKTPE
Sbjct: 481 GHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGETMTSPKTPE 540

Query: 541 VQVQGPHGQIIIDHLNKKFGVPTKWINYV 569
           VQVQGPHGQIIIDHLNKKFGVPTKWINYV
Sbjct: 541 VQVQGPHGQIIIDHLNKKFGVPTKWINYV 569

>NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.269
           YDR117C
          Length = 565

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/579 (63%), Positives = 427/579 (73%), Gaps = 36/579 (6%)

Query: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60
           MF+KEPHIKALSNLKNSDRKKL QTI  QT  + Y     +I+KQTNFQT  P +IGTI+
Sbjct: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTC--PSIVKQTNFQT--PTTIGTIY 56

Query: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120
           T++ NIPIWFK KH+  LY TV+TCWN  D+LP  LSHDFVIQEKLFNGANLMISGTIPP
Sbjct: 57  TDEKNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPP 116

Query: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180
           FD +L  GTLCG+AS QDP R+V+AIG+V M++P F+KVVGE+GVAV++IHHFEDELFK 
Sbjct: 117 FDEKLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKS 176

Query: 181 FKCNDLKPD--EFVKEQLN-------TEHPQDNDVADEDTTRKKEENRESNEPDF-EVLD 230
           FK  DLKP   +  K  +N        +  +  +  DE T   KE +  +N  D  EVLD
Sbjct: 177 FKI-DLKPPVVDVQKGSVNDEEEEEEEKEQEKANEEDETT---KEMSTATNVEDLAEVLD 232

Query: 231 HFKTEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKK 290
           H   +DVDYFITR+LYYTIT DTK+ LPISASNFISQHINKNLPD+ HNEVNIKK+SWKK
Sbjct: 233 HLSVQDVDYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKK 292

Query: 291 TAKFLKHXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTND 350
           TAKFLKH                TVVGMNKTKDELKNFVPYK+G S        +     
Sbjct: 293 TAKFLKHFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKLGSSNG-----ENKGAKK 347

Query: 351 KSDTK-GMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKN 409
           + D++ GMMYS TFYKPIN AKDL+K    +P K LY   EIRD V +YI  KNL+D KN
Sbjct: 348 EGDSQSGMMYSITFYKPINLAKDLIKE-SGMPMKNLYLPTEIRDGVNNYITLKNLVDNKN 406

Query: 410 KKMILLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELME 469
           KKM+LLDDLLF MV+K++++   + R++ R  ILEP L NNFTEH+QIY  +        
Sbjct: 407 KKMVLLDDLLFGMVNKKRTDPTVS-RSISRAQILEPTLKNNFTEHFQIYDSQG------- 458

Query: 470 DVEPLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTI 529
              PLFKSP RG  P+I ILTEMKIGRKVITKVSNFE FGI+ + LAADLRK+CSGSTTI
Sbjct: 459 --TPLFKSPMRGSPPRIKILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTI 516

Query: 530 GETMTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568
           GETMTSPKT EVQVQGPHGQIIIDHLN K GVPTKWI+Y
Sbjct: 517 GETMTSPKTAEVQVQGPHGQIIIDHLN-KLGVPTKWIDY 554

>Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/574 (56%), Positives = 402/574 (70%), Gaps = 25/574 (4%)

Query: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60
           MFKKEPHIKALSNLKNS+RKKLLQT K QTN E Y F  S I KQTNF  +   S+GT++
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTI-KQTNF--SGQKSLGTVY 57

Query: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120
           T+++N PI FK KHN+ L+PTV++CW NH +LP +L+H FVI+E LFNGANLMISG+IPP
Sbjct: 58  TDENNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPP 117

Query: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180
           FD R   GTLCG+AS Q PK IV A+G+V+M++PS+ +V+GETGVAV+++HHF D L K 
Sbjct: 118 FDPRCKIGTLCGVASRQAPK-IVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKA 176

Query: 181 FKCNDLKPDEF--VKEQLNTEHPQDNDVADEDTTRKKEEN-RESN---EPDFEVLDHFKT 234
           FK     P  F    E  + ++ Q        TT K  EN +E+N   E   EVLDH   
Sbjct: 177 FKVKLEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRENVQEANINIEEIAEVLDHLSV 236

Query: 235 EDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTAKF 294
            DVDYFITR+LYYT+TQD  + LPISASNFIS HI +NLP I HNEVN+K+TSWKK+AKF
Sbjct: 237 SDVDYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKF 296

Query: 295 LKHXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKSDT 354
           LKH                T+VG N  KDELKNFVPYK+G +   S      NTN K  T
Sbjct: 297 LKHFEKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGVNN--SAKEKGENTNSKEKT 354

Query: 355 KGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKMIL 414
            GMMYS T YKP N AKDL+K    +P +  YT Q+IR  +T YI+ KNL+D K+K  ++
Sbjct: 355 SGMMYSLTLYKPFNLAKDLVKEA-NLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVV 413

Query: 415 LDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVEPL 474
           +DDLL+NMV+K++ + + A R + R  IL+P+LANNFTE YQIY+          D   L
Sbjct: 414 MDDLLYNMVNKKKKDPDVA-RVIPRAQILDPLLANNFTEFYQIYK---------NDDTLL 463

Query: 475 FKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGETMT 534
            ++P +G  P+I I+TEMKIGRKVITKVSNFE   I  + LAADLRK+CSGSTTIGE+ T
Sbjct: 464 SRTPMKGSPPRIKIITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQT 523

Query: 535 SPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568
             K+ EVQVQGPHGQ+IIDHLNK  GVP KWI++
Sbjct: 524 F-KSAEVQVQGPHGQLIIDHLNKS-GVPNKWIDF 555

>YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}
           TMA64Protein of unknown function that associates with
           ribosomes; has a putative RNA binding domain; in mammals
           the corresponding protein, eIF2D, has been shown to
           possess translation initiation factor activity
          Length = 565

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/580 (56%), Positives = 412/580 (71%), Gaps = 37/580 (6%)

Query: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60
           MFKKEPHIKALSNLKNS+RKKLLQT + QTN E Y+F  S I KQTNF      S+GT++
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTI-KQTNFN--GQKSVGTVY 57

Query: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120
           T+++N PI FK KH + L+PTV++CW    +LP +L+H FVI+E LFNGANLMISG+IPP
Sbjct: 58  TDENNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPP 117

Query: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180
           FD R   GTLCGIAS Q P+ ++ AIG+V++++PSFDKV+GETGVAV++IHHF D L K+
Sbjct: 118 FDPRCKIGTLCGIASKQAPETVL-AIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKV 176

Query: 181 FKCNDLKPDEFVKEQLNTEHPQDNDVADED---------TTRKKEENRESN---EPDFEV 228
           FK   L+P  FV   L+T+  +DN+++ +            +++E+ +E++   E   EV
Sbjct: 177 FKMK-LEP-PFV---LSTQ-SKDNNISSKQIESSEQIKAVEKEQEDVKEASVDVEEIAEV 230

Query: 229 LDHFKTEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSW 288
           LDHF   DVDYFITR+LYYT+TQD  +ELPISASNFIS HI +NLP I HNEVN+KKTSW
Sbjct: 231 LDHFTVSDVDYFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSW 290

Query: 289 KKTAKFLKHXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNT 348
           KK+AKFLKH                T+VG N  KDELKNFVPYK+G S + + S  S  T
Sbjct: 291 KKSAKFLKHFEKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSKSATESRES--T 348

Query: 349 NDKSDTKGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMK 408
             K  T GMMYS T YKP N AKDLLK V  + +   YT Q+IR  V+ YI+ KNL D K
Sbjct: 349 TSKEKTSGMMYSLTLYKPFNLAKDLLKEV-NLASHTYYTSQDIRSAVSQYISVKNLADTK 407

Query: 409 NKKMILLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELM 468
           +K  +++DDLLF+MV+K++   NA+ R + RG IL P+L NNFTE YQI++         
Sbjct: 408 DKGKVIMDDLLFDMVNKKKKVLNAS-RIIARGEILHPLLTNNFTEFYQIFK--------- 457

Query: 469 EDVEPLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTT 528
            D   LFK+P +G LP I I+TEMKIGRKVIT+VSNFE+F +  + LAADLRK+CSGSTT
Sbjct: 458 SDDTLLFKAPMKGSLPHIKIITEMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTT 517

Query: 529 IGETMTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568
           I E+ T  K  EVQVQGPHGQ IIDHLN K G+P+KWI++
Sbjct: 518 ISESQTF-KCAEVQVQGPHGQSIIDHLN-KLGIPSKWIDF 555

>Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON}
           YDR117C (REAL)
          Length = 562

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/571 (55%), Positives = 396/571 (69%), Gaps = 22/571 (3%)

Query: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60
           MFKKEPHIKALSNLKNS+RKKLLQT K QTN + Y F  S I KQTNF +    S+G ++
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTI-KQTNFCSQK--SVGVVY 57

Query: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120
           T+++N PI FK KHN+ L+PTV++CW N  +LP +L+H FVI+E LFNGANLMISG+IPP
Sbjct: 58  TDENNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPP 117

Query: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180
           FD R   GTLCG+AS + PK +V AIG+V+M++PS+D+V+GETGVAV+VIHHF D L K 
Sbjct: 118 FDPRSKVGTLCGVASREAPK-VVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKA 176

Query: 181 FKCNDLKP-DEFVKEQLNTEHPQDNDVAD--EDTTRKKEENRESNEPDFEVLDHFKTEDV 237
            K     P  +   E +N++  Q  + A   E+     ++ +   E   EVLDHF   DV
Sbjct: 177 LKVKLDPPIAKSGDEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLDHFSVSDV 236

Query: 238 DYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTAKFLKH 297
           DYFITR+LYYT+TQD  + LPIS SNFIS HI +NLP I HNEVN+KKTSW+K+AKFLKH
Sbjct: 237 DYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKH 296

Query: 298 XXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKSDTKGM 357
                           T+VG    KDELKNFVPYK+G ST  S   S  + N K  T GM
Sbjct: 297 FEKEGFLKLKGKGDDLTIVGKTIDKDELKNFVPYKVGSST--SAQESGEHANSKEKTPGM 354

Query: 358 MYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKMILLDD 417
           MYS T YKP + AKD LK    +  +  YT Q+IR  ++ YI++ NL D K+K  +++DD
Sbjct: 355 MYSMTLYKPFSIAKDFLKEA-NLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDD 413

Query: 418 LLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVEPLFKS 477
           LLFNMV+K++   NAA R M R  IL+P+LANNFTE YQI++          D   LFK+
Sbjct: 414 LLFNMVNKKKKNLNAA-RIMPRAQILDPLLANNFTEFYQIFK---------NDDSLLFKA 463

Query: 478 PQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGETMTSPK 537
           P +G  P+I I TEMKIGRKVIT+VSNFE+F I  + LA DLRK+CSGSTTIGE+ T  K
Sbjct: 464 PIKGSPPRIKITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTF-K 522

Query: 538 TPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568
           + EVQVQGPHGQ+IIDHLN   GVP KWI++
Sbjct: 523 SAEVQVQGPHGQLIIDHLN-NLGVPNKWIDF 552

>TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {ON}
           Anc_8.269 YDR117C
          Length = 558

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/569 (52%), Positives = 401/569 (70%), Gaps = 24/569 (4%)

Query: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60
           MFKKEPHIKALSNLKNS+RKKLLQ+ K QT    YNF+ S I+KQTN++  +  S GT++
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTS-IVKQTNYKGQH--SDGTVY 57

Query: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120
           T+ +N+PIWFK KH +LL+PTV++CW   ++LP +L+HDFVI+E+LFNGANLM++GT+PP
Sbjct: 58  TDQNNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPP 117

Query: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180
           FD R +P  +CGIAS  DPK ++ AIGVV++N+PS+  V+G+ G+AV+V+H+F D L + 
Sbjct: 118 FDERCVPAKVCGIASRTDPK-VILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQA 176

Query: 181 FKCNDLKPDEFVKEQLNTEHPQDNDVADEDTTRKKEENRE-SNEPDFEVLDHFKTEDVDY 239
           FK  D++P     E +  E  ++      ++ +++  + E S E   +VLD    EDVD+
Sbjct: 177 FKI-DIEPAVLSSEPVEEEEEEEGKEKLTESPKRETFHTEISIEDVAQVLDELSVEDVDH 235

Query: 240 FITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTAKFLKHXX 299
           F TR+LYYT T DT + +PI+ASNFIS HI  NLP +  ++VN+KKTSWKKTAKFLKH  
Sbjct: 236 FFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHFE 295

Query: 300 XXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKSDTKGMMY 359
                          +VG+NK KDELKNFVPYK    T      +S   ++K  + GMMY
Sbjct: 296 KVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQT------ASKKNSNKDSSPGMMY 349

Query: 360 SETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKMILLDDLL 419
           SE  YKPIN  KD ++    +P K LYT  E++D V  YI +K L+D KNKKM+LLDDLL
Sbjct: 350 SEKLYKPINLGKDFIQC-SDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVLLDDLL 408

Query: 420 FNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVEPLFKSPQ 479
           F+M + R+ +    PR + R  I++P +ANNFTE YQ+++  +          PLFK+P 
Sbjct: 409 FDMFY-RKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDED---------TPLFKNPI 458

Query: 480 RGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGETMTSPKTP 539
           RG LP++ I+TEMKIGRKV+T+VS+FE F +  + LAA+LRKLCSGSTTIGET+TSPK  
Sbjct: 459 RGPLPRVKIVTEMKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVA 518

Query: 540 EVQVQGPHGQIIIDHLNKKFGVPTKWINY 568
           EVQVQG HG +IID+LNK+ G+PTKWI++
Sbjct: 519 EVQVQGAHGPLIIDYLNKQ-GIPTKWIDF 546

>ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 567

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/572 (53%), Positives = 396/572 (69%), Gaps = 22/572 (3%)

Query: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60
           MFKK+PH+KALSNLKNS+ KKLL T + QT  + Y+F  + +IKQTNFQ  +   IGT++
Sbjct: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFP-TGVIKQTNFQAQS--GIGTVY 57

Query: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120
           T+  N PIWFK KH +LLYPTVF CW++  +LP +L+H FV++E+LFNGANLM++GT+ P
Sbjct: 58  TDADNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLP 117

Query: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180
           FDSRL PGT+CGIAS   P  +V A+GVV++++PS+D V+G+TGVAV+++H+  D L K+
Sbjct: 118 FDSRLKPGTVCGIASKNAPD-VVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKV 176

Query: 181 FKCNDLKPDEFVKEQLNTEHPQDNDVADEDTTRKKEENRESNEPDF----EVLDHFKTED 236
           FK N   P          E  ++           +E   +    D     EVLD F+ ED
Sbjct: 177 FKVNAEPPVSLEDSDEEEEEEEEVLEESAQQPSSQEIPSQEKAVDIDDIAEVLDEFRLED 236

Query: 237 VDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTAKFLK 296
           VD F+TR+LYYT+T DTK+ELPISASNFIS HIN NLP + H +VN+KK+SWKKTAKFLK
Sbjct: 237 VDQFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLK 296

Query: 297 HXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKSDTKG 356
           +                T++G+NK K EL+NF PY+I   +    + SS   N+K D   
Sbjct: 297 NFEKEGFLKLKGKGDDLTIIGINKQKPELQNFQPYQISGGSGGGGNSSS--NNNKKDGSP 354

Query: 357 MMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKMILLD 416
            +  ET YKPIN AKD ++     P   LYT QE+++ +  YI S NL D KNKKM++LD
Sbjct: 355 QLRCETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILD 414

Query: 417 DLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVEPLFK 476
           DLL+++V+K+Q +   APR + R TI+EP+LAN+FT H+QIY     KG++     PLFK
Sbjct: 415 DLLYHLVNKKQKDT-TAPRLVSRATIIEPLLANSFTPHFQIY-----KGDI-----PLFK 463

Query: 477 SPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGETMTSP 536
           +P RG+LP I+I+TEMKIGRKVIT+VS FEIF I  D LAA LR+LCSGSTTIGETMTSP
Sbjct: 464 NPSRGNLPNIEIVTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSP 523

Query: 537 KTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568
           K  EV VQGPHG +IIDHLN   G+PTKWI +
Sbjct: 524 KYKEVTVQGPHGPLIIDHLN-SLGIPTKWIKF 554

>Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/580 (56%), Positives = 404/580 (69%), Gaps = 37/580 (6%)

Query: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60
           MFKKEPHIKALSNLKNS+RKKLLQT   QTN E Y F  S IIKQTNF      S+GT++
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTS-IIKQTNFGGQK--SVGTVY 57

Query: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120
           T+++NIPI FK KH + LYPTV++CW N  +LP +L+H FVI+E LFNGANLMISG+IPP
Sbjct: 58  TDENNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPP 117

Query: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180
           FDSR   GTLCG+A  Q PK +V AIGVV++++PS+D+V+GETGVAV+VIHHF D LFK 
Sbjct: 118 FDSRCNVGTLCGVAGKQSPK-VVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKA 176

Query: 181 FKCNDLKP-----DEFVKEQLN---TEHPQDNDVADEDTTRKKEENRESNEPDF----EV 228
           FK   L+P      E   E +N   TE P+    AD     K +E+ +   PD     EV
Sbjct: 177 FKVK-LEPPVVLNTESEDENINSKQTETPEQVKSAD-----KSQESIKKTAPDLEEVAEV 230

Query: 229 LDHFKTEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSW 288
           LDH    DVDYFITR+LYY++TQD  + LPISAS FIS HI +NLP I HNEVN+KK+SW
Sbjct: 231 LDHLTVSDVDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSW 290

Query: 289 KKTAKFLKHXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNT 348
           KK+AKFLKH                T+VG N  KDELKNFVPYK+G S +PS   S  N 
Sbjct: 291 KKSAKFLKHFEKEGILKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCS-SPSKG-SGENA 348

Query: 349 NDKSDTKGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMK 408
             K  T GMM+S T YKP + AKDLL+    +     YT Q++R+ V+ YI+ KNL D K
Sbjct: 349 TSKDRTSGMMHSLTLYKPFSLAKDLLREA-KLGCDTYYTSQDVRNAVSEYISVKNLADKK 407

Query: 409 NKKMILLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELM 468
           +K+ +++DDLLFNMV+K++   +   R + R  IL+P+L+NNFTE YQI+R         
Sbjct: 408 DKRKVVMDDLLFNMVNKKKKTPDTT-RIIARSEILQPLLSNNFTEFYQIFR--------- 457

Query: 469 EDVEPLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTT 528
            D   LF+ P +G  P+I I+TEMKIGRKVITKVSNFE+F I  + LAADLRK+CSGSTT
Sbjct: 458 NDDTLLFRVPMKGCPPRIKIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTT 517

Query: 529 IGETMTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568
           IGE+ T  K+ EVQVQGPHGQ IID+LNK  G+P+KWI++
Sbjct: 518 IGESQTF-KSAEVQVQGPHGQFIIDYLNKS-GIPSKWIDF 555

>TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {ON}
           Anc_8.269 YDR117C
          Length = 583

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/574 (52%), Positives = 397/574 (69%), Gaps = 22/574 (3%)

Query: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60
           MFKK P++KA SNLKNS+RKKLLQ+ K Q N   YNF +S IIKQ N++     S GT++
Sbjct: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSS-IIKQANYKGQT--SAGTVY 57

Query: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120
           T++ N+PIWFK KH+D+L+P+V+TCW N  +LP ++++ +VI+EK+ NGANLMISGT+ P
Sbjct: 58  TDEQNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLP 117

Query: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180
           FD RLI G LCGIAS + P  +V AIG+V++++ S+ KVVGETGVAV V+H+  D L   
Sbjct: 118 FDERLICGALCGIASYKKP-NVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDS 176

Query: 181 FKCNDLKPDEFVKEQLNTEH---PQD-NDVADEDTTRKKE--ENRESNEPDFEVLDHFKT 234
           FK N L+P E   E   T      QD  DV +E T   K+   +   N+   EVL+    
Sbjct: 177 FKMN-LEPPETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPNDDLAEVLETLPV 235

Query: 235 EDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTAKF 294
           + +D FIT+SLYY++T D K+E PISASNFIS +I  NLP + ++ VN+KK+SWKKTAKF
Sbjct: 236 DIIDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKF 295

Query: 295 LKHXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKSDT 354
           L+H                 + G NK K ELK+FVPY+ G     S       TND SD 
Sbjct: 296 LRHFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTGNGN--STKSKKDKTNDTSDN 353

Query: 355 KGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKMIL 414
             MM S ++YKPI+  KDL++     P K LYT  E+RD +T YIN KNL+D KNKKMIL
Sbjct: 354 GDMMQSVSYYKPISLGKDLIRE-SVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMIL 412

Query: 415 LDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVEPL 474
           +DDL++++V+K+++  +A PR + R  ++EPI  NNF EH+QIY+K +      E   PL
Sbjct: 413 MDDLMYSLVYKKKN--SAEPRLISRADVIEPITKNNFNEHFQIYKKGDN-----ETAVPL 465

Query: 475 FKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGETMT 534
           FK P RG +P+++I+TEMKIGRKVIT+VSNFE+F I ++ LAADLRKLC+G+TTIGET+T
Sbjct: 466 FKKPIRGSIPKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLT 525

Query: 535 SPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568
           SPKT EVQVQGPH Q+II HLN    +PTKWI++
Sbjct: 526 SPKTAEVQVQGPHSQVIIKHLN-SLSIPTKWIDF 558

>KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 574

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/582 (47%), Positives = 380/582 (65%), Gaps = 31/582 (5%)

Query: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60
           MFKKEP IKALSNLKNS+RK +    K QT    Y F  S +IKQT F+T  P + GT+F
Sbjct: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFP-SQVIKQTTFKT--PFTTGTVF 57

Query: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120
           T+  N+PIWFK K +DLLYPTVFTCW+N  +LP +L+H++V++EKL  GANLM+ GT+PP
Sbjct: 58  TDQKNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPP 117

Query: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180
           FD R +   +  +AS   P  +V AIG+V++N+P + +V+GE+GVAVE++H F DEL K+
Sbjct: 118 FDERCVKTRMVSVASTAAPD-VVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKV 176

Query: 181 FKCNDLKPDEFVKEQLNTEHPQDNDVADEDTTRKKEEN-------RESNEPDFEV----- 228
           FK   L+P E     L++E  ++ D+ D+       E+       ++  EP   V     
Sbjct: 177 FKVK-LQPPEGSAAILDSESEEEADIEDDTGVPSAPESLAAPKSLQDVQEPLVNVEDISE 235

Query: 229 -LDHFKTEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTS 287
            L   + EDVD+F TRSLYY++  D K+E PISASNF+S HI +NLP I H +VN+KKTS
Sbjct: 236 QLTELRVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTS 295

Query: 288 WKKTAKFLKHXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPN 347
           WKKTAKFLK+                T++G+++TK ELKNF PY+IG   + S   +S  
Sbjct: 296 WKKTAKFLKYFEKEGFLKLKGKGDDLTIIGVDRTKSELKNFAPYRIGGGASSSEKGASSV 355

Query: 348 TNDKSDTKGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDM 407
            N+K +   +M + + Y+PI+  K  L A   +P   ++TQQ+I+  V  YI++KNL+  
Sbjct: 356 ANEK-EQASVMKAVSLYRPISSTKAFLSAT-DLPPNQMFTQQDIKSAVDKYISAKNLVSP 413

Query: 408 KNKKMILLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGEL 467
            NK  + LDDLL+++V++   + NA  RT+ R  I+ P+L  NF+EH+ I         L
Sbjct: 414 DNKSAVRLDDLLYDLVNRSSKKENAV-RTIARAQIMAPVLKGNFSEHFLI---------L 463

Query: 468 MEDVEPLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGST 527
             D  PLFK P +G +PQ+ I+TEMKIGRKV+TKVSNFE F + +D LA  LRK CSGST
Sbjct: 464 KADGTPLFKHPVKGSIPQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGST 523

Query: 528 TIGETMTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINYV 569
           TIGE  TSPKT EV VQGPHG  +I+ LN+  G+PTKWIN+V
Sbjct: 524 TIGEANTSPKTLEVTVQGPHGPAVIELLNES-GIPTKWINFV 564

>CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117c
          Length = 569

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/577 (50%), Positives = 394/577 (68%), Gaps = 28/577 (4%)

Query: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60
           MFKKEPHIKALSNLKNS+RKKL +  + QT+ E Y+F  SN IKQTNF+     +IGTI+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFG-SNTIKQTNFKGIT--TIGTIY 57

Query: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120
           T++ N PIWFK KH++ LYPTV  CW   +++P +L+H  V+++ +FNGANLMISGTIPP
Sbjct: 58  TDEGNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPP 117

Query: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180
           FD RL  GT+CGIA  + P  IV A+G+V+MN+PSF +V+GETGVAV+++HH EDELFK+
Sbjct: 118 FDERLTVGTVCGIADKRTPNLIV-AVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKV 176

Query: 181 FKCNDLKPDEFVKEQLNTEHPQDN--DVADEDT---TRKKEENRESNEPDF-EVLDHFKT 234
           FK  +  P E ++ Q ++    +   D+ +++T   +    E  +SN  D  EVLD  + 
Sbjct: 177 FKVKEEPPAELLQTQSSSSEELELEADIHEDETKVESNSDTEKEKSNLDDMAEVLDELRL 236

Query: 235 EDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISH-NEVNIKKTSWKKTAK 293
           ED+DYFITR+LYYTI+QDTK+E P SASNF+S HIN NLP  ++  EVNIKK+SWKKTAK
Sbjct: 237 EDIDYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAK 296

Query: 294 FLKHXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNT-NDKS 352
           FLKH                T+V +NK KDE+K F+PY       P       NT ++  
Sbjct: 297 FLKHFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPY-------PVIGNQGSNTGSEGG 349

Query: 353 DTKGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKM 412
           + K  +   T YKPIN AKD + +   +P K LY + EI++++  YI  K+L+D K+KK 
Sbjct: 350 NAKTTIKIVTLYKPINLAKDFISS-NKVPLKQLYMEPEIKELINKYITMKDLVDKKDKKC 408

Query: 413 ILLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVE 472
           +L+DD+L  M++K++ +     R + R  IL+P+L NNF ++Y ++R          +  
Sbjct: 409 VLVDDMLMTMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGN------EQT 462

Query: 473 PLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGET 532
           PL K+P +G  P+I+I+TEMKIGRKVITKVSNFE+F I  +  AAD+RK CSGSTTIGET
Sbjct: 463 PLTKTPLKGEPPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGET 522

Query: 533 MTSP-KTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568
            +S  KT EVQVQGPHGQ+I+ +LN   G+P KWI++
Sbjct: 523 TSSAKKTAEVQVQGPHGQLIMSYLN-DLGIPNKWIDF 558

>KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON}
           Anc_8.269 YDR117C
          Length = 562

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/574 (49%), Positives = 383/574 (66%), Gaps = 29/574 (5%)

Query: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60
           MFKKEP IKALS LKNSDRKKL+Q++K Q   +       + I QTNF +T   + GTI+
Sbjct: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTT--AAGTIY 58

Query: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120
           T+ ++IPI FK+KH+D LYPT F  W+N+ +L T+ +H  V++  +FNGA+LMI+GT+PP
Sbjct: 59  TDSNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPP 118

Query: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180
           FDS L  GT+C +A+ + P  +  A+G+VK+N+P + +V+G+TGVAVE++HHFED LF  
Sbjct: 119 FDSTLTIGTICAVATKEAPD-VAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFST 177

Query: 181 FKCNDLKP---DEFVKEQLNTEHPQDNDVADEDTTRKKEENRESNEPD--FEVLDHFKTE 235
           FK     P      ++E+   +  +++D A++++    E    S  PD   EVLD    E
Sbjct: 178 FKAKLEIPASVKSILQEETTADVAKESD-AEQESQSVTEPPSGSEGPDDIAEVLDELTVE 236

Query: 236 DVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTAKFL 295
           DVDYFI R+LY+T+ QD  + LP+ AS F+S HI +NLPD+ H +VNIK+TSWKKTAKFL
Sbjct: 237 DVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKFL 296

Query: 296 KHXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKSDTK 355
           K+                 +VGMNK KDELKNFVPYKIG +   + S S     D + T+
Sbjct: 297 KYFEKEGFLKLKGKGDDLIIVGMNKDKDELKNFVPYKIGNTAKKAASKS-----DSTQTQ 351

Query: 356 GMMYSET-FYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKMIL 414
           G+  S    YKPIN  +  +K    I   P+YT  EIR+ +  YI  KNL+D K+KKM++
Sbjct: 352 GVSVSSVNLYKPINLGQKFIKE-SNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVM 410

Query: 415 LDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVEPL 474
           LDDLLF MV+ R+ +    PR + R  ILEP++ANNF E++Q+Y+  N          PL
Sbjct: 411 LDDLLFAMVN-RKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDN---------TPL 460

Query: 475 FKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGETMT 534
           FK+P +G  P+IDI+TEMKIGRKV+T+VSNFE F IS + LAADLRKLCSGSTTI E  T
Sbjct: 461 FKNPIKGQTPKIDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISE--T 518

Query: 535 SPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568
             K  EVQVQGPHGQ+IIDH NK  G+P+K+I +
Sbjct: 519 PKKVSEVQVQGPHGQLIIDHFNKS-GIPSKFIQF 551

>SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 563

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/576 (49%), Positives = 394/576 (68%), Gaps = 34/576 (5%)

Query: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60
           MFKK+PHIKALSNLKNS+RKKLL +++ Q  +  Y F  + ++KQT F+     S GT++
Sbjct: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFP-TQVVKQTTFKGQT--SAGTVY 57

Query: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120
           T++ N+PIWFK KH  L++PTVFTCW+N DILP + +H  V++EKL  GA+LM+ G +PP
Sbjct: 58  TDEQNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPP 117

Query: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180
           F S+   G+L G+AS + P R++ AIG+V++++PS+ +V+GETGVAV +IH F+D L K 
Sbjct: 118 FSSKCSKGSLVGVASTRSP-RVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKA 176

Query: 181 FKCNDLKPDEFVKEQLNTEHPQDN---DVADED-----TTRKKEENRESNEPDFEVLDHF 232
           FK   L+P E +++  +    Q+    D ADE      TT+ +  N E      E L+  
Sbjct: 177 FKMK-LEPPEAIEDTSSKTEEQEEEHVDSADEAKAIATTTQARMVNTEDAS---EQLNEL 232

Query: 233 KTEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTA 292
             ED+D+F+TRSLYYT+TQD +++LP++ASNF+S HI  NLP + HN++N+KK+SWKK+A
Sbjct: 233 SAEDIDHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSA 292

Query: 293 KFLKHXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKS 352
           KFLKH                 VVG+NK KDELK FVPY+IG    P+ + +    N   
Sbjct: 293 KFLKHFEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKAQENS-- 350

Query: 353 DTKGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKM 412
               MM + + YKPI+ AK+  KAV   P K ++T QE++  + SYI  KNL++  +KKM
Sbjct: 351 ---NMMQAVSLYKPISSAKEFSKAVDLPPNK-IFTAQELKAALDSYILKKNLVNKDDKKM 406

Query: 413 ILLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVE 472
           +LLDD LF M+++   + NA  RT+ R  I+ P LANNFTEH+QI      KG++     
Sbjct: 407 VLLDDTLFPMINRSTKKENAL-RTISRAQIMPPFLANNFTEHFQIL-----KGDV----- 455

Query: 473 PLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGET 532
           PLFK+  +G +P+I I+TEMKIGRKV+TKVSNFE F + ++ LAA+LRK CSGSTTIGET
Sbjct: 456 PLFKTALKGAIPEIQIVTEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGET 515

Query: 533 MTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568
           M+SPKT EV VQGPHG I+I  LN ++G+PTKWIN+
Sbjct: 516 MSSPKTLEVTVQGPHGAIVIGMLN-EYGIPTKWINF 550

>Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117C -
           Hypothetical ORF [contig 173] FULL
          Length = 562

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/578 (48%), Positives = 379/578 (65%), Gaps = 35/578 (6%)

Query: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60
           MFKKEP IKALSNLKNS+RKKL    + Q     Y+F  S +IKQT F+T  P + GT++
Sbjct: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFP-SQVIKQTTFKT--PFTTGTVY 57

Query: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120
           T+D NIPIWFK K +DLLYPTVF+CW+N D++P +L+H++V++EKL  GANLM+ GT+PP
Sbjct: 58  TDDKNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPP 117

Query: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180
           FD R +   + G+AS   P  +V AIG+V++N+P + +V+GE+GVAVE++H F+DEL K 
Sbjct: 118 FDERCVKTKMVGVASTHSPD-VVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKA 176

Query: 181 FKCNDLKPDEFVKEQLNTEHPQDNDVADEDTTRKKEENRES---NEP------DFEVLDH 231
           FK   L+P E       ++  +++D   E +   K E + S    EP        E L  
Sbjct: 177 FKVK-LQPPEGADGIAESDSEENSDA--EVSGAIKIEPKPSAPLQEPIVNIDDAAEQLSQ 233

Query: 232 FKTEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKT 291
              EDVD+F TR+LYYT+TQD+K+E+P SASNF+S HI +NLP + H +VN+KKTSWKKT
Sbjct: 234 LSVEDVDHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKT 293

Query: 292 AKFLKHXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDK 351
           AKFLKH                T+VG++KTKDELK+FVPY+ G ++  S    S   +  
Sbjct: 294 AKFLKHFEKEGFLKLKGKGDDLTIVGLDKTKDELKHFVPYRTGGNSGGSTGSESEQNS-- 351

Query: 352 SDTKGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKK 411
                MM +   YKP++ AK  L A    P   +++ QE++  V +YI SK L+   NK 
Sbjct: 352 -----MMKALVIYKPMSSAKPFLCATDLSPNS-MFSPQELKGAVDAYIASKGLVSQDNKA 405

Query: 412 MILLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDV 471
            + LDDLLF++V++   + NA  RT++R  I+ PIL  NF EH+ +         L  D 
Sbjct: 406 AVRLDDLLFSLVNRSTKKENAV-RTILRAQIMPPILKGNFAEHFLV---------LKPDG 455

Query: 472 EPLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGE 531
            PLFK P +G +PQI I+TEMKIGRKV+TKVSNFE F + +D LA  LRK CSGSTTIGE
Sbjct: 456 TPLFKHPVKGDIPQIQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGE 515

Query: 532 TMTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINYV 569
           T TSPKT EV VQGPHG  +I+ LN +  +PTKWIN+V
Sbjct: 516 TTTSPKTTEVTVQGPHGPAVIELLN-QLAIPTKWINFV 552

>Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)
           [1701 nt, 567 aa]
          Length = 566

 Score =  492 bits (1266), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 285/577 (49%), Positives = 377/577 (65%), Gaps = 31/577 (5%)

Query: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60
           MFKK PHIK+LSNLKNS+RKKLLQ+ K QT    YNF  S +IKQTNF      S+G I+
Sbjct: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTS-VIKQTNFNAQT--SVGVIY 57

Query: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120
           T++   P+WFK KH++LL+PTV+TCW +  +LP +L+HD VI E +FNGANLMISGT+PP
Sbjct: 58  TDEEGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPP 117

Query: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180
           FDSRL+P T+CGIA+  +P  IV A+GVV+++MPS+  V+G+TGVAV V+H++ D +   
Sbjct: 118 FDSRLVPATICGIATRNNPNTIV-AVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVA 176

Query: 181 FKCNDLKP------DEFVKEQLNTEHP---QDNDVADEDTTRKKEENRESNEPDFEVLDH 231
           FK     P      D+ V    N + P    + +  ++D+  +   N  S     E    
Sbjct: 177 FKMKRDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEE--SA 234

Query: 232 FKTEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKT 291
              ED+D+FITRSLYYT+T D K+  PI +S+FIS HI +NLP + HN VNIKKTSWKK+
Sbjct: 235 LTVEDIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKS 294

Query: 292 AKFLKHXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDK 351
           +KFLKH                T+VG NK K+ELK F PY+I  S++ S    + N   +
Sbjct: 295 SKFLKHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRISNSSSNSGKKINSN---R 351

Query: 352 SDTKGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKK 411
            +++ MMYS  FY P   AK  +  +  +P K  YT  E+++ VT YI  K L+D KN K
Sbjct: 352 QESENMMYSLVFYSPKGSAKQFM-TLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPK 410

Query: 412 MILLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDV 471
           M  LDD L++M + ++S     PR + R  ++E    NNFTE YQ+++          D 
Sbjct: 411 MANLDDRLYDMCYTKKS--TNPPRHITRAAVIESFTTNNFTELYQLFK---------NDD 459

Query: 472 EPLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGE 531
            PL K+P RG  P+I I+TEMKIGRK++T+VSNFE FGI +D LA DLR+LCSGSTTIGE
Sbjct: 460 TPLTKNPVRGSPPRIKIVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCSGSTTIGE 519

Query: 532 TMTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568
           T TSPKT EVQVQGPH +IIIDHLN    +PTKWI++
Sbjct: 520 TTTSPKTTEVQVQGPHSKIIIDHLN-SLSIPTKWIDF 555

>KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]
           {ON} similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117C RBF64 Hypothetical ORF
          Length = 570

 Score =  436 bits (1120), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 257/583 (44%), Positives = 353/583 (60%), Gaps = 40/583 (6%)

Query: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60
           MF KEPHIK LSNLKNSDRKKL  TIK Q N E YN   + +IKQT+FQ  N    G+I+
Sbjct: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQIN-EEYNLPTA-VIKQTSFQVAN--VAGSIY 56

Query: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWN-NHDILPTLLSHDFVIQEKLFNGANLMISGTIP 119
           T++SN PIWFK+K  D LYPT+F+ WN    +LP +L+HDFVI++ +  GA LM+ GT+P
Sbjct: 57  TDESNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVP 116

Query: 120 PFDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFK 179
           PF S +  G++ GIAS +DP  +V AIG+ +M++     V+G  G+AV V+H+ +D LFK
Sbjct: 117 PFPSNVKRGSIVGIASTKDP-LLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFK 175

Query: 180 IFKCNDLKPDEFVKEQLNTEHPQDNDVADEDTTRKKE---------ENRESNEPDFEVLD 230
            FK  +L+P   V    N+E P +    +  T++  E         E   S  P  E+ D
Sbjct: 176 AFKL-ELEPPAVV---YNSE-PIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIAD 230

Query: 231 HFK---TEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTS 287
             +    EDVD+ + R++ Y+I  D K+ LPI AS FIS H+ KNLPD+  N VNIKK+S
Sbjct: 231 ELEEMSIEDVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSS 290

Query: 288 WKKTAKFLKHXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPN 347
           WKK  K LK+                TV+ +NK   +L N   YK     T +   S   
Sbjct: 291 WKKATKLLKYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKT--LATIAKKSSGDT 348

Query: 348 TNDKSDTKGMMYS-ETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLID 406
           TN  +  K   YS E  YKP++  +  +  +     +  YTQQE++ ++  Y+ + NLID
Sbjct: 349 TNQSNKNKITAYSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLID 408

Query: 407 MKNKKMILLDDLLFNMVHKRQSEANAAPRTMMRGTILEP-ILANNFTEHYQIYRKRNGKG 465
            +NK ++  DD L+ M ++  +  N   + + RG I+ P  L+ NF  ++QIY K NG  
Sbjct: 409 PENKSLVKYDDTLYQMSNR--APQNGGIQKIARGLIVSPTFLSKNFNTYHQIY-KPNG-- 463

Query: 466 ELMEDVEPLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSG 525
                 EPL K P++G +P ++I+TE KIGRKVIT+V+NFE F I S+ LAA LRK CSG
Sbjct: 464 ------EPLLKVPEKGPIPTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSG 517

Query: 526 STTIGETMTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568
           STTIGE+  S KT EVQVQGPHG I+I  LN  +G+PTKWI++
Sbjct: 518 STTIGES-KSTKTAEVQVQGPHGSIVISILN-DYGIPTKWISF 558

>KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.269
           YDR117C
          Length = 561

 Score =  409 bits (1051), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 245/581 (42%), Positives = 344/581 (59%), Gaps = 44/581 (7%)

Query: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60
           MFKK PHIK LSNLKNS+++KL Q ++ Q  ++ + F+  N +KQTNFQ+T   S+GTI+
Sbjct: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSG-NTVKQTNFQSTT--SVGTIY 57

Query: 61  TNDSNIPI--WFKSKHNDL-LYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGT 117
            ND  IP+  +FK KH    L+P+V+ CW++  +LP +L+H  VI++ LFNGANLMISGT
Sbjct: 58  LNDEKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGT 117

Query: 118 IPPFD-SRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEV--IHHFE 174
           +PPFD + L  G  CGIA+ + P  I+ A+G +KM++  F+         V V   HHF 
Sbjct: 118 MPPFDVAHLHKGRPCGIANYKSPDVII-AVGTLKMDLEPFNTTGVVGHSGVVVEVAHHFA 176

Query: 175 DELFKIFKCNDLKPDEFVKEQLNTEHPQDNDVADEDTTRKKEENRESNEPDF----EVLD 230
           D L   F+     PD+        E     +VA+E     K  +  +N        EVL+
Sbjct: 177 DGLADAFRLKLDIPDKL-------ESATTQEVAEEPPVEAKPTSPVTNPVAVDDLAEVLE 229

Query: 231 HFKTEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLP-DISHNEVNIKKTSWK 289
               EDVDYF+TR+LYYT+TQ+ K+ LPI+ASNF+S H+ K LP  I   EVN+KK+SWK
Sbjct: 230 TLSVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWK 289

Query: 290 KTAKFLKHXXXXXXXXXXXXXXXXTVVGM--NKTKDELKNFVPYKIGKSTTPSFSLSSPN 347
           KTAK+LKH                 VVG   +KT   LK+FVPY +G S   S    S  
Sbjct: 290 KTAKYLKHFEKEGLLKLKGKGDDLVVVGSTDSKTHAGLKDFVPYLVGNSIAES-GPKSQT 348

Query: 348 TNDKSDTKGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDM 407
           TN       +M++ T ++P + A+  L     +  +  ++  EIR+++  YI +  L   
Sbjct: 349 TNGP-----VMFAVTSFQPDSTAQTALP----LGGQRYFSGPEIREVLNEYITANKLAQP 399

Query: 408 KNKKMILLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGEL 467
            N KM+LL+D LF MV K   E     R M R  ILE ++  +F   YQ+++ ++     
Sbjct: 400 NNPKMVLLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKD----- 454

Query: 468 MEDVEPLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGST 527
                PL K PQ+G  P++ I+TEMKIGRKV+T+V NF+   I     AADLRKLCS ST
Sbjct: 455 ----TPLTKHPQKGEPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSAST 510

Query: 528 TIGETMTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568
           TIG+T+++P   E+QVQG HG +IIDHL ++ GVP+ W+ +
Sbjct: 511 TIGKTVSTPVVSEIQVQGAHGPLIIDHL-RELGVPSSWVVF 550

>TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {ON}
           Anc_8.269 YDR117C
          Length = 563

 Score =  406 bits (1044), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 237/578 (41%), Positives = 342/578 (59%), Gaps = 36/578 (6%)

Query: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60
           MFKK   I  LSNLKNS+ + + QT +   +   Y F  S + KQT F++T   + G I+
Sbjct: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQV-KQTTFEST--VANGVIY 57

Query: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120
           T+ +N+PIWFK K+++ + PTV+T W   + +P + +HDF+I+ K+FNGANLMI GT+ P
Sbjct: 58  TDSNNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGP 117

Query: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180
            D RL PG +CGIAS + P  I+ AIG+   +M + D  +G+TGVAVEV+H + DEL  I
Sbjct: 118 HDERLKPGKICGIASTKVPGTIL-AIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNI 176

Query: 181 FKCNDLKPDEFVKEQLNTEHPQDNDVADEDTTRKKEENR---------ESNEPDF-EVLD 230
           FK     P       L T      +   ++ +  + E +          SN  D  E L+
Sbjct: 177 FKIKLNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLE 236

Query: 231 HFKTEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKK 290
             + ED+D F+T+SLYYTITQ+T ++LPI +S F+S ++ KNLP++ HN+VNIKK+SWKK
Sbjct: 237 QLRVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKK 296

Query: 291 TAKFLKHXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTND 350
           TAKFLKH                T+ G NK K +LK FVPY+IGK   P+ +L S    D
Sbjct: 297 TAKFLKHFEKEGFLKLKGKGDDLTITGFNKEKPQLKTFVPYRIGK---PAGALPS---KD 350

Query: 351 KSDTKGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNK 410
           K D K  +   T Y P         A+  + +K  +T  EI   +  YI  KNL + K+K
Sbjct: 351 KQDNKNFLKVVTLYSPKKKNDSCWTAL-GLTSKSYFTSAEITSAIQGYIAKKNLANPKDK 409

Query: 411 KMILLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMED 470
             I +DD+LF++V    ++ANA  R +MR  ++EP+L NNF  ++Q++           D
Sbjct: 410 AKISMDDVLFDLVI-TNNKANAN-RNIMRSQVVEPVLVNNFLLYHQLF---------THD 458

Query: 471 VEPLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIG 530
              L K P++G  P + ++TE     KVIT+VSNFE+F I +  ++ +L+ LCSGST+I 
Sbjct: 459 NISLSKHPKKGSPPTVKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIE 518

Query: 531 ETMTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568
           E    P   EVQVQGPHG I++++  +K G+P KW +Y
Sbjct: 519 EL---PNGSEVQVQGPHGDIVMEYF-EKHGIPRKWFDY 552

>Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii AGR079W
          Length = 564

 Score =  402 bits (1034), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 230/581 (39%), Positives = 352/581 (60%), Gaps = 39/581 (6%)

Query: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60
           MFKK+P IK+ SNLKNS+RKKLL  ++ Q   + + F+ + I+KQ  F+T  P + GTIF
Sbjct: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTT-IVKQATFKT--PTATGTIF 57

Query: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120
           T++ N PI+FK KH++ L PT+ TCW    +L  +L+H  V+  KL NGA+LM+ GTIPP
Sbjct: 58  TDEDNKPIFFKEKHSEFLIPTILTCWQYPGLLHVVLTHKHVLDNKLKNGADLMLPGTIPP 117

Query: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180
           F      G L G+AS + P  +V AIGV ++N+    KVVGETGVAV+V+H   D L+++
Sbjct: 118 FSDNCTRGKLVGVASSETP-FVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEV 176

Query: 181 FKCNDLKPDEFV---KEQLNTEHPQDNDVA-----DEDTTRKKEENRESNEPD-----FE 227
           FK +   P + +   K ++  E     D A     DED    K  +    EP+      E
Sbjct: 177 FKMSVEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAE 236

Query: 228 VLDHFKTEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTS 287
            L+    E VD+F+T+++YYT+  D  ++LPI ASNFI+ H+ KNLP I   +V++K++S
Sbjct: 237 QLEELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSS 296

Query: 288 WKKTAKFLKHXXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPN 347
           W + +KFLK+                TVV +NK K E+K+F PY   ++   S S SS N
Sbjct: 297 WARASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPY---RTIQKSVSTSSKN 353

Query: 348 TNDKSDTKGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDM 407
            NDK D + ++Y    Y+P+N AK  L A+   P   +   ++I+ I+  Y+  K L++ 
Sbjct: 354 -NDKHDVEVVVY----YQPLNTAKATLHALGNNPN-AMLKAKDIKAILNKYVTEKKLVNA 407

Query: 408 KNKKMILLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGEL 467
            ++++ILLDD LF++ +K+   A+ + R ++R  + + IL+ +FTE + I++        
Sbjct: 408 TDERIILLDDTLFSLAYKKS--ASDSTRKVLRAKMFDLILSTSFTEVFFIFK-------- 457

Query: 468 MEDVEPLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGST 527
             D +PL   P +     + ++TEMKI RK++T++SNFEI+G+  + L+ +LRK CSGS+
Sbjct: 458 --DGKPLSSKPLKSKNRNVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSS 515

Query: 528 TIGETMTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568
           T+ E  T   T EVQVQGPHG   I+ LN + G+P+K+I++
Sbjct: 516 TVLEPSTLQSTTEVQVQGPHGNTAINILN-EHGIPSKYIDF 555

>AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR117C
          Length = 542

 Score =  358 bits (918), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 206/574 (35%), Positives = 319/574 (55%), Gaps = 52/574 (9%)

Query: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60
           MFKKEP++   SN KNS+RK+L  +I+ Q   E+Y F+++ I K   F+T +  ++GT++
Sbjct: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEI-KHGTFKTQS--TVGTVY 57

Query: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120
           T+ +NIP+WF+ KH+    PTV++CW++ D+LP + +H+ V++ KL  GA+LM+ GT+PP
Sbjct: 58  TDPNNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPP 117

Query: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180
           F S    G + GIAS + P  +V A+G+ +M++     V   TGVAV V+H + D L ++
Sbjct: 118 FSSGTRRGRVVGIASTRAPG-VVKAVGICEMDLEGVTTVADTTGVAVRVLHTYGDGLCRV 176

Query: 181 FKCNDLKPDEFVKEQLNTEHPQDNDVADEDTTRKKEENRESNEPD---FEVLDHFKTEDV 237
           FK     P+    +  + E             R+ E       P     E L+    EDV
Sbjct: 177 FKVQREAPEASEAKGASPE------------AREPEAEPPKTAPGEGLAEELERLTMEDV 224

Query: 238 DYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTAKFLKH 297
           D+ +TR++YYTI  D +++LP++AS FI++H+ KNLP +  ++V +K++SW K AK LKH
Sbjct: 225 DHLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKH 284

Query: 298 XXXXXXXXXXXXXXXXTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKSDTKGM 357
                           TVV +N   + LK+F PY+       + S +S  T         
Sbjct: 285 FEAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGSKNSSTTQSLEIVYHY 344

Query: 358 MYSETFYKPIN----HAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKMI 413
           + + T    +N       D L A            ++IRD +  Y+ ++  +D  +K M+
Sbjct: 345 VPNRTLLPQLNGLGISGGDALSA------------KDIRDRLEQYVAARKCVDPYDKSML 392

Query: 414 LLDDLLFNMVHKRQSEANA-APRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVE 472
            LDD L  ++HK     NA  PR++ R   L  +L+ +F+E++ +          M    
Sbjct: 393 RLDDTLAQLLHK---NVNADTPRSLPRPEALAALLSRSFSEYFVV----------MRGDA 439

Query: 473 PLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGET 532
           PL K PQ+G  P I +  E KI +KV+TKVSNFE++G+  + LAA+LR  CSGSTTI + 
Sbjct: 440 PLSK-PQKGRAPPIKVTNERKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDV 498

Query: 533 MTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWI 566
             + K  EVQVQGPH   I+  LN K G+P+K+I
Sbjct: 499 PNT-KAVEVQVQGPHEATIVSILN-KHGIPSKYI 530

>ZYRO0G06776g Chr7 (543464..543757) [294 bp, 97 aa] {ON} similar to
           uniprot|Q12497 Saccharomyces cerevisiae YDR070C FMP16
           The authentic non-tagged protein was localized to the
           mitochondria
          Length = 97

 Score = 35.4 bits (80), Expect = 0.063,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 5/59 (8%)

Query: 200 HPQDNDVADEDTTRKKEENRESNEPDFEVLDHFKTEDVDYFITRS--LYYTITQDTKVE 256
           H +DN  ADE T +K   N + N+   E ++H +T+DVDY   RS      I +D +VE
Sbjct: 33  HRKDNLTADEQTEQK---NFDDNQARLEEMEHSRTKDVDYTHQRSEAELRKIGEDAQVE 88

>TPHA0P00650 Chr16 complement(134232..135554) [1323 bp, 440 aa] {ON}
           Anc_3.166 YOL061W
          Length = 440

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 30/47 (63%), Gaps = 6/47 (12%)

Query: 379 TIPTKPLYTQQEIRDI-----VTSYINSKNLI-DMKNKKMILLDDLL 419
           +I TKPL  Q+E+RD+       + + +  L+ D++NK  IL+DDL+
Sbjct: 298 SISTKPLLKQEELRDVKRVASTPTIVQTTMLVGDVRNKVCILVDDLV 344

>SAKL0G06226g Chr7 (518015..519313) [1299 bp, 432 aa] {ON} weakly
           similar to uniprot|Q03703 Saccharomyces cerevisiae
           YML037C Hypothetical ORF
          Length = 432

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 202 QDNDVADEDTTRKKEENRESNEP-DFEVLDHF 232
           Q+N   DEDT R+  ENRE N+P D + +D+F
Sbjct: 19  QENTAYDEDTGRQANENREGNKPEDVDSIDNF 50

>Ecym_7243 Chr7 complement(511468..512430) [963 bp, 320 aa] {ON}
           similar to Ashbya gossypii AGL080C
          Length = 320

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 8/75 (10%)

Query: 380 IPTKPLYTQQEIRDIVTSYINSKNLIDMK-----NKKMILLDDLL---FNMVHKRQSEAN 431
           +P   LY +  +   +  +IN K+ I +       K+  LL D L   F ++HK +++AN
Sbjct: 143 VPVDNLYAEPSVVRYIKEHINHKDAIIISPDAGGAKRASLLSDRLNLNFALIHKERAQAN 202

Query: 432 AAPRTMMRGTILEPI 446
              R ++ G + + I
Sbjct: 203 EVSRMVLVGDVTDKI 217

>TPHA0A03920 Chr1 complement(867407..870277) [2871 bp, 956 aa] {ON}
           Anc_3.295 YBR074W
          Length = 956

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 59/134 (44%), Gaps = 10/134 (7%)

Query: 69  WFKSKHNDLLYPTVFTCWNN--HDILPTLLSHDFVIQEKLFNGANLMISGTIPPFDSRLI 126
           WF+   + ++   +  C +N    + P +LS ++V+   LF G  L+ +  +     RL 
Sbjct: 393 WFRLPISLMVSCLITYCTSNVLKALNPFILSSNYVLATLLFVGVFLISNYIVLNVFERLS 452

Query: 127 PGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHH----FEDE---LFK 179
           P       ++ +   ++WAI  ++ N  S+      TG+    I +    F      LF 
Sbjct: 453 PTLDFKTVAINEVSVLLWAILFIQ-NTKSYYNNYKNTGIYPLTISYAFVSFAGNIAYLFM 511

Query: 180 IFKCNDLKPDEFVK 193
           IFK   + P+E VK
Sbjct: 512 IFKKTTITPEETVK 525

>NCAS0A04100 Chr1 complement(827360..828814) [1455 bp, 484 aa] {ON}
           Anc_2.408 YLR033W
          Length = 484

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 8/53 (15%)

Query: 22  LLQTIKTQTNLETY-------NFNNSNIIKQTNFQTTNPPSIGTIFTNDSNIP 67
           L  +I T+++LET        NF  +N+I QTN +  + P +G +  N SNIP
Sbjct: 185 LFSSIITRSHLETRPQELPNSNFEINNVIAQTNLE-QDSPKLGFLAANTSNIP 236

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,828,933
Number of extensions: 3259967
Number of successful extensions: 16009
Number of sequences better than 10.0: 81
Number of HSP's gapped: 16517
Number of HSP's successfully gapped: 81
Length of query: 579
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 464
Effective length of database: 40,294,809
Effective search space: 18696791376
Effective search space used: 18696791376
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)