Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0J012808.272ON69469432490.0
TPHA0A017508.272ON6365012592e-22
TDEL0F039908.272ON6315032592e-22
Kwal_56.237548.272ON5894932502e-21
AGR076C8.272ON6864852404e-20
ZYRO0C01430g8.272ON5903982297e-19
KLTH0G13464g8.272ON5934872252e-18
Kpol_543.448.272ON6434852128e-17
YDR119W (VBA4)8.272ON7687011985e-15
Kwal_26.6669singletonON5905101903e-14
SAKL0H16808g8.272ON6572651762e-12
Smik_4.3638.272ON7654801762e-12
KLLA0A04631g8.272ON5794191691e-11
TBLA0F030408.272ON9064411621e-10
Skud_4.3798.272ON7591301396e-08
KLLA0F17776gna 1ON5534301288e-07
Ecym_42988.272ON6784801262e-06
NCAS0B037808.272ON589801262e-06
Suva_2.2798.272ON7751191243e-06
SAKL0E04246gna 1ON5654251145e-05
KAFR0B054508.272ON625221020.001
SAKL0C02178gsingletonON565304940.011
KAFR0I01560singletonON632189840.20
Kpol_1053.243.84ON620173810.40
Suva_8.12na 2ON633195780.94
TBLA0A079705.469ON500159780.99
CAGL0C01771g6.155ON48568771.1
SAKL0C12122gna 3ON611198771.3
KLLA0A10439gsingletonON63495771.4
KNAG0K01020singletonON599128761.5
ZYRO0G07414gsingletonON707195761.5
TPHA0K02330singletonON63169752.2
SAKL0C09350g3.84ON578149752.3
Kwal_56.227243.84ON578138724.5
TPHA0J016803.53ON56296724.7
Skud_4.588.446ON68749725.5
CAGL0E04092gna 2ON645192715.6
Kpol_2001.581.133ON63382715.7
TPHA0M00120singletonON619197715.9
KNAG0J02980singletonON636195715.9
NCAS0I00100singletonON16351686.0
YHL040C (ARN1)na 2ON627190708.1
Smik_16.81na 4ON62555708.2
TPHA0G003507.519ON138053709.0
YEL065W (SIT1)na 5ON628199699.8
NOTE: 1 genes in the same pillar as NDAI0J01280 were not hit in these BLAST results
LIST: KNAG0H03180

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0J01280
         (694 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8....  1256   0.0  
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...   104   2e-22
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...   104   2e-22
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...   100   2e-21
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    97   4e-20
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    93   7e-19
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    91   2e-18
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    86   8e-17
YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protei...    81   5e-15
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...    78   3e-14
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    72   2e-12
Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W ...    72   2e-12
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    70   1e-11
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    67   1e-10
Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W ...    58   6e-08
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    54   8e-07
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    53   2e-06
NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa] {O...    53   2e-06
Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W ...    52   3e-06
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    49   5e-05
KAFR0B05450 Chr2 complement(1116514..1118391) [1878 bp, 625 aa] ...    44   0.001
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    41   0.011
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C      37   0.20 
Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON} (36161....    36   0.40 
Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON} Y...    35   0.94 
TBLA0A07970 Chr1 (1971258..1972760) [1503 bp, 500 aa] {ON} Anc_5...    35   0.99 
CAGL0C01771g Chr3 (187030..188487) [1458 bp, 485 aa] {ON} simila...    34   1.1  
SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} simi...    34   1.3  
KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {...    34   1.4  
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    34   1.5  
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...    34   1.5  
TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON}              33   2.2  
SAKL0C09350g Chr3 complement(849691..851427) [1737 bp, 578 aa] {...    33   2.3  
Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {...    32   4.5  
TPHA0J01680 Chr10 (388361..390049) [1689 bp, 562 aa] {ON}              32   4.7  
Skud_4.58 Chr4 complement(98588..100651) [2064 bp, 687 aa] {ON} ...    32   5.5  
CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} simila...    32   5.6  
Kpol_2001.58 s2001 complement(162456..164357) [1902 bp, 633 aa] ...    32   5.7  
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}                32   5.9  
KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON}              32   5.9  
NCAS0I00100 Chr9 complement(4805..5296) [492 bp, 163 aa] {ON}          31   6.0  
YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}  AR...    32   8.1  
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    32   8.2  
TPHA0G00350 Chr7 complement(58440..62582) [4143 bp, 1380 aa] {ON...    32   9.0  
YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}  SIT1Ferrioxa...    31   9.8  

>NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8.272
          Length = 694

 Score = 1256 bits (3249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/694 (90%), Positives = 630/694 (90%)

Query: 1   MGRKDKQRKRLRDFAKLKEKQRQLHLDQFIATSDNLKNKLIATSQNSVPQTIDEQPTGNI 60
           MGRKDKQRKRLRDFAKLKEKQRQLHLDQFIATSDNLKNKLIATSQNSVPQTIDEQPTGNI
Sbjct: 1   MGRKDKQRKRLRDFAKLKEKQRQLHLDQFIATSDNLKNKLIATSQNSVPQTIDEQPTGNI 60

Query: 61  EDNDSTELTPLLLKKQSENHIAVAESSGIDALKSDTVEEPIEEEVTSLAHQKQKNISDDN 120
           EDNDSTELTPLLLKKQSENHIAVAESSGIDALKSDTVEEPIEEEVTSLAHQKQKNISDDN
Sbjct: 61  EDNDSTELTPLLLKKQSENHIAVAESSGIDALKSDTVEEPIEEEVTSLAHQKQKNISDDN 120

Query: 121 QLXXXXXXXXXXXXXXXXXXXTNEAPIVPHKKIHSPSYGSIEQRLSHEEPAFTEEVVDLE 180
           QL                   TNEAPIVPHKKIHSPSYGSIEQRLSHEEPAFTEEVVDLE
Sbjct: 121 QLIEEPSRPQSSREEISSSASTNEAPIVPHKKIHSPSYGSIEQRLSHEEPAFTEEVVDLE 180

Query: 181 TNNRDISLLNEPQLTAGMXXXXXXXXXXXXXXXXXAMMLSTTSGSHVKQSSNSSWIIASY 240
           TNNRDISLLNEPQLTAGM                 AMMLSTTSGSHVKQSSNSSWIIASY
Sbjct: 181 TNNRDISLLNEPQLTAGMIFLFSLLLFTIIFDFTLAMMLSTTSGSHVKQSSNSSWIIASY 240

Query: 241 LITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIVMARFILGLAS 300
           LITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIVMARFILGLAS
Sbjct: 241 LITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIVMARFILGLAS 300

Query: 301 GSLIYVMLTIINKCILNKRFSRPSMKIFTIPIVGGLSLAYATAIFITSWQNVYFLLAIFS 360
           GSLIYVMLTIINKCILNKRFSRPSMKIFTIPIVGGLSLAYATAIFITSWQNVYFLLAIFS
Sbjct: 301 GSLIYVMLTIINKCILNKRFSRPSMKIFTIPIVGGLSLAYATAIFITSWQNVYFLLAIFS 360

Query: 361 FFTLFLIMFYFPSNESYKTNNTNLSSIVATLDIDLIGCTILSVFLLLIAVITTGNSNGFS 420
           FFTLFLIMFYFPSNESYKTNNTNLSSIVATLDIDLIGCTILSVFLLLIAVITTGNSNGFS
Sbjct: 361 FFTLFLIMFYFPSNESYKTNNTNLSSIVATLDIDLIGCTILSVFLLLIAVITTGNSNGFS 420

Query: 421 ITSPYSATXXXXXXXXXXXXXXXETTTNKNPIIPLDFIENKVIFFKSLTVFFASMSLITF 480
           ITSPYSAT               ETTTNKNPIIPLDFIENKVIFFKSLTVFFASMSLITF
Sbjct: 421 ITSPYSATLVISIILVGILLLLSETTTNKNPIIPLDFIENKVIFFKSLTVFFASMSLITF 480

Query: 481 IHYFPFYLEKTLNISLFDIYKRTSPMFLTILFIIITVSRRISTQNTLSYGLVTFFGIMGL 540
           IHYFPFYLEKTLNISLFDIYKRTSPMFLTILFIIITVSRRISTQNTLSYGLVTFFGIMGL
Sbjct: 481 IHYFPFYLEKTLNISLFDIYKRTSPMFLTILFIIITVSRRISTQNTLSYGLVTFFGIMGL 540

Query: 541 IGQCILLNYVYNDTADYKLWKQCMIGILPILGSTFLVIATLMDVTDDKKLPIISTSSFAV 600
           IGQCILLNYVYNDTADYKLWKQCMIGILPILGSTFLVIATLMDVTDDKKLPIISTSSFAV
Sbjct: 541 IGQCILLNYVYNDTADYKLWKQCMIGILPILGSTFLVIATLMDVTDDKKLPIISTSSFAV 600

Query: 601 STLGSILGICISGFIFNQGLYDELWVHSTEEKGLGKIIRKMINNXXXXXXXXXXXXXILE 660
           STLGSILGICISGFIFNQGLYDELWVHSTEEKGLGKIIRKMINN             ILE
Sbjct: 601 STLGSILGICISGFIFNQGLYDELWVHSTEEKGLGKIIRKMINNSEYESSSRYYCYEILE 660

Query: 661 SYFIVSGYVFLFSAICLLVAVISFCFTIKNKRHH 694
           SYFIVSGYVFLFSAICLLVAVISFCFTIKNKRHH
Sbjct: 661 SYFIVSGYVFLFSAICLLVAVISFCFTIKNKRHH 694

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score =  104 bits (259), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 125/501 (24%), Positives = 207/501 (41%), Gaps = 39/501 (7%)

Query: 224 GSHVKQSSNSSWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKT 283
           GS   +    SWI  +YL++    Q L  ++S  +     L++     F+    ++    
Sbjct: 123 GSEFNELPRISWIATAYLLSSATFQPLYGKISDIFGRKIVLTFCNVNFFI--GCLICGTA 180

Query: 284 VSFWWIVMARFILGLASGSLIYVMLTIINKCILNKRFSRPSMKIFTIPIVGGLSLAYATA 343
            SFW +V+ RFI G+  G  I  M TI    I+  R       +       G++L     
Sbjct: 181 KSFWVLVIGRFISGVGGGG-ITSMSTITVSDIIPLRNRALYQGVCNFYYGLGIALGGIIG 239

Query: 344 IFIT----SWQNVYFLLAIFSFFTLFLIMFYF---PSNESY---------KTNNTNLSSI 387
            + T    SW+  +      S  +   +M +      ++SY          +NN   S I
Sbjct: 240 GWFTEKLGSWRGAFLFQVPLSVISTVTVMVWLQLPKDSKSYGLEITMSNNSSNNGTESII 299

Query: 388 VATLD-IDLIGCTILSVFLLLIAVITTGNSNGFSITSPYSATXXXXXXXXXXXXXXXETT 446
           +  L  ID  G   L +FLL   ++++   +  S+ S                    E  
Sbjct: 300 MKKLKTIDWYGAMSLVIFLLSFMILSSAGGSDISVKSNTFLYLTLISVTSFISFIYIELK 359

Query: 447 TNKNPIIPLDFIENKVIFFKSLTVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPM 506
             K+PI+PL F++++ +   SL+ +F  M L+T  +Y P Y    + I  +D+ KRT P 
Sbjct: 360 FAKDPILPLVFLKDRSVLGSSLSNWFTMMLLMTISYYLPIYFTSVMGIGAYDVGKRTLPN 419

Query: 507 FLTILFIIITVSRRISTQNTLSYGLVTFFGIMGLIGQCILLNYVYNDTADYKLWKQCMIG 566
           F ++ F  +     +       Y  VTFF ++ +IG C+ + Y+ ND     +W+Q ++ 
Sbjct: 420 FFSVAFGSLGAGYYMKKTGKY-YWFVTFFCLVVVIG-CLQI-YLIND--GISVWRQYLLS 474

Query: 567 ILPILGSTFLVIATL--MDVTDDKKLPIISTS-SFAVSTLGSILGICISGFIFNQGLYDE 623
            +P LG+  L+   L  M V    +   ++TS S+A  + G  LG+ I   +F   L   
Sbjct: 475 FVPGLGAAVLITIALLSMIVAVPHEYQAVTTSISYAFRSTGCTLGVSIGAALFRDSLNKY 534

Query: 624 LWVHSTE---------EKGLGKIIRKMIN--NXXXXXXXXXXXXXILESYFIVSGYVFLF 672
           L     E         EK L +II       +             ILE Y      VFLF
Sbjct: 535 LRAKILELGSQNGNYSEKELLQIIDHASKSIDWVHNEAPRFFKRTILECYHYACKKVFLF 594

Query: 673 SAICLLVAVISFCFTIKNKRH 693
             IC ++A++S     ++K H
Sbjct: 595 CLICSVLALLSISMIKEHKLH 615

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score =  104 bits (259), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 128/503 (25%), Positives = 212/503 (42%), Gaps = 42/503 (8%)

Query: 218 MLSTTSG---SHVKQSSNSSWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLI 274
           ++STTS    S   Q S  SWI  SYL++    Q L  +VS  +   K L     + FLI
Sbjct: 130 IVSTTSAHVASEFNQLSKVSWIATSYLLSSATFQPLYGKVSDIFGR-KCLLVFTNVAFLI 188

Query: 275 GSSILTIKTVSFWWIVMARFILGLASGSLIYVM-LTIINKCILNKRFSRPSMKIFTIPIV 333
           G  +  + + SFWW+V+ARF+ G+  G L  +  +TI +   L +R    +M      + 
Sbjct: 189 GCLMCGL-SKSFWWLVIARFVAGVGGGGLTSMSSITITDLVPLRER----AMYQGICNVF 243

Query: 334 GGLSLAYATAIF------ITSWQNVYFLLAIFSFFTLFLIMFYFPSNESYKTNNTNLSSI 387
            GL  A    +          W+  + +    S  +L +I+ +        T N + S  
Sbjct: 244 YGLGTACGGIVGGWFSDNKGGWRMAFLIQVPLSAISLLVIILHLKLPSKRATRNQDNSIK 303

Query: 388 VATLDIDLIGCTILSVFLLLIAVITTGNSNGFSITSPYSATXXXXXXXXXXXXXXXETTT 447
              L ID +G + L +FL+L  +  +      +  S   A                E   
Sbjct: 304 RKLLAIDWLGASTLVIFLVLFLLTASLGGKEIAYGSRTFALMLISSLLSCLVFIYVELRV 363

Query: 448 NKNPIIPLDFIENKVIFFKSLTVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPMF 507
             +PI+PL F+  + +   SL+ +F  M+ +T  +Y P Y    LN+S  D+ KR  P F
Sbjct: 364 AADPILPLRFLAIRSVLGSSLSNWFCMMATMTTSYYLPIYFSGVLNMSPTDVGKRLMPNF 423

Query: 508 LTILFIIITVSRRISTQNTLSYGLVTFFGIMGLIGQCILLNYVYNDTADYKL--WKQCMI 565
            ++ F  +     +       Y     F  + ++GQ  +L        D K+  W+Q ++
Sbjct: 424 FSVAFGSLGAGYYMKKTRKY-YWFSLIFCAVAVLGQLQIL------LIDPKIPTWRQYIL 476

Query: 566 GILPILGSTFLVIATLMDV---TDDKKLPIISTSSFAVSTLGSILGICISGFIFNQGL-- 620
            ++P +G++ L+   L+ +      +     ++ S+A  + G  LG+ I G IF + L  
Sbjct: 477 LLVPGVGTSVLITVALLAMIAAVPHEHQAATTSISYAFRSAGCTLGVSIGGAIFRESLSK 536

Query: 621 ----YDELWV---HSTEEKGLGKIIRKMINNXXXXXXXXX--XXXXILESYFIVSGYVFL 671
               Y   ++   H  EE  L KII K   +               +LE Y       FL
Sbjct: 537 LTTRYVLRYISKEHPKEE--LLKIIDKASESSEWVHHSAPDFIRQTLLECYHKACKNTFL 594

Query: 672 FSAICLLVAVISFCFTIKNKRHH 694
           F  IC ++ ++SF   IK K+ H
Sbjct: 595 FCFICSILTLVSFSI-IKEKKLH 616

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 118/493 (23%), Positives = 207/493 (41%), Gaps = 32/493 (6%)

Query: 219 LSTTSGSHVKQSSNSSWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSI 278
           L T  GS        SWI  SYL++    Q L  ++S +    K L     ++F IG  I
Sbjct: 105 LLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGR-KPLLVFSNVVFSIGCLI 163

Query: 279 LTIKTVSFWWIVMARFILGLASGSLIYVMLTIINKCI-LNKRFSRPSMKIFTIPIVGGLS 337
             + T S WW+V+ RF+ G+    L  +   +I+  + L +R     +  F   + G  S
Sbjct: 164 CGMST-SIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGL-GTAS 221

Query: 338 LAYATAIFITSWQNVYFLLAIFSFFTLFLIMFYF---PSNESYKTNNTNLSSIVATLDID 394
                A F   W+  + +    S  +  LI+ Y    P +E  K  +          D+D
Sbjct: 222 GGLVGAAF-QDWRMAFTIQCPISLASCALIVSYLELPPRHEDDKDRHWT----SKLRDLD 276

Query: 395 LIGCTILSVFLLLIAVITTGNSNGFSITSPYSATXXXXXXXXXXXXXXXETTTNKNPIIP 454
             G   L  FL L  ++++      +  S   A                E     +P++P
Sbjct: 277 WAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLP 336

Query: 455 LDFIENKVIFFKSLTVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPMFLTILFII 514
           + F++ + +   SL  +FA MS++T  +Y P Y    LN+   DI KR+ P F ++ F  
Sbjct: 337 IAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGS 396

Query: 515 ITVSRRISTQNTLSYGLVTFFGIMGLIGQCILLNYVYNDTADYKLWKQCMIGILPILGST 574
           +     +       + L+ F GI G++GQ + +N +   T    +W+Q ++ ++P  G +
Sbjct: 397 LGAGIYMKRTGKYYWFLLAFCGI-GILGQ-LKINLL---TPATPVWQQYLLLVVPSFGLS 451

Query: 575 FLVIATLM---DVTDDKKLPIISTSSFAVSTLGSILGICISGFIF----NQGLYDELWVH 627
            L+  TL+        +     ++ S+A  + G+ LG+ I   IF    N  L +++   
Sbjct: 452 VLITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQF 511

Query: 628 STEEKGLGKIIRKMINNXXXXX------XXXXXXXXILESYFIVSGYVFLFSAICLLVAV 681
           +++E    +++R +INN                   ++E Y   S   F F  I +++A 
Sbjct: 512 ASDEHPREELLR-IINNAAHSANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILAG 570

Query: 682 ISFCFTIKNKRHH 694
            S C  I+    H
Sbjct: 571 AS-CSIIQEHTLH 582

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 97.1 bits (240), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 111/485 (22%), Positives = 198/485 (40%), Gaps = 42/485 (8%)

Query: 234 SWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIVMAR 293
           SWI  +YL++    Q L  ++S  +   + L     ++F +G+ I  +   + W +V+ R
Sbjct: 178 SWIATAYLLSSATFQPLYGKLSDIFGR-RPLLVFSNLVFCLGALICGMSK-NLWVLVLGR 235

Query: 294 FILGLASGSLIYVMLTIINKCILNKRFSRPSMKIFTI---------PIVGGLSLAYATAI 344
           F+ G+  G L   M +I    I+  R       I  +          +VGGL    A   
Sbjct: 236 FVAGIGGGGLT-SMCSITTTDIVPLRSRALYQGICNVFFGLGTACGGLVGGLFADRAVG- 293

Query: 345 FITSWQNVYFLLAIFSFFTLFLIMFYF----PSNESYKTNNTNLSSIVATLDIDLIGCTI 400
               W+  + +    +  +   I  +     P +        ++        +D  G   
Sbjct: 294 ----WRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVT 349

Query: 401 LSVFLLLIAVITTGNSNGFSITSPYSATXXXXXXXXXXXXXXXETTTNKNPIIPLDFIEN 460
           L VFL    ++ +          P+                  E     +PI+P+ F+EN
Sbjct: 350 LVVFLFCFTLVCSLYGEDL----PHLYLIFVVILLSGSYFIYHELYVATDPILPIRFLEN 405

Query: 461 KVIFFKSLTVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPMFLTILFIIITVSRR 520
           + +   SL+ +F  M ++T   Y P Y    LN+   DI KR  P F +  F  +     
Sbjct: 406 RSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYY 465

Query: 521 ISTQNTLSYGLVTFFGIMGLIGQCILLNYVYNDTADYKLWKQCMIGILPILGSTFLVIAT 580
           +       + L+ F  ++G++GQ + ++YV   T     W+Q  + ++P  GS  L+  T
Sbjct: 466 MKRTGKYYWFLLAFC-LVGVLGQ-VQISYV---TPSISTWRQYCLYMIPGFGSAVLLTVT 520

Query: 581 LMD--VTDDKKLPIISTS-SFAVSTLGSILGICISGFIFNQGLYDELW-----VHSTEEK 632
           L+   V   ++    +TS S+A  + GS LG+ I G IF  GL ++L+     + S E  
Sbjct: 521 LLALIVAVPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHP 580

Query: 633 G--LGKIIRKMINNX--XXXXXXXXXXXXILESYFIVSGYVFLFSAICLLVAVISFCFTI 688
              L +II K  ++               +++ Y     Y F F   C+++A ++ CF +
Sbjct: 581 ASELLRIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCFIV 640

Query: 689 KNKRH 693
           + K H
Sbjct: 641 EYKLH 645

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 44/106 (41%), Gaps = 20/106 (18%)

Query: 2   GRKDKQRKRLRDFAKLKEKQRQLHLDQFIATSDNLKNKLIATSQNSVPQTIDEQPTGNIE 61
           G K KQR RLR+FAK KE+QR L                    QN      D QP     
Sbjct: 7   GLKTKQRDRLREFAKRKERQRAL------------------AGQNQAGVGQDAQPARRQH 48

Query: 62  DNDSTELTPLLLKKQSENHIAVAESSGIDALKSDTVEEPIEEEVTS 107
              + E + LL  + S   +    SSG+  L +  +E   ++EV +
Sbjct: 49  RPRAGEQSGLL--EASRGTLVSDPSSGLSGLVASELEVQRQQEVCA 92

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 92.8 bits (229), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 98/398 (24%), Positives = 164/398 (41%), Gaps = 23/398 (5%)

Query: 234 SWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIVMAR 293
           SWI  +YL++    Q L  ++S  +   K L  +  ++FL+G  +  + T SFW +V AR
Sbjct: 117 SWIATAYLLSSATFQPLYGKLSDIFGR-KPLLMLNNIVFLVGCLMCGL-TPSFWGLVGAR 174

Query: 294 FILGLASGSLIYVM-LTIINKCILNKRFSRPSMKIF-------TIPIVGGLSLAYATAIF 345
           FI G+  G +  +  +TI +   L  R     M  F          +VGG    +     
Sbjct: 175 FISGIGGGGVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACGGVVGGWFSDHGGG-- 232

Query: 346 ITSWQNVYFLLAIFSFFTLFLIMFYFPSNESYKTNNTNLSSIVATLDIDLIGCTILSVFL 405
              W+  + +    S  +  LI  +       K  N+  S     L +D IG + L VFL
Sbjct: 233 ---WRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIGASALVVFL 289

Query: 406 LLIAVITTGNSNGFSITSPYSATXXXXXXXXXXXXXXXETTTNKNPIIPLDFIENKVIFF 465
            L  V  +      +  S                    E    K+PI+PL F+ N+ +  
Sbjct: 290 SLFLVTASLGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLG 349

Query: 466 KSLTVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPMFLTILFIIITVSRRISTQN 525
            S + +F  M+++T  +Y P Y    LN++   + KR  P F +     +     +    
Sbjct: 350 SSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTG 409

Query: 526 TLSYGLVTFFGIMGLIGQCILLNYVYNDTADYKLWKQCMIGILPILGSTFLVIATLMDV- 584
              Y L   F  + L+G  + +N +  D A    W+Q ++ ++P  G + L+   L+ + 
Sbjct: 410 KY-YWLTVGFCTLSLLGH-LQINLMKPDIAT---WRQFILLVIPGFGYSVLITVALLAMI 464

Query: 585 --TDDKKLPIISTSSFAVSTLGSILGICISGFIFNQGL 620
                      ++ S+A  + GS LG+ I G IF Q L
Sbjct: 465 AAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSL 502

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 91.3 bits (225), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 108/487 (22%), Positives = 187/487 (38%), Gaps = 30/487 (6%)

Query: 224 GSHVKQSSNSSWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKT 283
           GS       +SWI  SYL++    Q L  ++S +    K L      +F IG  I  +  
Sbjct: 114 GSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGR-KPLLVFSNAVFAIGCLICGLSN 172

Query: 284 VSFWWIVMARFILGLASGSLIYVMLTIINKCI-LNKRFSRPSMKIFTIPI---VGGLSLA 339
            S W +V  RFI G+    L  +   I++  + L  R     +  F   +    GGL  A
Sbjct: 173 -SIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGA 231

Query: 340 YATAIFITSWQNVYFLLAIFSFFTLFLIMFYFPSNESYKTNNTNLSSIVATLDIDLIGCT 399
           Y        W+  + L    S  +  LI+ Y         +N +  S      +D  G T
Sbjct: 232 Y-----FRDWRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWS-ARLRRLDWAGAT 285

Query: 400 ILSVFLLLIAVITTGNSNGFSITSPYSATXXXXXXXXXXXXXXXETTTNKNPIIPLDFIE 459
            L  FL L  + ++   +  +  S   A                E     +P++P+ F+ 
Sbjct: 286 SLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLR 345

Query: 460 NKVIFFKSLTVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPMFLTILFIIITVSR 519
           ++ +   SL  +F  MS++T   Y P Y    L +   D+ KR  P F ++ F  +    
Sbjct: 346 DRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGL 405

Query: 520 RISTQNTLSYGLVTFFGIMGLIGQCILLNYVYNDTADYKLWKQCMIGILPILGSTFLVIA 579
            +       Y L+ F  ++ + GQ  ++      T    +W+Q ++ ++P  G + L+  
Sbjct: 406 YMKRTGKYYYFLLAFC-VLAIAGQVQIVLI----TPQMPVWRQYLLQVVPGFGVSVLITV 460

Query: 580 TLMDV---TDDKKLPIISTSSFAVSTLGSILGICISGFIFNQGLYDELWVH-------ST 629
           TL+ +      +     ++ S+A  + G+ LG+ +   +F   L   L            
Sbjct: 461 TLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGH 520

Query: 630 EEKGLGKIIRKMI--NNXXXXXXXXXXXXXILESYFIVSGYVFLFSAICLLVAVISFCFT 687
            E+ L  II      ++             +LE Y   S   F F    +++A +S C  
Sbjct: 521 SERELRGIIASAARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVS-CSI 579

Query: 688 IKNKRHH 694
           IK  + H
Sbjct: 580 IKEHKLH 586

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 86.3 bits (212), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 112/485 (23%), Positives = 194/485 (40%), Gaps = 35/485 (7%)

Query: 234 SWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIVMAR 293
           SW+  +YL++    Q +  ++S  +     L +   + F +GS I  + + SF W+V  R
Sbjct: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFC-NITFFVGSLICGL-SPSFEWLVAGR 216

Query: 294 FILGLASGSLIYVMLTIINKCILNKRFSRPSMKIFTIPIVGGLSLAYATAIFIT----SW 349
           FI     G  I  M +I    I+  R       I       G +L      + +     W
Sbjct: 217 FI-AGIGGGGITSMSSITTSDIVPLRNRALYQGICNFYFGLGTALGGVVGGWFSDRSVGW 275

Query: 350 QNVYFLLAIFSFFTLFLIMFYF-----PSNESYKTNNTNLSSIVATLD-IDLIGCTILSV 403
           +  + +    +FF+  LI+ +            + +    S+I   L  +D IG T L +
Sbjct: 276 RMSFLIQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVL 335

Query: 404 FLLLIAVITTGNSNGFSITSPYSATXXXXXXXXXXXXXXXETTTNKNPIIPLDFIENKVI 463
           FL    +  +        TS                    E    K+PI+PL F++++ +
Sbjct: 336 FLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSV 395

Query: 464 FFKSLTVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPMFLTILFIIITVSRRIST 523
              SL+ +F  M+L+T  +Y P Y    LN+   DI KR  P F +  F  +     +  
Sbjct: 396 LGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKK 455

Query: 524 QNTLSYGLVTFFGIMGLIGQCILLNYVYNDTADYKLWKQCMIGILPILGSTFLVIATLMD 583
                Y  V  F ++  IG C+ + ++  D +   ++KQ  +  +P LG++ L+   L+ 
Sbjct: 456 TGKY-YWFVISFCVLASIG-CLQIVWIQPDIS---VFKQYTLMFIPGLGASVLITVALLA 510

Query: 584 V---TDDKKLPIISTSSFAVSTLGSILGICISGFIFNQGLYDELWV---------HSTEE 631
           +          + ++ S+A  + G  LG+ I G IF + L + L           HS +E
Sbjct: 511 MIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDE 570

Query: 632 KGLGKIIRKMINNX--XXXXXXXXXXXXILESYFIVSGYVFLFSAICLLVAVISFCFTIK 689
             L +II K   +               +++ Y      VF+F  +C + A  S    IK
Sbjct: 571 --LMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAI-IK 627

Query: 690 NKRHH 694
             R H
Sbjct: 628 EHRLH 632

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 6/71 (8%)

Query: 1  MGRKDKQRKRLRDFAKLKEKQRQLHLDQFIATSDNLKNKLIATSQNSVPQTIDEQPTGNI 60
          MG+KDKQRK+LR+F K K KQ Q   +  +                S  QT+ E      
Sbjct: 1  MGKKDKQRKKLRNFTKAKVKQVQEDQEPMVPDPPEFDG------TESFVQTLAETSQLTK 54

Query: 61 EDNDSTELTPL 71
          ED++++ L P+
Sbjct: 55 EDDENSVLLPI 65

>YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protein
           of unknown function with proposed role as a basic amino
           acid permease based on phylogeny; GFP-fusion protein
           localizes to vacuolar membrane; physical interaction
           with Atg27p suggests a possible role in autophagy;
           non-essential gene
          Length = 768

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 154/701 (21%), Positives = 274/701 (39%), Gaps = 104/701 (14%)

Query: 1   MGRKDKQRKRLRDFAKLKEKQRQLHLD-QFIATSDNLKNKLIATSQN------------- 46
           MG+KD+QRK+LR+FAKLK +QR L    Q +      + K+  TS               
Sbjct: 1   MGKKDRQRKKLREFAKLKNRQRNLRKSVQTLKNEVQREAKVPRTSNQIALGNDKIEEINE 60

Query: 47  --------------SVPQ-----TIDEQP---TGNIEDNDSTELTPLLLK---KQSENHI 81
                         S+P+     TID QP      I+D+   E+  +  K   K +E+ +
Sbjct: 61  NSPLLSAPSKQEEVSIPKAVDIDTIDAQPLHEGPKIDDSPQDEVNSIKGKPADKANEDDL 120

Query: 82  ---AVAESSGIDALKSD----------------TVEEPIEEEVTSLAHQKQKNISDDNQL 122
              +  E+ G  AL+S                 +   P+ E    ++       +DD  +
Sbjct: 121 KPPSQHEACGNSALQSSITDFSDRSVSPLQSITSCNTPMSEHELPVSSSNSFERADDMPV 180

Query: 123 XXXXXXXXXXXXXXXXXXXTNEAPIVPHKKIHSPSYGSIEQRLSHEEPAFTEEVVDLETN 182
                              + E P V   +I S  YGSI Q +   E       V+  ++
Sbjct: 181 VQADNQTSSSKSLHIVAP-SPEVP-VSGDEITSYGYGSIPQSIGDVENGLNPPYVENTSS 238

Query: 183 NRDISLLNEPQLTAGMXXXXXXXXXXXXXXXXXAMMLSTTSGSHVKQSSNSSWIIASYLI 242
           +  +  L   ++ +                    +++++   S   +    S +I++YL+
Sbjct: 239 DELVHDLTRRRIFSSCMCTYLFFIAMDSSII---LVIASKIASEFHELWRLSLVISAYLL 295

Query: 243 TMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIVMARFILGLASGS 302
           +  I QL+  ++S    + K L  I    F++G   L+  +  FW  + AR + G   GS
Sbjct: 296 SNAIGQLVFLKLS-LISSVKLLLCIAQFSFILGG-YLSWSSAHFWTFIFARCVTGFGGGS 353

Query: 303 LIYVMLTIINKCILNKRFSRPSMKIFTIPIVGGLSLA-YATAIFITS----WQNVYFLLA 357
           LI +  TI+N+    K  SR S+    I    G+ +  +   +F +S    W+N + +  
Sbjct: 354 LIALKSTIMNR-FSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPV 412

Query: 358 IFSFF--TLFLIMFYFPSNESYKTNNTNLSSIVAT--LDIDLIGCTILSVFLLLIAVITT 413
            F     ++ L   Y   +  Y      L        L  DL     L++FLL    +T+
Sbjct: 413 PFCLVNASIMLADMYSVKSTLYGRPTPTLWKRFKNTLLSPDLYEILTLTLFLLCFVQVTS 472

Query: 414 GNSNGFSITSPYSATXXXXXXXXXXXXXXXETT-TNKNPIIPLDFIENKVIFFKSLTVFF 472
            +  G    +   A                ET+ T  N +I +    +K + +  + + F
Sbjct: 473 LDLTGLKNNTMIQALLFSVIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTMIGISF 532

Query: 473 ASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPMFLTILFIIITVSR--RISTQNTL--- 527
              +L+  I +   Y    LN+S   + +R SP F +I+    +VS   +   QN L   
Sbjct: 533 CFAALMCIIPFGTTYFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLKF 592

Query: 528 ---SYGLVTFFGIMGLIGQCILLNYVYNDTADYKLWKQCMIGILPILGSTFLVIATLM-- 582
                 L+ +  +MG+             + +  +WKQ +   LP LGS+  +I TL+  
Sbjct: 593 VLSGATLLLYVALMGV-------------SLNLPVWKQYICLSLPFLGSS--MILTLLSN 637

Query: 583 ---DVTDDKKLPIISTSSFAVSTLGSILGICISGFIFNQGL 620
              +  + +K PI  +  +    +G  +GI + G++F++ L
Sbjct: 638 LYHEYHEQRKSPISGSIVYCFGAVGGTVGISLGGYVFHKTL 678

>Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}
           YBR293W - Hypothetical ORF [contig 294] FULL
          Length = 590

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 115/510 (22%), Positives = 194/510 (38%), Gaps = 87/510 (17%)

Query: 224 GSHVKQSSNSSWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTI-K 282
           GS +    N S +  SY+ +  I Q L  + S  +   K L     +LF  G     + K
Sbjct: 109 GSELNDMPNVSLVATSYVFSCAIFQPLFGKTSDVFGR-KPLLISSNLLFFAGCLTCGLSK 167

Query: 283 TVSFWWIVMARFILGLASGSLIYVMLTIINKCI--LNKRFSRPSMKIFTI------PIVG 334
           T+  WW+++ R + G+  G L  +   IIN  +   N+   +    +F         +VG
Sbjct: 168 TI--WWLILGRLVTGIGGGGLTSMCTIIINDIVPLRNRAVYQGFGNLFYALGTACGGLVG 225

Query: 335 GLSLAYATAIFITSWQNVYFLLAIFSFFTLFLIMFYFPSNESYKTNNTNLSSIVATLD-I 393
           GL   Y        W+  + +   F F +   I+ Y   + S    +   SS+   L  I
Sbjct: 226 GLFSEYGNG-----WRMAFMIQLPFCFLSTISIIVYL--DLSDDKQDLGRSSLYCKLRLI 278

Query: 394 DLIGCTI-----------------------LSVFLLLIAVITTGNSNGFSITSPYSATXX 430
           D +G                          L  FLL +AV  +G +  +           
Sbjct: 279 DWLGALTLVTFLLLFLVTMTIGGQHVPYGSLRFFLLCVAVCASGLALAY----------- 327

Query: 431 XXXXXXXXXXXXXETTTNKNPIIPLDFIENKVIFFKSLTVFFASMSLITFIHYFPFYLEK 490
                        E     +PI+P+ F+ NK +   SL  +F  M ++T  +Y P Y   
Sbjct: 328 ------------VEIFLANDPILPISFLRNKNVLGSSLANWFCMMGMMTITYYLPIYWSS 375

Query: 491 TLNISLFDIYKRTSPMFLTILFIIITVSRRISTQNTLSYGLVTFFGIMGLIGQCILLNYV 550
             N     + K++ P F ++       +  +  +N   Y L+    ++ + GQ   L  V
Sbjct: 376 VSNQGPIQVGKKSIPSFFSMALGSFGTAYYVQ-KNGTYYRLLMTSCLIIIFGQ---LQIV 431

Query: 551 YNDTADYKLWKQCMIGILPILGSTFLVIATLMDV---TDDKKLPIISTSSFAVSTLGSIL 607
           Y  T +   W+Q ++  +P  G + L+  TL+ +      K     ++ S+A  T G I+
Sbjct: 432 Y-ITPEMPQWRQYILLAVPGFGVSILITVTLLAMIAAVPHKHQAATTSLSYAFRTTGCII 490

Query: 608 GICISGFIFNQGLYDELWV---------HSTEEKGLGKIIRKMI--NNXXXXXXXXXXXX 656
           G  ++G IF   L   +           HS +E  L  +I K +  ++            
Sbjct: 491 GASLAGAIFQNTLKKNVTTAVMKFLGDEHSKKE--LNLVIEKALRSSDWVNNGSPEFVHE 548

Query: 657 XILESYFIVSGYVFLFSAICLLVAVISFCF 686
            +L+ Y    G  F F  +C L+ VIS  F
Sbjct: 549 ALLKCYENACGQTFRFCLLCFLLTVISCSF 578

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/265 (23%), Positives = 118/265 (44%), Gaps = 22/265 (8%)

Query: 444 ETTTNKNPIIPLDFIENKVIFFKSLTVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRT 503
           ET  +K+PI+P+ F++N+ I   SL  +F+ M ++T  ++ P Y    LN+   D+ KRT
Sbjct: 382 ETYVSKDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRT 441

Query: 504 SPMFLTILFIIITVSRRISTQNTLSYGLVTFFGIMGLIGQCILLNYVYNDTADYKLWKQC 563
            P F +     +     +       + L+  F  + ++GQ + ++ +  + A   +W+Q 
Sbjct: 442 IPSFFSTALGSLGAGYYMKKTGKYKW-LLMAFCALAVVGQ-LQISLIEPNIA---VWRQY 496

Query: 564 MIGILPILGSTFLVIATLMDV---TDDKKLPIISTSSFAVSTLGSILGICISGFIFNQGL 620
           ++ ++P  G + L+  TL+ +      +     ++ S+A  + G  LG+ I G IF + L
Sbjct: 497 ILLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSL 556

Query: 621 YDELWV---------HSTEEKGLGKIIRKMIN--NXXXXXXXXXXXXXILESYFIVSGYV 669
              L           H  EE  L KII    +  +             ++ESY       
Sbjct: 557 GSLLERNVMKLASDKHPREE--LAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNT 614

Query: 670 FLFSAICLLVAVISFCFTIKNKRHH 694
           + F    +  A++S C  +K  + H
Sbjct: 615 YKFCLASIFCALLS-CIAVKEYKLH 638

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 58/121 (47%), Gaps = 11/121 (9%)

Query: 4   KDKQRKRLRDFAKLKEKQRQLHLDQ-FIATSDNLKNKLIATSQNSVPQTIDEQ----PTG 58
           K+KQRK+L+ F KLKE+QRQL  D+  +    N  + +  T      Q I  +    PT 
Sbjct: 8   KNKQRKKLQAFVKLKERQRQLLNDEPKVVIQQNPAHSIEPTETTPFLQPIRRELVLDPTS 67

Query: 59  NIEDNDSTELTPLLLKKQSENHIAVAESSGIDALKSDTV--EEPIEEEVTSLAHQKQKNI 116
           ++    + EL     +   E       +SG D++K +TV   + I+ E +S+  +    +
Sbjct: 68  DLPGFVAGELEEQEERCAEEQ----TNASGYDSIKKNTVATAKTIDLETSSIEAKNNTGL 123

Query: 117 S 117
           S
Sbjct: 124 S 124

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 2/70 (2%)

Query: 234 SWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIVMAR 293
           SWI  +YL++    Q L  ++S  +   K L     ++F +G  I  + +   W +V  R
Sbjct: 167 SWIATAYLLSSATFQPLYGKISDIFGR-KPLLIFSNVMFALGCLICGL-SPGLWCLVAGR 224

Query: 294 FILGLASGSL 303
           FI G+  G L
Sbjct: 225 FIAGIGGGGL 234

>Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W
           (REAL)
          Length = 765

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 107/480 (22%), Positives = 203/480 (42%), Gaps = 39/480 (8%)

Query: 234 SWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIVMAR 293
           S +I+ YL+   I QL+  ++S      K L  +    F++GS  L+  ++ FW  ++AR
Sbjct: 293 SLVISVYLLGNAIGQLMFLKLS-LVSGVKLLLCVAQFSFILGS-YLSWSSIHFWTFILAR 350

Query: 294 FILGLASGSLIYVMLTIINKCILNKRFSRP---SMKIFTIPI-VGGLSLAYATAIFITSW 349
            + G  SGSLI +  TI+N+         P   SM +F++ + VG   +++  +   + W
Sbjct: 351 SVTGFGSGSLIALKSTIMNRFSQKNENQYPLSTSMTVFSLGVAVGPFLVSFFDSSHGSGW 410

Query: 350 QNVYFLLAIFSFF--TLFLIMFYFPSNE-SYKTNNTNLSSIVATL--DIDLIGCTILSVF 404
           +N + +   F     ++ L   Y   N   ++   T L      +    DL     L++F
Sbjct: 411 KNAFLIPVPFCLVNASIMLADIYSVKNTIHHEGPTTTLQKRFKKVLWSPDLYEILTLALF 470

Query: 405 LLLIAVITTGNSNGFSITSPYSATXXXXXXXXXXXXXXXETTTNK-NPIIPLDFIENKVI 463
           LL     T+ +S     ++                    E +  + N +  L    +K +
Sbjct: 471 LLCFVQATSLDSTRLEHSTMIQEIIFSVIIICGVLFFVIEKSDVRMNSVFSLSLQGDKHL 530

Query: 464 FFKSLTVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPMFLTILFIIITV-----S 518
            +  + +FF   +L+  I +   Y    LN+   +I +R  P F +I+    +V     S
Sbjct: 531 IWTMMGIFFCFAALMCIIPFGTTYFMIVLNLDTLEIAERLLPFFFSIVVGYFSVCYFWNS 590

Query: 519 RRISTQNTLSYGLVTFFGIMGLIGQCILLNYVYNDTADYKLWKQCMIGILPILGSTFL-- 576
            R +         VT    + L+G  + L+          +WKQ     LP+LGS+ +  
Sbjct: 591 ERQNYLFKFVLSGVTLLLYVALMGMNLSLS----------VWKQYTCLSLPLLGSSMILT 640

Query: 577 VIATLM-DVTDDKKLPIISTSSFAVSTLGSILGICISGFIFNQGLY----DELWVHSTE- 630
           +++TL  +    +K PI  + ++  + +G  +G+  +G++F++ L     +E+   S + 
Sbjct: 641 LLSTLYHEYHVQRKSPISGSIAYCFAAMGGTIGVSSAGYVFHKTLVRTMNEEVMKFSKQG 700

Query: 631 --EKGLGKIIRKMI--NNXXXXXXXXXXXXXILESYFIVSGYVFLFSAICLLVAVISFCF 686
             +K L KII+     +N             ++E Y      VF  SA+   + V++  F
Sbjct: 701 YLKKDLFKIIKHATQSSNWVHKSAPKFIFRTLIECYLQACRNVFKLSALFFTITVVTLFF 760

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 6/119 (5%)

Query: 1   MGRKDKQRKRLRDFAKLKEKQRQLHLDQFIATSDNLKNKLIATSQNSVPQ-TIDEQPTGN 59
           MG+KD+QRK+LR+FAKLK +QR L  +        ++ K + +    + Q   D+    N
Sbjct: 1   MGKKDRQRKKLREFAKLKNRQRNLK-ESVQNLKKEVQQKAVCSEHLDLVQLENDKSEEIN 59

Query: 60  IEDNDSTELTPLLLKKQSENHIAVAESSGIDALKSDTVEEPIEEEVTSLAHQKQKNISD 118
            E  +  E  PLL     +    V++   +D + +     P+       +HQ + + ++
Sbjct: 60  DESEEINENVPLLSTHGGQKEEKVSKVPDVDTINT----HPLHSSKNDDSHQTEADCAE 114

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 95/419 (22%), Positives = 168/419 (40%), Gaps = 30/419 (7%)

Query: 224 GSHVKQSSNSSWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKT 283
            S   + S+ SWI  +YL++    Q L  ++S  +   + L  I  + F++G  I  +  
Sbjct: 89  ASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGR-RPLIIISNLFFILGCLICGLSK 147

Query: 284 VSFWWIVMARFILGLASGSLIYVMLTIINKCILNKRFSRPSMKIFTIPIVGGLSLAYATA 343
            + W +V  RFI G+  G  +  + +I    I+  R       IF      G+++     
Sbjct: 148 -NLWTLVAGRFIAGIGGGG-VTSLGSITASDIVPLRSRALYQGIFNFFFGLGIAIGGLIG 205

Query: 344 IFIT----SWQNVYFLLAIFSFFTLFLIMFYF---PSNESYKTNNTNLSSIVATLD---- 392
            + +     W+  + +       +L LI+ +    P  +     + +    V   D    
Sbjct: 206 GWFSESKNGWRMAFLVQVPLCAISLVLIIIFLKLPPGCKGLGLVSNDKDGKVDIKDKLKR 265

Query: 393 IDLIGCTILSVFLLLIAVITTGNSNGFSITSPYSAT----XXXXXXXXXXXXXXXETTTN 448
           ID +G   LS+   L A +   +  G  I  PY++                    E   +
Sbjct: 266 IDWLGS--LSLVTFLFAFMLASSLGGKEI--PYNSNIFKLLVVATILSGTAFIYVELYIS 321

Query: 449 KNPIIPLDFIENKVIFFKSLTVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPMFL 508
            +PI+P+ F+ N+ I   S   +F  MS +T   Y P Y     N+   D+ KR +P F 
Sbjct: 322 DDPILPIRFLTNRSILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFF 381

Query: 509 TILFIIITVSRRISTQNTLSYGLVTFFGIMGLIGQCILLNYVYNDTADYKLWKQCMIGIL 568
           +  F  I     +         L+ F G+M ++GQ  +L        D   W+Q ++  L
Sbjct: 382 STAFGSIGAGYYMKKTGRYYGFLLKFTGLM-VLGQLQVLLM----KPDISTWRQYILLPL 436

Query: 569 PILGSTFLVIATLMDV---TDDKKLPIISTSSFAVSTLGSILGICISGFIFNQGLYDEL 624
           P  GS+ L+  TL+ +      +     ++ S+A  + GS LG+ +   +F   L   L
Sbjct: 437 PHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSL 495

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 100/441 (22%), Positives = 174/441 (39%), Gaps = 44/441 (9%)

Query: 224 GSHVKQSSNSSWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKT 283
           GS   Q     W+  SYL++  + Q L  ++S  +   K L     ++F  G  I  +  
Sbjct: 425 GSEFNQIPKVPWVATSYLLSSAVFQPLYGKLSDIFGR-KALLIFSNLIFFFGCIICGMSN 483

Query: 284 VSFWWIVMARFILGLASGSLIYVM-LTIINKCILNKRFSRPSMKIFTIPIVGGLSLAYAT 342
            S   +V  RF+ G+  G +  +  +T+ +   L  R     +  F      GL  A+  
Sbjct: 484 -SLNMLVWGRFVAGIGGGGITSMTTITVSDIVPLRSRAVYQGICNFFF----GLGTAFGG 538

Query: 343 ---AIFIT---SWQNVYFLLAIFSFFTLFLIMFYF--PSNESYKTNNTNLSSIVATLDID 394
               IF+     W+ V++     S  +  LI  +   P  ++Y+     +S     + +D
Sbjct: 539 VIGGIFVDHQYGWRMVFWSQVPVSGLSTLLICSFLVVPRIKNYE-----VSLGRKLMRVD 593

Query: 395 LIGCTILSVFL---LLIAVITTGNSNGFSITSPYSATXXXXXXXXXXXXXXXETTTNKNP 451
            +G   + ++L   LLI  +  G S    I S                    E     +P
Sbjct: 594 WLGSISMILWLTSFLLITTMMGGIS--LDIDSDQFHYLIMFSSVSAIIFVLTELFVASDP 651

Query: 452 IIPLDFIENKVIFFKSLTVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPMFLTIL 511
           ++PL F+ N+ +   SL  FF  M  +T   Y P Y    L+IS   I KR +P FL   
Sbjct: 652 VLPLRFLSNRSVLGASLGNFFCVMGFMTICFYLPIYFASVLDISPTGIGKRMAPNFLCTA 711

Query: 512 FIIITVSRRISTQNTLSYGLVTFFGIMGLIGQ--CILLNYVYNDTADYKLWKQCMIGILP 569
              +     +  Q    Y  V  F ++  +G     L+    + T  Y      ++ +LP
Sbjct: 712 LGSLGAGVYMK-QTGKYYWFVVLFALVSTLGHYYLTLIPLTVSITVQY------LLVVLP 764

Query: 570 ILGSTFLVIATLMDV---TDDKKLPIISTSSFAVSTLGSILGICISGFIFNQGLYDELWV 626
            +GS+ +++  L+ +      K     ++ S+A  + G  LG+ +   +F++ L   L  
Sbjct: 765 GVGSSIIIVVALLAMIAAVPHKHQAATTSISYAFRSTGGTLGVALGSSVFHRTLIKRLHT 824

Query: 627 HSTE-------EKGLGKIIRK 640
              E        K L +II+K
Sbjct: 825 DVLEYVSPEHPRKELLRIIKK 845

>Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W
           (REAL)
          Length = 759

 Score = 58.2 bits (139), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 63/130 (48%), Gaps = 19/130 (14%)

Query: 1   MGRKDKQRKRLRDFAKLKEKQRQLHLDQFIATSDNLKNKL---IATSQNSVPQTIDEQPT 57
           MG+KD+QRK+LR+FAKLK +Q++L       +  NLKN++   +  S+N  P  I+    
Sbjct: 1   MGKKDRQRKKLREFAKLKNRQQKLQ-----NSVQNLKNEVQREVGESENPNPIAIE---- 51

Query: 58  GNIEDNDSTELTPLLLKKQSENHIAVAESSGIDALKSDTVEE------PIEEEVTSLAHQ 111
            N +  ++ E TPLLL          ++   ID   +   +E      P++ E   +  +
Sbjct: 52  -NDKSEENKENTPLLLTSSERREDDGSKPLDIDTFDTRPFQERSKSGNPVQAEGDDMEGK 110

Query: 112 KQKNISDDNQ 121
            +     D+ 
Sbjct: 111 SEDKADQDHH 120

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 67/131 (51%), Gaps = 8/131 (6%)

Query: 234 SWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIVMAR 293
           S I++ YL++  I QLL  ++S    + K L  +    F++GS  L+  +  FW  + AR
Sbjct: 287 SLIVSVYLLSNAIGQLLFLKLS-IISSVKLLLCMAQFSFILGS-YLSWSSSHFWTFIFAR 344

Query: 294 FILGLASGSLIYVMLTIINKCILNKRFSRPSMKIFTIPIVGGLSLA-YATAIFITS---- 348
           F+ G  SGSLI +  TI+N+    K  SR S+    I    G+++  +   +F +S    
Sbjct: 345 FVAGFGSGSLIALKSTIMNR-FSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSG 403

Query: 349 WQNVYFLLAIF 359
           W+N + +   F
Sbjct: 404 WKNAFLIPVPF 414

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 99/430 (23%), Positives = 167/430 (38%), Gaps = 26/430 (6%)

Query: 222 TSGSHVKQSSNSSWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTI 281
           T  S +  S+  SWI  SYL++    Q L  ++S  +   K L     + F  G  +   
Sbjct: 58  TIASELDASNQMSWIATSYLLSCSAFQPLYGKLSDVFGR-KPLLIWSNLCFGFGCILCGA 116

Query: 282 K-TVSFWWIVMARFILGLASGSLIYVMLTIINKCI-LNKRFSRPSMK--IFTIPIVGGLS 337
             T S W + + RFI G+  G L  +     +  I L +R     M   +F +    G S
Sbjct: 117 PFTKSLWMLCIGRFIAGVGGGGLNSLSTITTSDIIPLRQRGVYQGMGNIVFALGCASG-S 175

Query: 338 LAYATAIFITSWQNVYFLLAIFSFFTLFLIMFYF------PSNESYKTNNTNLSSIVATL 391
           L  A       W+  +      S  +  LIM +       P       +N  +++     
Sbjct: 176 LIGAFLQQRIGWRWAFLCQVPLSLLSCSLIMKFLNLPAGSPGRGLINLSNKKITTADVRE 235

Query: 392 DIDLIGCTILSVFLLLIAVITTGNSNGFSITSPYSATXXXXXXXXXXXXXXXETTTNKNP 451
            +D  G   L   +LL+ +I +   N   +T    A                E + + NP
Sbjct: 236 HVDFTGSFTLITTMLLLMIILSVLDNPSHLTYGTWALFIVGLALAGYTFVSTELSVH-NP 294

Query: 452 IIPLDFI-ENKVIFFKSLTVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPMFLTI 510
           ++P+  +  N+ +   SLT +F +MS     +Y P + +   ++  ++I  RT   F  I
Sbjct: 295 MVPIRLLGSNRTVLASSLTNWFFTMSTFVLAYYVPVFWQTVYHLKPWNIGVRTVSNFFGI 354

Query: 511 LFIIITVS---RRISTQNTLSYGLVTFFGIMGLIGQCILLNYVYNDTADYKLWKQCMIGI 567
               +      +R      LS  L T    + + G  I+    YN T    L +  M+  
Sbjct: 355 AIGSMMTGLYMKRTGKYKALSNTLNT----VTVAGTLIVYLSTYN-TEPKGLLEYFML-F 408

Query: 568 LPILGSTFLVIATLMDV---TDDKKLPIISTSSFAVSTLGSILGICISGFIFNQGLYDEL 624
           LP LG   ++  TL+ +    D      +++  +A   +GS LG+  +G I+   L   L
Sbjct: 409 LPGLGYASMLTITLLSLIASVDTSHQAQVTSIQYAFRAIGSTLGVSFAGLIYQSKLQTSL 468

Query: 625 WVHSTEEKGL 634
             +  E K L
Sbjct: 469 LRNIVENKTL 478

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 105/480 (21%), Positives = 190/480 (39%), Gaps = 32/480 (6%)

Query: 234 SWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSIL-TIKTVSFWWIVMA 292
           SWI ASYL++  I Q L  ++S  +   K +     ++F +G  +  T  TV  WW++  
Sbjct: 190 SWIAASYLLSACIFQPLYGKLSDIFGR-KAILLFSNLMFGLGCLVCGTAPTV--WWLLAG 246

Query: 293 RFILGLASGSLIYVMLTIINKCILNKRFSRPSMKIFTIPIVGGLSLAYATAIFIT---SW 349
           RF+ G+  G L   M +II   I+  R       +F I  V G++L  +   ++     W
Sbjct: 247 RFVAGIGGGGLT-SMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGW 305

Query: 350 QNVYFLLAIFSFFTLFLIMFYFPSNESYKTNNTNLSSIVATLDIDLIGCTILSVFLLLIA 409
           + V+ L  + +  +   I  +    + +  N   L++   +L   L     L  F L+I 
Sbjct: 306 RLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALAN-KESLKTKLYMMDWLGTFCLVIF 364

Query: 410 VIT-TGNSNGFSITSPYSATXXXXXXXXXXXXXXXETTTNKNPIIPLDFIENKVIFFKSL 468
           + + T   +   +   +                  E     +PI+ +  + ++ +   SL
Sbjct: 365 LASLTLTCSLVDLNFNFLLLLILLMFVSGYYFVYHELNIAADPILSVHLLTDRNVLASSL 424

Query: 469 TVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPMFLTILFIIITVSRRISTQNTLS 528
             FF  ++ +  I Y P Y    L +   +I KRT   FL            I  +    
Sbjct: 425 ANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSFGTGYYIKRRGKYR 484

Query: 529 YGLVTFFGIMGLIGQCILLNYVYNDTADYKLWKQCMIGILPILGSTFL---VIATLMDVT 585
              +    I+G++GQ      +         W+Q ++ ++PIL +T +   ++ +L+   
Sbjct: 485 T-FICLACIIGILGQL----QIALIKPSISTWRQYLLLLIPILYTTTVRTSLLISLIAAV 539

Query: 586 DDKKLPIISTSSFAVSTLGSILGICISGFIFNQGLYD---------ELWVHSTEEKGLGK 636
             K     ++ S+   + G+ILG  + G IF   L           E  +H   +  L  
Sbjct: 540 PYKNQTAAASISYTFRSTGAILGASLGGGIFRSSLKSLLNTNIMPLESEIHPKSQ--LLH 597

Query: 637 IIRKMIN--NXXXXXXXXXXXXXILESYFIVSGYVFLFSAICLLVAVISFCFTIKNKRHH 694
           II K  +  +             ++  Y  V   +F FS +C+L   IS C+ +K    H
Sbjct: 598 IIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLFTSIS-CYFLKEYPVH 656

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 34/79 (43%), Gaps = 16/79 (20%)

Query: 1  MGRKD-----KQRKRLRDFAKLKEKQRQLHLDQFIATSDNLKNKLIATSQNSVPQTIDEQ 55
          MGRK      K+R RL++FAKLK +QR L  D+  A    L +K           TI   
Sbjct: 1  MGRKRSGIKTKERNRLKEFAKLKGRQRTLKSDE--AGETYLGDK---------SNTISFG 49

Query: 56 PTGNIEDNDSTELTPLLLK 74
          P     D    E  P L +
Sbjct: 50 PYSRSSDESQGETIPFLTR 68

>NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa]
          {ON} Anc_8.272 YDR119W
          Length = 589

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 17/80 (21%)

Query: 1  MGRKDKQRKRLRDFAKLKEKQRQLHLDQFIATSDNLKNKLIATSQNSVPQTIDEQPTGNI 60
          MGRKDKQRK+LR+FAKLKEKQR             L+NK+   + N   +   E  T  +
Sbjct: 1  MGRKDKQRKKLREFAKLKEKQRL------------LENKIHHATPNGTQKPTSELNT--V 46

Query: 61 EDNDSTELTPLLLKKQSENH 80
          +  +  E TPLL   ++ NH
Sbjct: 47 QQLEPEESTPLL---KTSNH 63

 Score = 39.7 bits (91), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 79/179 (44%), Gaps = 28/179 (15%)

Query: 454 PLDFIENK---VIFFKSL----TVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPM 506
           PLD I NK    I  K+L       F+ ++LI  + Y P Y     N S   +  R  P+
Sbjct: 349 PLDDITNKDEISISRKNLLDLLPNMFSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPI 408

Query: 507 FLTILFIIITVSRRISTQNTLSYGLVTFFGIMGLIGQCILLNYVYNDTADYKLWKQCMIG 566
           +L++  +++  +R     NT   G      ++GLIG   L + +   T D   W   + G
Sbjct: 409 YLSMFAVVLIQARYAKKYNTSLLG-----SLVGLIGYYQLYS-LDKSTPD---WFHFVAG 459

Query: 567 ILPILGSTFLVIATLMDVTDDKKLPIISTSSFAVSTL-GSILGICISGFIFNQGLYDEL 624
            +P++G T +++A   ++ D           FAV  L G    I +   +F + L+D L
Sbjct: 460 CIPLIGVTSVIMANTKNMRD-----------FAVGILVGGSATIILCQGLFTRTLHDTL 507

>Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W
           (REAL)
          Length = 775

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 65/119 (54%), Gaps = 13/119 (10%)

Query: 1   MGRKDKQRKRLRDFAKLKEKQRQLHLDQFIATSDNLKNKLIATSQNSVPQTIDEQPTGNI 60
           MG+KD+QRK+LR+FAKLK +Q+ L       +  +LK ++    ++  P+ ++    GN+
Sbjct: 1   MGKKDRQRKKLREFAKLKNRQQNLR-----KSVQSLKKEV--QRKSVAPENLNRIVFGNL 53

Query: 61  EDNDSTELTPLLLKKQSENHIAVAESSGIDALKSDTVEEPIEEEVTSLAHQKQKNISDD 119
           +  +++E +PLL         +  ++  I+A  + ++ E + E  TS+  +     SDD
Sbjct: 54  KREEASENSPLLPAPSEPREGSGPKTLNINANDTRSLPE-LPENSTSVETE-----SDD 106

 Score = 38.9 bits (89), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 71/340 (20%), Positives = 135/340 (39%), Gaps = 26/340 (7%)

Query: 33  SDNLKNKLIATSQNSVPQTI-DEQPTGNIEDNDSTELTPLLLKKQSENHIAVAESSGIDA 91
           SD+++ KL   +    P+ +  E+P   +   +  + +P    + S +  +    S + +
Sbjct: 104 SDDIEGKLAENANEEPPKFLSQEEPPKFLSREEPGKKSP---SQNSVSDFSDRSVSPLQS 160

Query: 92  LKSDTVEEPIEEEVTSLAHQKQKNISDD---NQLXXXXXXXXXXXXXXXXXXXTNEAP-- 146
           + SD     + E   SLA+  + N   D    QL                      AP  
Sbjct: 161 ITSDNTPMSVHEVPESLANALEGN--GDIVVAQLDSCVPAINALPTSDLSPTSATSAPEV 218

Query: 147 IVPHKKIHSPSYGSIEQRLSHEEPAFTEEVVDLETNNRDISLLNEPQLTAGMXXXXXXXX 206
           +V   ++ +  YGSI + +   E   T     + ++++ +  L   ++ +          
Sbjct: 219 LVDRPQMRAYEYGSISRTVKDVENGTTSSYARVASSDKFVHDLTRRRIFSSCMCTYLFFI 278

Query: 207 XXXXXXXXXAMMLSTTSGSHVKQSSNSSWIIASYLITMYISQLLTAQVSGKYKNYKTLSY 266
                     M + +   S   +    S II+ YL++  I QL+  ++S    + K L  
Sbjct: 279 AMDSTIL---MSIVSKIASEFHELWRLSLIISIYLLSNAIGQLVFLKLS-IVTSVKLLLC 334

Query: 267 IGTMLFLIGSSILTIKTVSFWWIVMARFILGLASGSLIYVMLTIINKCILNKRFS---RP 323
           +    F++GS  L+     FW  V AR I G  SG+L+ +  TI+N+    K+       
Sbjct: 335 VAQFSFILGS-YLSWSAFHFWTFVFARSITGFGSGALMALKSTIMNRFSDKKKNGYSLSA 393

Query: 324 SMKIFTIPIVGGLSLAYATAIFITS----WQNVYFLLAIF 359
           S+ +F++ +  G  L Y   +F  S    W+N + +   F
Sbjct: 394 SVIVFSLGVAIGPFLVY---LFDNSRGSGWKNAFLIPVPF 430

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 97/425 (22%), Positives = 176/425 (41%), Gaps = 31/425 (7%)

Query: 222 TSGSHVKQSSNSSWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSIL-T 280
           T  S +  SS  SWI  SYL++    Q L  ++S  +   K L     ++F IG ++  +
Sbjct: 67  TIASDLDASSQMSWIATSYLLSCSAFQPLYGKLSDIFGR-KILLVWSNLVFAIGCALCGS 125

Query: 281 IKTVSFWWIVMARFILGLASGSLIYVMLTIINKCI-LNKRFSRPSMK--IFTIPIVGGLS 337
             T + W +   RFI G+  G L  +     +  I L KR     +    F++    G  
Sbjct: 126 PWTTNIWILSAGRFIAGIGGGGLTTLSTITTSDIIPLRKRGVYQGLGNICFSLGCASGSV 185

Query: 338 LAYATAIFITSWQNVYFLLAIFSFFTLFLIMFYF--PSN---------ESYKTNNTNLSS 386
           L       I  W+  + +    +  +  LI+F    PS+         E  + N    S 
Sbjct: 186 LGAVLQQGI-GWRWAFLIQVPIALISGLLIVFVLELPSDSPGRGLIWLEHARGNTFQWSK 244

Query: 387 IVATLDIDLIGCTILSVFLLLIAVITTGNSNGFSITSPYSATXXXXXXXXXXXXXXXETT 446
           +  T  ID +G   L + +LL+ +  +  S+   ++                     E T
Sbjct: 245 V--TKMIDFVGSITLVMSMLLLMITISFLSDPSQLSENSWVVLVLLVAGFCAKFVHTECT 302

Query: 447 TNKNPIIPLDFI-ENKVIFFKSLTVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRTSP 505
            + NP++PL  + EN+ +F  S T +F +MS    ++Y P + +     + +DI  R+  
Sbjct: 303 IH-NPMVPLRLLWENRTVFASSFTNWFMTMSTFAVMYYIPVFWQTVFKFTPYDIGFRSIS 361

Query: 506 MFLTILF--IIITVSRRISTQNTLSYGLVTFFGIMGLIGQCILLNYVYNDTADYKLWKQC 563
            F+ I    ++  V  +  T    ++ LVT   I+   G   L    + +T    L  + 
Sbjct: 362 NFVGIATGSMLAGVYMK-CTGKYWNFSLVT--NILYFTGILSLFACTFRNTPQGVL--EY 416

Query: 564 MIGILPILGSTFLVIATLMDV---TDDKKLPIISTSSFAVSTLGSILGICISGFIFNQGL 620
           ++  LP  G   ++  TL+ +    D +    +++  +A    GS LG+ ++G I+   L
Sbjct: 417 LLMFLPGFGYATMLTVTLLALIASVDFEHQAQVTSIQYAFRATGSTLGVSLAGLIYQASL 476

Query: 621 YDELW 625
             +L+
Sbjct: 477 QYKLY 481

>KAFR0B05450 Chr2 complement(1116514..1118391) [1878 bp, 625 aa]
          {ON} Anc_8.272 YDR119W
          Length = 625

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 19/22 (86%)

Query: 1  MGRKDKQRKRLRDFAKLKEKQR 22
          MG+KDKQRKRLR F +LKE QR
Sbjct: 1  MGKKDKQRKRLRKFVQLKEAQR 22

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 64/304 (21%), Positives = 122/304 (40%), Gaps = 19/304 (6%)

Query: 222 TSGSHVKQSSNSSWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSIL-T 280
           T  S +  SS  SWI  +YL++    Q L  ++S  +   K L  +  + F +G +I  +
Sbjct: 67  TIASDLDASSQMSWIATAYLLSCSAFQPLYGKLSDIFGR-KILLILSNLTFALGCAICGS 125

Query: 281 IKTVSFWWIVMARFILGLASGSLIYVMLTIINKCI-LNKRFSRPSMK--IFTIPIVGGLS 337
             T + W +   RF+ G+  G    +     +  I L KR     +    F++    G  
Sbjct: 126 PWTNNVWVLSTGRFVAGIGGGGQATLSTITTSDIIPLRKRGVYQGLVNICFSLGCASGSV 185

Query: 338 LAYATAIFITSWQNVYFLLAIFSFFTLFLI--MFYFPSNESYK-------TNNTNLSSIV 388
           L       I  W+  + +    +     +I  +   P++   +            L    
Sbjct: 186 LGAVLQQGI-GWRWAFLVQVPMALVCALMIAVVLDLPADSPGRGLLWLELKRGKRLKWCT 244

Query: 389 ATLDIDLIGC-TILSVFLLLIAVITTGNSNGFSITSPYSATXXXXXXXXXXXXXXXETTT 447
            T  +D +G  T+++  +LL+  I+   S+   +++                    E TT
Sbjct: 245 VTEMVDFVGSFTLIASMILLMTAISL-LSDPTQLSTSLWLLLGVLLTASSLQFAYTECTT 303

Query: 448 NKNPIIPLDFI-ENKVIFFKSLTVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPM 506
            +NP++PL  + EN+ +   S T +F +M+  T ++Y P +       + +DI  R+   
Sbjct: 304 -RNPMVPLRLLWENRTVCASSFTNWFMTMTTFTVMYYVPVFWHTVYKFTPWDIGVRSMSN 362

Query: 507 FLTI 510
           F+ I
Sbjct: 363 FVGI 366

>KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C
          Length = 632

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 86/189 (45%), Gaps = 29/189 (15%)

Query: 450 NPIIPLDFIENKVIFFKSLTVFFASMSLITFIHYFPF-YLEKTLNISL---FDIYKRTSP 505
           +PI+P   ++++ ++  SL + F    LI FI+Y    YL   L +++        R S 
Sbjct: 340 DPIVPYKLVKDRGVW-ASLGISF----LIDFIYYMAADYLYTVLIVAVNESVSAATRISS 394

Query: 506 MF-----LTILFIIITVSRRISTQNTLSYGLVTFFGIMGLIGQCILLNYVYNDTADYKLW 560
           ++     +   F+ + ++R    +  + +G   +F  MGL+       Y +   A     
Sbjct: 395 LYSFVSTVASPFVSLALTRFTRLKPFIIFGCCLWFLAMGLL-------YHFRGGASSH-- 445

Query: 561 KQCMIGILPI--LGSTFL---VIATLMDVTDDKKLPIISTSSFAVSTLGSILGICISGFI 615
              +IG L +  LGSTF    V  ++      +++  +S  ++    +GS +G  +SG I
Sbjct: 446 -SGIIGGLCVWGLGSTFFTYPVTVSVQAAVSHEQMATVSALNYTFYRIGSAVGAAVSGAI 504

Query: 616 FNQGLYDEL 624
           + Q LY +L
Sbjct: 505 WTQKLYKKL 513

>Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON}
           (36161..38023) [1863 nt, 621 aa]
          Length = 620

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 72/173 (41%), Gaps = 14/173 (8%)

Query: 231 SNSSWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIV 290
            N  +I A+  +   IS +  A +S      K    +  ++FLIG+ I+ +   +FW +V
Sbjct: 159 GNKEFITAATSLGALISSIF-AGISADIFGRKPCILLSNLMFLIGA-IIQVTAHTFWQMV 216

Query: 291 MARFILGLASGSLIYVMLTIINKCILNKRFSRPSMKIFTIPIVGGLSLAYATAIFITSWQ 350
           + RFI+G   G    +    I++ I  K        I ++ + GG  +AY     ++   
Sbjct: 217 VGRFIMGFGVGIGSLIAPLYISE-IAPKNIRGRLTVINSLWLTGGQLIAYGCGAGLSHVN 275

Query: 351 NVYFLLAIFSF------FTLFLIM-----FYFPSNESYKTNNTNLSSIVATLD 392
           N + +L   S       F+ FL +     FY    +  K N     S V T D
Sbjct: 276 NGWRILVGLSLIPTVIQFSCFLFLPDTPRFYVMKGQLEKANKVLHKSYVDTPD 328

>Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON}
           YHL040C (REAL)
          Length = 633

 Score = 34.7 bits (78), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 40/195 (20%), Positives = 88/195 (45%), Gaps = 29/195 (14%)

Query: 444 ETTTNKNPIIPLDFIENKVIFFKSLTVFFASMSLITFIHYFPF-YLEKTLNISLFDIYKR 502
           E    ++PIIP   ++++ ++  S+ + F    LI FI+Y    YL   + +++ +  K 
Sbjct: 346 EYRVARDPIIPYKLVKDRGVW-SSMGISF----LIDFIYYMAADYLYTVMLVAVNESIKS 400

Query: 503 TSPM-----FLTIL---FIIITVSRRISTQNTLSYGLVTFFGIMGLIGQCILLNYVYNDT 554
            + +     F++++   F  + ++R    +  + +G   +   MGL+       Y Y   
Sbjct: 401 ATRISTLSSFVSVVASPFFGLIMTRCTRLKPFIMFGCCLWMLAMGLL-------YRYRGG 453

Query: 555 ADYKLWKQCMIGILPILG-----STFLVIATLMDVTDDKKLPIISTSSFAVSTLGSILGI 609
            +       +IG L + G      T+ V  ++      + L  ++  ++ +  +GS +G 
Sbjct: 454 RESH---SGIIGALCVWGLGTTLFTYPVTVSVQSAVSHENLATVTALNYTLYRIGSAVGA 510

Query: 610 CISGFIFNQGLYDEL 624
            +SG I+ Q LY ++
Sbjct: 511 AVSGAIWTQTLYKQI 525

>TBLA0A07970 Chr1 (1971258..1972760) [1503 bp, 500 aa] {ON}
           Anc_5.469 YDR387C
          Length = 500

 Score = 34.7 bits (78), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 80/159 (50%), Gaps = 21/159 (13%)

Query: 245 YISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIVMARFILGLASGSLI 304
           +++ L+   ++  Y    TL+ + + +F+I S  + + T +  ++V+ RFI+GLA G+  
Sbjct: 106 FLASLIAFALADHYGRKFTLA-LCSCIFIIASLWMALST-TLTYLVIGRFIVGLAIGT-- 161

Query: 305 YVMLTIINKCI---LNKRFSRP-SMKIFTIPIVG---GLSLAYATAIFIT---SWQNVYF 354
                 + +CI   L++    P   KI T+ +V    G   +YA AI +T   +W+ ++ 
Sbjct: 162 ------VAQCIPVYLSEMAPAPIRGKILTLNVVSITFGQLFSYAIAICLTIPHAWRYLFA 215

Query: 355 LLAIFSFFTLFLIMFYFPSNESYKTNNTNLSSIVATLDI 393
             AI +   L L++ + P +  +  +  N +  + TL I
Sbjct: 216 FAAIPAIVFL-LVLDFIPESPRWLLSQNNTTDAIKTLSI 253

>CAGL0C01771g Chr3 (187030..188487) [1458 bp, 485 aa] {ON} similar
           to uniprot|P38142 Saccharomyces cerevisiae YBR241c or
           uniprot|P53142 Saccharomyces cerevisiae YGL104c
          Length = 485

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 2/68 (2%)

Query: 246 ISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIVMARFILGLASGSLIY 305
           I   +  Q++ KY   K +S     ++ IGS +LT+    +W ++  R ++G+ASG  I 
Sbjct: 99  IGSYIAGQLAAKYGK-KKISQGTAFVYFIGSLMLTMAN-GYWTMIFGRLLVGMASGISIV 156

Query: 306 VMLTIINK 313
           V+   IN+
Sbjct: 157 VIPVYINE 164

>SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} similar
           to uniprot|P39980 Saccharomyces cerevisiae YEL065W SIT1
           Ferrioxamine B transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 611

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 86/198 (43%), Gaps = 34/198 (17%)

Query: 444 ETTTNKNPIIPLDFIENKVIFFKSLTVFFASMSLITFIHYFPF-YLEKTLNISLFDIYKR 502
           E    +NP+ P D I+++ IF   +  F     LI FI Y    Y+   L +++ +  K 
Sbjct: 317 EGKYARNPLTPWDLIKDRGIFSALIIAF-----LINFIWYMQGDYMYTVLIVAVHESIKS 371

Query: 503 TSPM-----FLTIL------FIIITVSRRISTQNTLSYGLVTFFGIMGLIGQCILLNYVY 551
            + +     F++++      F+I+ V R   T+  + +G+  +F   GL     L++Y  
Sbjct: 372 ATRIVSLYSFVSVITGTLLGFVIVKVRR---TKPFILFGVCCWFLSFGL-----LVHYRG 423

Query: 552 NDTADYKLWKQ-CMIGILPILGSTFLVIATLMDVT----DDKKLPIISTSSFAVSTLGSI 606
           +  A   +    C++G     G+ F    T   +       + + +I+    A   +GS 
Sbjct: 424 DSGAHAGIVGSLCLLG----FGAGFFTYTTQASIQASTGSHQNMAVITALYLATYNIGSA 479

Query: 607 LGICISGFIFNQGLYDEL 624
           +G  +SG I+   L  +L
Sbjct: 480 VGNAVSGAIWTNVLPQQL 497

>KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 634

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 46/95 (48%), Gaps = 10/95 (10%)

Query: 538 MGLIGQCILLNYVYNDTADYKLWKQCMIGILPILG-----STFLVIATLMDVTDDKKLPI 592
           + ++   IL ++     +D     + +IG L + G      T+ V  +L  VT  + +  
Sbjct: 440 LWMVAMGILFHFRSGQNSD-----KGIIGALVVWGLGTTMFTYPVTVSLQSVTSHENMAT 494

Query: 593 ISTSSFAVSTLGSILGICISGFIFNQGLYDELWVH 627
           ++  S+ +  +GS +G  +SG I+ Q LY +L  H
Sbjct: 495 VTALSYTMYRIGSAVGSAVSGAIWTQLLYKQLLQH 529

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 58/128 (45%), Gaps = 11/128 (8%)

Query: 224 GSHVKQSSNSSWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKT 283
           G+H    + + WIIA Y +   +  LL  +++  +  +KT      ++F IGS I  +  
Sbjct: 86  GAHFDAYAKTGWIIAGYSLPNALMSLLWGRIAFSFLGFKTAMLSAIVIFEIGSLICALAN 145

Query: 284 VSFWWIVMARFILGLASGSLIYVMLTIINKCILNKR-------FSRPSMKIFTI--PIVG 334
            S   ++  R I G+  GS I  +  +I   +++ R       F   S  I ++  P +G
Sbjct: 146 -SMDMLIGGRVIAGIG-GSGIQSLSFVIGSTLVSPRGRGFIIAFMSASFGIASVIGPFIG 203

Query: 335 GLSLAYAT 342
           G   ++ T
Sbjct: 204 GAFTSHVT 211

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 89/195 (45%), Gaps = 29/195 (14%)

Query: 444 ETTTNKNPIIPLDFIENKVIFFKSLTVFFASMSLITFIHYFPFYLEK----TLNISLFDI 499
           E    + PI+P   I+++ ++        ASMS I+F++ F FY+      T+ I   D 
Sbjct: 362 ELKWAREPILPWKLIKDRAVW--------ASMS-ISFLYDFIFYMAYDYLYTVMIVAVDE 412

Query: 500 YKRTSPMFLTILFIIITV-----SRRISTQNTLSYGLVTFFGIMGLIGQCILLNYVYNDT 554
             +++    ++   + TV     +  I+    L   ++   G+  ++   +L ++    +
Sbjct: 413 SVKSATRISSLSAFVSTVFSPFFALYITRVTRLKPYIIAGCGLW-MVAMGLLYHFRGGKS 471

Query: 555 ADYKLWKQCMIGILPILGS-----TFLVIATLMDVTDDKKLPIISTSSFAVSTLGSILGI 609
           +        +IG L + G      T+ V  ++   T  + +  +++ ++ +  +GS +GI
Sbjct: 472 S-----HSGIIGGLCVWGVGTTMFTYPVNVSVQSATSHENMATVTSLNYTLYRIGSAVGI 526

Query: 610 CISGFIFNQGLYDEL 624
            +SG I+ Q LY E+
Sbjct: 527 AVSGCIWTQNLYHEI 541

>TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 36/69 (52%), Gaps = 5/69 (7%)

Query: 564 MIGILPILGS-----TFLVIATLMDVTDDKKLPIISTSSFAVSTLGSILGICISGFIFNQ 618
           +IG L + G      T+ V  ++      + +  ++ +++ +  +GS +G  +SG I+ Q
Sbjct: 456 IIGALCVWGVGTTLFTYPVTVSVQAAVSHENMATVTAANYTLYRIGSAIGAAVSGAIWTQ 515

Query: 619 GLYDELWVH 627
            LY +L+ H
Sbjct: 516 TLYKQLYKH 524

>SAKL0C09350g Chr3 complement(849691..851427) [1737 bp, 578 aa] {ON}
           similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C ITR1
          Length = 578

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 62/149 (41%), Gaps = 17/149 (11%)

Query: 252 AQVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIVMARFILGLAS--GSLIY-VML 308
           A VS      K       +LF+IG+ IL +   +FW + + R ++G     GSLI  + +
Sbjct: 128 AGVSADLFGRKPCIMFSNLLFVIGA-ILQVSAHTFWQMAIGRLVMGFGVGIGSLISPLFI 186

Query: 309 TIINKCILNKRFSRPSMKIFTIPIVGGLSLAYATAIFITSWQNVYFLLAIFSF------F 362
           + I   ++  R +     + ++ + GG  +AYA    +    N + +L   S       F
Sbjct: 187 SEIAPKMIRGRLT----VVNSLCLTGGQLIAYACGAGLDKVHNGWRILVGLSLIPTVIQF 242

Query: 363 TLFLIMFYFPSNESYKTNNTNLSSIVATL 391
           T+F+   + P    Y     NL      L
Sbjct: 243 TMFM---FLPDTPRYYVMKGNLEKAAQVL 268

>Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {ON}
           YDR497C (ITR1) - myo-inositol transporter [contig 184]
           FULL
          Length = 578

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 57/138 (41%), Gaps = 8/138 (5%)

Query: 246 ISQLLTAQVSGKYKN---YKTLSYIGTMLFLIGSSILTIKTVSFWWIVMARFILGLASGS 302
           +  L++A  +G   +    K    I  + F+IG+ +L +   +FW + + R I+G   G 
Sbjct: 121 LGALISAVAAGTCADIWGRKPCLMISNLFFVIGA-VLQVSASTFWQMAVGRLIMGFGVGI 179

Query: 303 LIYVMLTIINKCILNKRFSRPSMKIFTIPIVGGLSLAYATAIFITSWQNVYFLLAIFSF- 361
              +    I + I  K      + I ++ + GG  +AY     +    N + +L   S  
Sbjct: 180 GSLISPLFIGE-IAPKMIRGRLVVINSLCLTGGQLIAYGCGAGLDHVHNGWRILVGLSLI 238

Query: 362 --FTLFLIMFYFPSNESY 377
             FT F+   + P    Y
Sbjct: 239 PTFTQFVCFCFLPDTPRY 256

>TPHA0J01680 Chr10 (388361..390049) [1689 bp, 562 aa] {ON} 
          Length = 562

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 45/96 (46%), Gaps = 9/96 (9%)

Query: 228 KQSSNSSWIIASYLITMYISQLLTAQVSGKY--KNYKTLSYI-GTMLFLIGSSILTIKTV 284
           ++ S +SWI + +L     S +LT    G Y  +N   + YI GT+LFL G  I T    
Sbjct: 193 EELSTTSWIFSIFLAVSCFSTILT----GGYFDRNGSVVPYISGTILFLSG-LIATANCT 247

Query: 285 SFWWIVMA-RFILGLASGSLIYVMLTIINKCILNKR 319
             W  V+A      L SG LI  ++  +    L KR
Sbjct: 248 KVWHFVLAFSLTTALGSGMLITPLVGCVATWFLKKR 283

>Skud_4.58 Chr4 complement(98588..100651) [2064 bp, 687 aa] {ON}
           YDL199C (REAL)
          Length = 687

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 31/49 (63%), Gaps = 3/49 (6%)

Query: 255 SGKYKNY--KTLSYIGTMLFLIGSSILTIKTVSFWWIVMARFILGLASG 301
           SG  + Y  K L  IGTM++ +G+ ++ +  ++ W +++ RFILG+  G
Sbjct: 182 SGVLETYSRKKLLQIGTMIYSLGA-LIQVSALNQWCLLLGRFILGVGVG 229

>CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040c ARN1
           or uniprot|P38724 Saccharomyces cerevisiae YHL047c TAF1
          Length = 645

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 83/192 (43%), Gaps = 33/192 (17%)

Query: 449 KNPIIPLDFIENKVIFFKSLTVFFASMSLITFIHYFPF-YLEKTLNISLFDIYKRTSPM- 506
           ++PIIP   ++++ ++       FA   LI FI+Y    YL   L + + +  K  + + 
Sbjct: 363 RDPIIPYKLVKDRGVWAS-----FAISFLIDFIYYMAADYLYTVLIVGVNESVKSATRIS 417

Query: 507 ----FLT-----ILFIIITVSRRISTQNTLSYGLVTFFGIMGLIGQCILLNYVYNDTADY 557
               F++     I  ++IT   R+        GL  +   MGL+       Y Y   A+ 
Sbjct: 418 SLSTFVSTVGSPIFSLLITRFSRLKPFIICGCGL--WMLAMGLL-------YHYRGGAES 468

Query: 558 KLWKQCMIGILPILGS-----TFLVIATLMDVTDDKKLPIISTSSFAVSTLGSILGICIS 612
                 +IG L + G      T+ V  ++   T  + +  ++  ++    +GS +G  +S
Sbjct: 469 H---SGIIGALCVWGVGTTLFTYPVNVSVQAATSHEHMATVTALNYTFYRIGSAVGAAVS 525

Query: 613 GFIFNQGLYDEL 624
           G I+ Q LY +L
Sbjct: 526 GAIWTQTLYKQL 537

>Kpol_2001.58 s2001 complement(162456..164357) [1902 bp, 633 aa]
           {ON} complement(162456..164357) [1902 nt, 634 aa]
          Length = 633

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 39/82 (47%), Gaps = 11/82 (13%)

Query: 304 IYVMLTIINKCILNKRFSRPSMKI--FTIPIVGGLSLAYATAIFITSWQNVYFLL-AIFS 360
           IY + +I    + NK  S+P + I    +PIV      YAT + I  +   Y LL AIF 
Sbjct: 250 IYSLASIFLHFLKNK--SKPLIPIDFIALPIVDDFDYTYATFLRIIHYNEYYELLAAIFP 307

Query: 361 FFTLFLIMFYFPSNESYKTNNT 382
            FT FL       NE +  +N+
Sbjct: 308 LFTSFL------DNEDHTKHNS 323

>TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 83/197 (42%), Gaps = 32/197 (16%)

Query: 444 ETTTNKNPIIPLDFIENKVIFFKSLTVFFASMSLITFIHYFPF-YLEKTLNISLFD---- 498
           E   +++P+ P   I+++ I F     F      I F  Y    Y+   L +S+ +    
Sbjct: 336 EIKFSRHPLTPWALIKDRGIIFAIFIAFH-----INFCWYMQGDYMYTVLIVSVHESVKS 390

Query: 499 ------IYKRTSPMFLTILFIIITVSRRISTQNTLSYGLVTFFGIMGLIGQCILLNYVY- 551
                 +Y   S +  TIL + IT  RR  T+  + +G+V +F   GL     L++Y   
Sbjct: 391 ATRITSLYSFVSVITGTILGMFITKIRR--TKPFIVFGVVCWFIAFGL-----LVHYRGD 443

Query: 552 NDTADYKLWKQCMIGILPILGSTFLVIATLMDVT----DDKKLPIISTSSFAVSTLGSIL 607
           N++    +   C++G     G+ F    T   +        K+ +I+    A   +GS +
Sbjct: 444 NNSHSGIIGSLCLLG----FGAGFFTYTTQASIQASAKSHSKMAVITALYLATYNIGSSV 499

Query: 608 GICISGFIFNQGLYDEL 624
           G  +SG I+   L  E+
Sbjct: 500 GAAVSGAIWTNILPKEI 516

>KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 39/195 (20%), Positives = 85/195 (43%), Gaps = 29/195 (14%)

Query: 444 ETTTNKNPIIPLDFIENKVIFFKSLTVFFASMSLITFIHYFPF-YLEKTLNISLFDIYKR 502
           E     NP++P   ++++ ++  +L + F    LI FI Y    YL   L +++ +  K 
Sbjct: 346 EARWATNPLVPYKLVKDRGVW-AALGISF----LIDFIFYMAVDYLYTVLIVAVHESVKS 400

Query: 503 TSPM-----FLTIL---FIIITVSRRISTQNTLSYGLVTFFGIMGLIGQCILLNYVYNDT 554
            + +     F++ +    + + ++R    +  +  G   +   MGL+       Y +   
Sbjct: 401 ATRISSLSSFVSTVASPIVALALTRVTRMKPVIIVGCSLWLLAMGLL-------YHFRGG 453

Query: 555 ADYKLWKQCMIGILPILG-----STFLVIATLMDVTDDKKLPIISTSSFAVSTLGSILGI 609
            +       +IG L + G      T+ V  ++   T+   +  ++  ++ +  +GS +G 
Sbjct: 454 RESH---SGIIGALCVWGLGTTLFTYPVTVSVQAATNHDNMATVTALNYTLYRIGSAVGA 510

Query: 610 CISGFIFNQGLYDEL 624
            +SG I+ Q LY +L
Sbjct: 511 AVSGAIWTQTLYKQL 525

>NCAS0I00100 Chr9 complement(4805..5296) [492 bp, 163 aa] {ON} 
          Length = 163

 Score = 30.8 bits (68), Expect = 6.0,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 27/51 (52%)

Query: 574 TFLVIATLMDVTDDKKLPIISTSSFAVSTLGSILGICISGFIFNQGLYDEL 624
           T+ V  +    T  + +  ++  ++ V  +GS +G  ISG I+ Q LY E+
Sbjct: 3   TYPVTVSCQAATSHEHMATVTALTYTVYRIGSAVGSAISGCIWTQKLYPEI 53

>YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}
           ARN1Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to ferrirubin, ferrirhodin, and related
           siderophores
          Length = 627

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 37/190 (19%), Positives = 86/190 (45%), Gaps = 29/190 (15%)

Query: 449 KNPIIPLDFIENKVIFFKSLTVFFASMSLITFIHYFPF-YLEKTLNISLFDIYKRTSPM- 506
           ++PI+P   ++++ ++  S+ + F    LI FI+Y    YL   + +++ +  K  + + 
Sbjct: 346 RDPILPYRLVKDRAVW-SSMGISF----LIDFIYYMAADYLYTVMIVAVNESVKSATRIA 400

Query: 507 ----FLTIL---FIIITVSRRISTQNTLSYGLVTFFGIMGLIGQCILLNYVYNDTADYKL 559
               F++ +   F  + V+R    +  + +G   +   MGL+       Y +   +    
Sbjct: 401 TLSSFVSTVASPFFALLVTRCTRLKPFIMFGCALWMVAMGLL-------YHFRGGSQSH- 452

Query: 560 WKQCMIGILPILGS-----TFLVIATLMDVTDDKKLPIISTSSFAVSTLGSILGICISGF 614
               +IG L + G      T+ V  ++      + +  ++  ++ +  +GS +G  +SG 
Sbjct: 453 --SGIIGALCVWGVGTTLFTYPVTVSVQSAVSHENMATVTALNYTLYRIGSAVGSAVSGA 510

Query: 615 IFNQGLYDEL 624
           I+ Q LY ++
Sbjct: 511 IWTQTLYKQI 520

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 34/55 (61%), Gaps = 4/55 (7%)

Query: 231 SNSSWIIASYLITMYISQLLTAQVSG----KYKNYKTLSYIGTMLFLIGSSILTI 281
           ++S+W  A +LIT  IS ++TA V G    K +  K +  I ++L ++G+ +LT+
Sbjct: 402 NDSAWKAAVHLITCVISTVITAIVCGVITDKTRQIKPIIVISSILGVVGAGLLTL 456

>TPHA0G00350 Chr7 complement(58440..62582) [4143 bp, 1380 aa] {ON}
           Anc_7.519 YPR164W
          Length = 1380

 Score = 31.6 bits (70), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%)

Query: 368 MFYFPSNESYKTNNTNLSSIVATLDIDLIGCTILSVFLLLIAVITTGNSNGFS 420
           +++F  NE   TN  N+ S    LD+     TIL+++   + VI  GNS  F+
Sbjct: 809 IYHFKWNEFISTNMINIKSYNKILDVTFAKFTILAIYETFLIVIDNGNSQVFN 861

>YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}
           SIT1Ferrioxamine B transporter, member of the ARN family
           of transporters that specifically recognize
           siderophore-iron chelates; transcription is induced
           during iron deprivation and diauxic shift; potentially
           phosphorylated by Cdc28p
          Length = 628

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 88/199 (44%), Gaps = 36/199 (18%)

Query: 444 ETTTNKNPIIPLDFIENKVIFFKSLTVFFASMSLITFIHYFPF-YLEKTLNISLFD---- 498
           E   +++P+ P D I+++ IFF  L  FF     I F  Y    Y+   L +++ +    
Sbjct: 336 EIKYSRHPLTPWDLIQDRGIFFALLIAFF-----INFNWYMQGDYMYTVLVVAVHESIKS 390

Query: 499 ------IYKRTSPMFLTIL-FIIITVSRRISTQNTLSYGLVTFFGIMGLIGQCILLNYVY 551
                 +Y   S +  TIL FI+I V R   T+  + +G+  +    GL     L++Y  
Sbjct: 391 ATRITSLYSFVSVIVGTILGFILIKVRR---TKPFIIFGISCWIVSFGL-----LVHYRG 442

Query: 552 NDTADYKLWKQCMIGILPILG-----STFLVIATLM-DVTDDKKLPIISTSSFAVSTLGS 605
           +  A        +IG L +LG      T++  A++        ++ ++++   A   +GS
Sbjct: 443 DSGA-----HSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIGS 497

Query: 606 ILGICISGFIFNQGLYDEL 624
             G  +SG ++   L  E+
Sbjct: 498 AFGSSVSGAVWTNILPKEI 516

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,277,711
Number of extensions: 2759249
Number of successful extensions: 10741
Number of sequences better than 10.0: 143
Number of HSP's gapped: 11127
Number of HSP's successfully gapped: 158
Length of query: 694
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 577
Effective length of database: 40,065,477
Effective search space: 23117780229
Effective search space used: 23117780229
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 69 (31.2 bits)