Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0J012908.273ON75753881e-50
CAGL0B01875g8.273ON74691122e-08
YDR119W-A (COX26)8.273ON66721103e-08
Smik_4.3648.273ON65721086e-08
Skud_4.3808.273ON66721086e-08
Suva_2.2808.273ON66721009e-07
NCAS0B037708.273ON6061954e-06
KLLA0F19371g8.273ON8064941e-05
TPHA0A017408.273ON7977922e-05
TBLA0F030308.273ON7535887e-05
Kpol_YGOB_YDR119W-A8.273ON7541889e-05
SAKL0H16786g8.273ON7465861e-04
TDEL0F040008.273ON6227825e-04
KAFR0B054408.273ON6635790.001
Ecym_42978.273ON7436790.002
Kwal_YGOB_YDR119W-A8.273ON7431750.006
KLTH0G13442g8.273ON7431690.045
ZYRO0D06908g8.273ON7771680.068
KLLA0F19382gsingletonON7561640.26
KNAG0H031708.273ON7132620.64
TDEL0G003805.15ON37428612.0
KLTH0B09966g5.19ON80750593.4
NOTE: 1 genes in the same pillar as NDAI0J01290 were not hit in these BLAST results
LIST: KAFR0B02760

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0J01290
         (75 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.27...   154   1e-50
CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar ...    48   2e-08
YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}  COX26Putat...    47   3e-08
Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A ...    46   6e-08
Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A ...    46   6e-08
Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A ...    43   9e-07
NCAS0B03770 Chr2 complement(674509..674691) [183 bp, 60 aa] {ON}       41   4e-06
KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some s...    41   1e-05
TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}...    40   2e-05
TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}...    39   7e-05
Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON} A...    39   9e-05
SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa] {...    38   1e-04
TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273...    36   5e-04
KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa] {O...    35   0.001
Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON} s...    35   0.002
Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74 a...    33   0.006
KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa] {...    31   0.045
ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON...    31   0.068
KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some s...    29   0.26 
KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}...    28   0.64 
TDEL0G00380 Chr7 (78655..79779) [1125 bp, 374 aa] {ON} Anc_5.15 ...    28   2.0  
KLTH0B09966g Chr2 (831234..833657) [2424 bp, 807 aa] {ON} simila...    27   3.4  

>NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 75

 Score =  154 bits (388), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 75/75 (100%), Positives = 75/75 (100%)

Query: 1  MLFNSVLKRSIRNTAVRQFVTNGAAHTIRPVRGLPWVSSEIQRVAPTILRWSTFLVVVLG 60
          MLFNSVLKRSIRNTAVRQFVTNGAAHTIRPVRGLPWVSSEIQRVAPTILRWSTFLVVVLG
Sbjct: 1  MLFNSVLKRSIRNTAVRQFVTNGAAHTIRPVRGLPWVSSEIQRVAPTILRWSTFLVVVLG 60

Query: 61 WPAPFYYYHKIKYQS 75
          WPAPFYYYHKIKYQS
Sbjct: 61 WPAPFYYYHKIKYQS 75

>CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar
          to uniprot|Q2V2P9 Saccharomyces cerevisiae YDR119wa
          Length = 74

 Score = 47.8 bits (112), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 39/69 (56%), Gaps = 9/69 (13%)

Query: 2  LFNSVLKRSIRNTAVRQFVTNGAAHTIRPVRGLPWVSSEIQRVAPTILRWSTFLVVVLGW 61
          + NS + RS+ +TA  Q     A   I P     W  +EI+R+ PT++ W++FL V LGW
Sbjct: 13 VMNSSMTRSLSSTARTQ-----AQGRIGP----SWTIAEIKRLTPTLIGWASFLTVTLGW 63

Query: 62 PAPFYYYHK 70
          P   Y++ K
Sbjct: 64 PFGIYFWKK 72

>YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}
          COX26Putative protein of unknown function; copurifies
          with respiratory chain supercomplexes composed of
          Complex III (ubiquinol-cytochrome c reductase) and
          Complex IV (cytochrome c oxidase)
          Length = 66

 Score = 47.0 bits (110), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 8/72 (11%)

Query: 1  MLFNSVLKRSIRNTAVRQFVTNGAAHTIRPVRGLPWVSSEIQRVAPTILRWSTFLVVVLG 60
          M F+ VL+ S R   ++++ T G         G  WV +E +R+ P I +WS  L V LG
Sbjct: 1  MFFSQVLRSSARAAPIKRY-TGGRI-------GESWVITEGRRLIPEIFQWSAVLSVCLG 52

Query: 61 WPAPFYYYHKIK 72
          WP   Y++ K +
Sbjct: 53 WPGAVYFFSKAR 64

>Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A
          (REAL)
          Length = 65

 Score = 46.2 bits (108), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 8/72 (11%)

Query: 1  MLFNSVLKRSIRNTAVRQFVTNGAAHTIRPVRGLPWVSSEIQRVAPTILRWSTFLVVVLG 60
          M F+ VL+ S R   ++++ T G         G  WV +E +R+ P + +WS  L + LG
Sbjct: 1  MFFSEVLRSSARAAPIKRY-TGGRV-------GESWVITEGRRLIPEVFQWSATLSICLG 52

Query: 61 WPAPFYYYHKIK 72
          WP+  Y++ K +
Sbjct: 53 WPSAVYFFSKAR 64

>Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 46.2 bits (108), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 8/72 (11%)

Query: 1  MLFNSVLKRSIRNTAVRQFVTNGAAHTIRPVRGLPWVSSEIQRVAPTILRWSTFLVVVLG 60
          M F+ VL+ S R   ++++ T G         G  WV +E +R+ P +L+WS  L + LG
Sbjct: 1  MFFSQVLRSSARAAPIKRY-TGGRV-------GESWVITEGRRLIPEVLQWSAALSICLG 52

Query: 61 WPAPFYYYHKIK 72
          WP   Y+  K +
Sbjct: 53 WPGAVYFLSKAR 64

>Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 43.1 bits (100), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 8/72 (11%)

Query: 1  MLFNSVLKRSIRNTAVRQFVTNGAAHTIRPVRGLPWVSSEIQRVAPTILRWSTFLVVVLG 60
          M F+ VL+ S R   ++++ T G         G  W+ +E +R+ P + +W   +   LG
Sbjct: 1  MFFSQVLRSSARAAPIKRY-TGGRV-------GEAWMITESRRLIPEVFQWGAVICTCLG 52

Query: 61 WPAPFYYYHKIK 72
          WP   Y++ K +
Sbjct: 53 WPGAVYFFSKAR 64

>NCAS0B03770 Chr2 complement(674509..674691) [183 bp, 60 aa] {ON}
          Length = 60

 Score = 41.2 bits (95), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 37/61 (60%), Gaps = 4/61 (6%)

Query: 1  MLFNSVLKRSIRNTAV--RQFVTNGAAHTIRPVRGLPWVSSEIQRVAPTILRWSTFLVVV 58
          M+FN++L+ + R      RQ  T   ++T+ P+ G+ W+  E++RV PT+  W++ L+  
Sbjct: 1  MIFNTILRNTARRAGASSRQAFTR--SYTVGPLTGVRWLKGEVKRVTPTLGVWASILITT 58

Query: 59 L 59
          L
Sbjct: 59 L 59

>KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 80

 Score = 40.8 bits (94), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 33/64 (51%), Gaps = 3/64 (4%)

Query: 1  MLFNSVLKRS--IRNTAVRQFVTNGAAHTIRPVRGLPWVSSEIQRVAPTILRWSTFLVVV 58
          M F   L+ +  I      Q  T  A  + R V G  W  +E +R+ PTIL + TF+V V
Sbjct: 1  MFFTKALRSTATIAMNHATQTTTKTAVRSGRRV-GEAWAVTEARRLGPTILMYGTFIVSV 59

Query: 59 LGWP 62
          LGWP
Sbjct: 60 LGWP 63

>TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 79

 Score = 40.0 bits (92), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 3/77 (3%)

Query: 2  LFNSVLKRSIRNTAVRQFV---TNGAAHTIRPVRGLPWVSSEIQRVAPTILRWSTFLVVV 58
          +F+ ++ +S    A RQ +   +N A        G  W+ +E +RV P +L W + +  V
Sbjct: 1  MFSKIISQSTARIANRQIIRHSSNAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTV 60

Query: 59 LGWPAPFYYYHKIKYQS 75
          L WP+   Y+    Y+ 
Sbjct: 61 LLWPSFIKYFKDPNYKE 77

>TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 75

 Score = 38.5 bits (88), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 36 WVSSEIQRVAPTILRWSTFLVVVLGWPAPFYYYHK 70
          W  +E++R+ P I  W+T L V LGWP  F +Y  
Sbjct: 31 WAVTEVKRIVPNIAFWATLLSVSLGWPFCFVWYQD 65

>Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 75

 Score = 38.5 bits (88), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 22/41 (53%)

Query: 33 GLPWVSSEIQRVAPTILRWSTFLVVVLGWPAPFYYYHKIKY 73
          G  W  +E +RV PTI+ W T L  +L WP   Y+Y    Y
Sbjct: 35 GESWAVTEAKRVFPTIIGWGTTLTAILSWPFIIYHYKAPDY 75

>SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa]
          {ON} similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A Pi
          Length = 74

 Score = 37.7 bits (86), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 4/65 (6%)

Query: 2  LFNSVLKRSIRNTAVRQFVTNGAAHTIRPVR----GLPWVSSEIQRVAPTILRWSTFLVV 57
          +F+S + RS    +     + GA+  +        G PW  +E +R+ PTI  W   +  
Sbjct: 1  MFSSQVLRSTAAISRSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAA 60

Query: 58 VLGWP 62
          VLGWP
Sbjct: 61 VLGWP 65

>TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 62

 Score = 36.2 bits (82), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 16/27 (59%)

Query: 36 WVSSEIQRVAPTILRWSTFLVVVLGWP 62
          W  SE +R+ P IL W  FL   LGWP
Sbjct: 26 WAVSEAKRLTPAILGWGGFLAGCLGWP 52

>KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa]
          {ON} Anc_8.273 YDR119W-A
          Length = 66

 Score = 35.0 bits (79), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 22/35 (62%)

Query: 33 GLPWVSSEIQRVAPTILRWSTFLVVVLGWPAPFYY 67
          G P++  + ++   TI  W TFL+V LGWP+  YY
Sbjct: 28 GPPYLYLKAKQDVKTIAAWGTFLLVALGWPSVIYY 62

>Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON}
          similar to Saccharomyces cerevisiae YDR119W-A
          Length = 74

 Score = 35.0 bits (79), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 21/36 (58%)

Query: 33 GLPWVSSEIQRVAPTILRWSTFLVVVLGWPAPFYYY 68
          G PW+ +E +R+ PTIL W   +  +L WP  F  Y
Sbjct: 33 GEPWMVTETKRLVPTILIWGGTMTGILLWPIIFRVY 68

>Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74
          aa] {ON} ANNOTATED BY YGOB -
          Length = 74

 Score = 33.5 bits (75), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%)

Query: 32 RGLPWVSSEIQRVAPTILRWSTFLVVVLGWP 62
          R   W   E +R+ PT+  W+T + ++LGWP
Sbjct: 36 RARQWAVIEAKRIVPTVAMWATSMTIMLGWP 66

>KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa]
          {ON} conserved hypothetical protein
          Length = 74

 Score = 31.2 bits (69), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 16/31 (51%)

Query: 32 RGLPWVSSEIQRVAPTILRWSTFLVVVLGWP 62
          R   W   E +R+ P I  W  F+  VLGWP
Sbjct: 36 RARKWAVIEAKRLVPAIGMWGAFMGAVLGWP 66

>ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON}
          similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A
          Length = 77

 Score = 30.8 bits (68), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 7/71 (9%)

Query: 1  MLFNSVLKRSIRNTAVRQFVTNGAAHTI-RPVRGLPWVSSEIQRVAPTILRWSTFLVVVL 59
          M F  VL    RN+AV    T  AA  I +   G  W   E +R++   + W+  L ++L
Sbjct: 1  MFFTQVL----RNSAVS--ATKQAAKQISKSSAGEQWGLLEARRLSRGAVEWAVSLSLIL 54

Query: 60 GWPAPFYYYHK 70
           WPA    + +
Sbjct: 55 AWPAAIIKFSE 65

>KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 75

 Score = 29.3 bits (64), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/61 (22%), Positives = 30/61 (49%), Gaps = 4/61 (6%)

Query: 2  LFNSVLKRSIRNTAVRQFVTNGAAHTIRPVRGLPWVSSEIQRVAPTILRWSTFLVVVLGW 61
          +F  +L+    +    + V   + H +    G  W  SE +R+AP ++ ++ F+  ++ W
Sbjct: 1  MFIRLLRAGKEHATTARRVVYASGHHV----GESWTKSETRRLAPNLITYALFIGTMVTW 56

Query: 62 P 62
          P
Sbjct: 57 P 57

>KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 71

 Score = 28.5 bits (62), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 39 SEIQRVAPTILRWSTFLVVVLGWPAPFYYYHK 70
          +EI+R  P +  W + L +VL WP  F +Y++
Sbjct: 35 TEIKRRIPQVALWGSGLFLVLEWPFFFKWYNQ 66

>TDEL0G00380 Chr7 (78655..79779) [1125 bp, 374 aa] {ON} Anc_5.15
           YMR305C
          Length = 374

 Score = 28.1 bits (61), Expect = 2.0,   Method: Composition-based stats.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 36  WVSSEIQRVAPTILRWSTFLVVVLGWPA 63
           WV  +IQRV+ T     T +V   GWP+
Sbjct: 290 WVLEQIQRVSTTCNNEKTVVVTESGWPS 317

>KLTH0B09966g Chr2 (831234..833657) [2424 bp, 807 aa] {ON} similar
           to uniprot|P32843 Saccharomyces cerevisiae YMR302C PRP12
           Integral inner mitochondrial membrane protein with
           similarity to exonucleases
          Length = 807

 Score = 27.3 bits (59), Expect = 3.4,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 31/50 (62%), Gaps = 7/50 (14%)

Query: 4   NSVLKRSI---RNTAVRQFVTNGAAHTIRPVRGLPWVSSEIQRVAPTILR 50
           NS+++++     + ++  FVT  AA    PV+G PW+  +++R+  T+++
Sbjct: 140 NSIIQQNTAKESSKSILSFVTRAAAF---PVKGSPWI-EDLRRLPSTVIK 185

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.137    0.445 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,573,108
Number of extensions: 225359
Number of successful extensions: 562
Number of sequences better than 10.0: 22
Number of HSP's gapped: 562
Number of HSP's successfully gapped: 22
Length of query: 75
Length of database: 53,481,399
Length adjustment: 47
Effective length of query: 28
Effective length of database: 48,092,097
Effective search space: 1346578716
Effective search space used: 1346578716
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)