Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0J012708.270ON73573537160.0
NCAS0B037908.270ON6126336386e-73
Skud_4.3788.270ON6526345847e-65
Suva_2.2778.270ON6496305697e-63
KAFR0B054608.270ON6106505623e-62
YDR118W (APC4)8.270ON6526275494e-60
TDEL0F039708.270ON6194975475e-60
Smik_4.3628.270ON6486275424e-59
ZYRO0C01474g8.270ON5994864781e-50
Kpol_392.18.270ON4243744652e-50
TPHA0J007908.270ON6854094014e-40
KNAG0H031908.270ON6224673942e-39
CAGL0B01859g8.270ON6223863374e-32
TBLA0C045708.270ON6083853365e-32
KLTH0G13508g8.270ON6454872742e-24
Kwal_56.237668.270ON7404672691e-23
SAKL0H16852g8.270ON6444832644e-23
Ecym_43008.270ON715187960.008
AGR078C8.270ON715406950.010
Kpol_1018.1077.413ON112768742.9
ZYRO0E01496g2.617ON87794716.3
Suva_10.1918.295ON4907150718.1
NOTE: 1 genes in the same pillar as NDAI0J01270 were not hit in these BLAST results
LIST: KLLA0F19316g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0J01270
         (735 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8....  1436   0.0  
NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {O...   250   6e-73
Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W ...   229   7e-65
Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa...   223   7e-63
KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa] ...   221   3e-62
YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subuni...   216   4e-60
TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.2...   215   5e-60
Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W ...   213   4e-59
ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {...   188   1e-50
Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON} compl...   183   2e-50
TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8....   159   4e-40
KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {O...   156   2e-39
CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly...   134   4e-32
TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON} Anc_8...   134   5e-32
KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]...   110   2e-24
Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {...   108   1e-23
SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]...   106   4e-23
Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}...    42   0.008
AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON} S...    41   0.010
Kpol_1018.107 s1018 complement(282640..286023) [3384 bp, 1127 aa...    33   2.9  
ZYRO0E01496g Chr5 complement(108148..110756,110823..110847) [263...    32   6.3  
Suva_10.191 Chr10 complement(353936..368659) [14724 bp, 4907 aa]...    32   8.1  

>NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8.270
           YDR118W
          Length = 735

 Score = 1436 bits (3716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 707/735 (96%), Positives = 707/735 (96%)

Query: 1   MNHQQSQYPHQKGHRDEQWNFAPISYINPSFPLYLTKTSNSIIARRTLDGFQISNIIIRN 60
           MNHQQSQYPHQKGHRDEQWNFAPISYINPSFPLYLTKTSNSIIARRTLDGFQISNIIIRN
Sbjct: 1   MNHQQSQYPHQKGHRDEQWNFAPISYINPSFPLYLTKTSNSIIARRTLDGFQISNIIIRN 60

Query: 61  MQNVIAIDWDSKTGKYLTINFDDGTFRIYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAI 120
           MQNVIAIDWDSKTGKYLTINFDDGTFRIYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAI
Sbjct: 61  MQNVIAIDWDSKTGKYLTINFDDGTFRIYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAI 120

Query: 121 WDRLIILNSIQELEFNHDITKLMPTLIKFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYK 180
           WDRLIILNSIQELEFNHDITKLMPTLIKFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYK
Sbjct: 121 WDRLIILNSIQELEFNHDITKLMPTLIKFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYK 180

Query: 181 PISTNMDAIDMTTNQEVEKSMRYLDLHIIHVIDPDCFTIAINGTYQINLVRKTINTTNRN 240
           PISTNMDAIDMTTNQEVEKSMRYLDLHIIHVIDPDCFTIAINGTYQINLVRKTINTTNRN
Sbjct: 181 PISTNMDAIDMTTNQEVEKSMRYLDLHIIHVIDPDCFTIAINGTYQINLVRKTINTTNRN 240

Query: 241 KIVRILKSTVHGVYHCFHENGSIRSLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDL 300
           KIVRILKSTVHGVYHCFHENGSIRSLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDL
Sbjct: 241 KIVRILKSTVHGVYHCFHENGSIRSLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDL 300

Query: 301 INKHLLKTFTDFLYPTIFEEKQNGGGNSMXXXXXXXXXXXXXXXXXIEWLTLSIGEKNLK 360
           INKHLLKTFTDFLYPTIFEEKQNGGGNSM                 IEWLTLSIGEKNLK
Sbjct: 301 INKHLLKTFTDFLYPTIFEEKQNGGGNSMLQQLKLSLLSGEMSEELIEWLTLSIGEKNLK 360

Query: 361 KWKRLSEELYSKSIQIFSLALIPACELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNS 420
           KWKRLSEELYSKSIQIFSLALIPACELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNS
Sbjct: 361 KWKRLSEELYSKSIQIFSLALIPACELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNS 420

Query: 421 THTNIELNSRQDKILTEFSPSFLELIEILQKFGSRCLQNLRKISYIEKQSSLFLKWLQEM 480
           THTNIELNSRQDKILTEFSPSFLELIEILQKFGSRCLQNLRKISYIEKQSSLFLKWLQEM
Sbjct: 421 THTNIELNSRQDKILTEFSPSFLELIEILQKFGSRCLQNLRKISYIEKQSSLFLKWLQEM 480

Query: 481 IFHALDEDHVPKLDTYSNPIICLDLSNFLNKLIVLSTDKNKEDREEDQNPLVNDDDENEL 540
           IFHALDEDHVPKLDTYSNPIICLDLSNFLNKLIVLSTDKNKEDREEDQNPLVNDDDENEL
Sbjct: 481 IFHALDEDHVPKLDTYSNPIICLDLSNFLNKLIVLSTDKNKEDREEDQNPLVNDDDENEL 540

Query: 541 FCSMEETTTMLQRINYLSRSIDEKGIQPTLQQCLYLGPNIQFITEREFDPSKEITVKDVV 600
           FCSMEETTTMLQRINYLSRSIDEKGIQPTLQQCLYLGPNIQFITEREFDPSKEITVKDVV
Sbjct: 541 FCSMEETTTMLQRINYLSRSIDEKGIQPTLQQCLYLGPNIQFITEREFDPSKEITVKDVV 600

Query: 601 KVLNGSILLYLLQVKSLDSRDLFYVGTINVVDLKPICHPKLIQFPLTSNEIINITDVQLL 660
           KVLNGSILLYLLQVKSLDSRDLFYVGTINVVDLKPICHPKLIQFPLTSNEIINITDVQLL
Sbjct: 601 KVLNGSILLYLLQVKSLDSRDLFYVGTINVVDLKPICHPKLIQFPLTSNEIINITDVQLL 660

Query: 661 TDIKLVXXXXXXXXXXXMIDEIGPFFNLFIMFDTVSSMNNREVNSKIWYRIRKSNEHYGV 720
           TDIKLV           MIDEIGPFFNLFIMFDTVSSMNNREVNSKIWYRIRKSNEHYGV
Sbjct: 661 TDIKLVSTNSNNNDDDSMIDEIGPFFNLFIMFDTVSSMNNREVNSKIWYRIRKSNEHYGV 720

Query: 721 VSTELIPDLSNVFAN 735
           VSTELIPDLSNVFAN
Sbjct: 721 VSTELIPDLSNVFAN 735

>NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {ON}
           Anc_8.270 YDR118W
          Length = 612

 Score =  250 bits (638), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 191/633 (30%), Positives = 310/633 (48%), Gaps = 97/633 (15%)

Query: 24  ISYINPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDD 83
           +SY NPS+P  L KTS     RRT D  QI  I+IRNM  VIA  W+S    YLT+ F+D
Sbjct: 9   VSY-NPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMFND 67

Query: 84  GTFRIYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNSIQELEFNHDITKLM 143
           G+ RI+DIF++GKL+TL+R Q        +  +D  IW +L +     E EF+ DI+ LM
Sbjct: 68  GSARIHDIFREGKLMTLLRLQDGF-----QKCMDTGIWSKLEVRQKPNEGEFDRDISGLM 122

Query: 144 PTLIKFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRY 203
           P+ IKFV ++  + +VPY   + Q  WR        KP+  N                  
Sbjct: 123 PSPIKFVNNAGQLEVVPYVVTQTQ--WRNVD-----KPLEVN----------------DI 159

Query: 204 LDLHIIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGSI 263
           +D+H+ H  + D + + ING Y++ +   + +    N++ +I+      ++HCF+++   
Sbjct: 160 IDIHMAHNSNTDEYLLMINGVYKLTIQPNSTDENASNQLHKIIHLEKTAIFHCFYKDRKT 219

Query: 264 RSLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPT-IFEEKQ 322
            ++  +    ST HV LL +  E+ ++ +Y   HLD+I+  L K   DFL  T I   K 
Sbjct: 220 STIDLTTLMESTPHVSLLNVLTEMKQLHRYIVDHLDIIDNDLKKPLDDFLEVTNILNIKD 279

Query: 323 NGGGNSMXXXXXXXXXXXXXXXXXIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALI 382
                 +                   WL   +GEKNLKKWKRLSE  Y K IQI SLA++
Sbjct: 280 ------LSKSLKSFILYGLMAKSLNHWLCNVVGEKNLKKWKRLSETKYQKIIQIISLAVL 333

Query: 383 PACELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKILTEFSPSF 442
           PA E   LLS +C A++ AI +     ++                               
Sbjct: 334 PALEKLSLLSIRCEALVVAIALPASGHMQE------------------------------ 363

Query: 443 LELIEILQK-FGSRCLQNL---RKISYIEKQSSLFLKWLQEMIFHALDEDHVPKLDTYSN 498
           LE  + L++   + C Q L   +K S  EK+ S+F+ W+Q++IF  +DED+VPKL+    
Sbjct: 364 LEYFDSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDYVPKLN---- 419

Query: 499 PIICLDLSNFLNKLIVLSTDKNKEDREEDQNPLVNDDDENELFCSMEETTTMLQRINYLS 558
             IC D S     + ++  D+  +D  ++++    D  +N           +L+ I+   
Sbjct: 420 --ICEDGSVVPTLMEII--DQFFQDTTKEKSTDGTDLSKN-----------LLKSISDTL 464

Query: 559 RSIDEKGIQPTLQQCLYLGPNIQFITEREFDPSKEITVKDVVKVLNGSILLYLLQVKSLD 618
            +ID   ++  L + + +    +  TE  FD  +++T+ D+        L+YL++ +S +
Sbjct: 465 ENIDSSYVRNMLLKTMKIRGTARSFTEN-FD--EDVTILDIFYCAKYPFLVYLVEKRS-N 520

Query: 619 SRD----LFYVGTINVVDLKPICHPKLIQFPLT 647
           ++D    + Y+GT N ++L+ I   K + +PL+
Sbjct: 521 TQDVKASVKYIGTANSINLRTISAAKKVNYPLS 553

>Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W
           (REAL)
          Length = 652

 Score =  229 bits (584), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 180/634 (28%), Positives = 288/634 (45%), Gaps = 104/634 (16%)

Query: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87
           NP FP++ T+ +  +   R  D  +I+ I +RN+  V    WD  +GK+L+I F DGT R
Sbjct: 13  NPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIFFKDGTVR 72

Query: 88  IYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNSIQELEFNHDITKLMPTLI 147
           I+DIF+DG+L++ +R           TK+   IWDR+ +        F +++  ++P LI
Sbjct: 73  IHDIFKDGRLVSFLRVP--------STKISRGIWDRIPLKREYDSETFAYNVIDILPKLI 124

Query: 148 KFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYLDLH 207
           +FVKDS  + IVPY+      +WR                      +++  +S   LD+H
Sbjct: 125 RFVKDSKRVSIVPYT--PPNGLWR--------------------GPDEDDPESGEILDVH 162

Query: 208 IIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVH---GVYHCFHENGSIR 264
           +I     D  TI  NG Y I L    I         RIL+S V    G YHCF+ +GS+R
Sbjct: 163 VIFNEGNDKITIFFNGDYTILLPMDDIENE------RILESVVKVQDGFYHCFYNDGSVR 216

Query: 265 SLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNG 324
           +L       S   V+LL   M I E+I Y   H++LIN+ L+  + DF+   I +E    
Sbjct: 217 TLNLQPLLRSKPSVDLLHYIMVIKELIGYLLAHVELINRELITPYLDFV-KRICDEAY-- 273

Query: 325 GGNSMXXXXXXXXXXXXXXXXXIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPA 384
           G N +                  +WL  S+GEKNLKKWK L  E Y K+ QI +L  +P 
Sbjct: 274 GYNKLKSELECLFLLGEVSCDLEDWLCNSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPT 333

Query: 385 CELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKILTEFSPSFLE 444
           CE  ++  +K    L A  ++ K+          N+T                   S L 
Sbjct: 334 CERIIIFVEKLRGTLEAFSVQNKS----------NNT-------------------SDLT 364

Query: 445 LIEILQKFGSRCLQN-LRKISYIEKQSSLFLK---WLQEMIFHALDEDHVPKLDTYSNPI 500
            +E+L K     L N L+ I  + +  +LF K   W  + I   LDED+  K +   +P 
Sbjct: 365 AVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKFEFEDDPY 424

Query: 501 ICLDLSNFLNKLIVLSTDKNKEDREEDQNPLVNDDDENELFCSMEETTTMLQRINYLSRS 560
              DL  + +K++          R  + + ++N     EL  +M +          + + 
Sbjct: 425 FGYDLLTYFDKILSY--------RSTESSSVINMKLYRELINNMSD----------MEKD 466

Query: 561 IDEKGIQPTLQQCLYLGPNIQFITEREFDPSKEITVKDVVKVLNGSILLYLLQV-KSLDS 619
           I +  +   +QQ L +  NI+     +  PS ++ + D +K+ N S ++YL++V K +++
Sbjct: 467 IAKNNVSQHIQQQLLI--NIRKDVYSQMYPSSQVRLLDAIKLPNQSYIVYLIEVTKLMNT 524

Query: 620 RDL--------FYVGTINVVDLKPICHPKLIQFP 645
           +++         YVGT+    L  I     I+ P
Sbjct: 525 KEVSSGENTPKLYVGTLKDESLDIISRESSIRIP 558

>Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa]
           {ON} YDR118W (REAL)
          Length = 649

 Score =  223 bits (569), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 167/630 (26%), Positives = 279/630 (44%), Gaps = 96/630 (15%)

Query: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87
           NP FP++  +    +   R  D  +++ I +RN+  V   +WD  TGK+L+I F DGT R
Sbjct: 9   NPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIFFKDGTIR 68

Query: 88  IYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNSIQELEFNHDITKLMPTLI 147
           I+DIF+DG+L++ +R  R        TK+   IWDR+ +        F +++  ++P LI
Sbjct: 69  IHDIFKDGRLVSFLRIPR--------TKISRGIWDRIPLKYESSNRNFANNVIDVLPKLI 120

Query: 148 KFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYLDLH 207
           +FVKDS  + I PY+     ++WR                      +++  ++   LD+H
Sbjct: 121 RFVKDSKRVTIAPYT--PPNSLWR--------------------GPDEDDPENCENLDIH 158

Query: 208 IIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGSIRSLY 267
           +I     D  T+  NG Y I L    ++     KI++ +    +G YHCF+ +G++ +  
Sbjct: 159 VIFNEGNDKITVFFNGDYAILL---PVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFN 215

Query: 268 FSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNGGGN 327
                 S   V+LL   M I E+I Y   H++ IN+ L   + DF+   I +E    G +
Sbjct: 216 LERLLQSEPSVDLLRYMMVIKELIGYLLAHIEFINRELTTPYMDFV-KRICDEAY--GYS 272

Query: 328 SMXXXXXXXXXXXXXXXXXIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPACEL 387
            +                  +WL  ++GEKN K+WK L  E Y K++Q+F+LA +P CE 
Sbjct: 273 KLKSELKCLFLLGEVPSDLDDWLCNAVGEKNFKRWKVLGCEAYQKTVQVFTLAFVPTCER 332

Query: 388 TLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKILTEFSPSFLELIE 447
            ++  QK   IL A  I+                 T +EL  +Q +          EL+ 
Sbjct: 333 IIIFVQKLKGILEAFSIQXXX--------XXXXDLTAVELLLKQSQ----------ELLN 374

Query: 448 ILQKFGSRCLQNLRKISYIEKQSSL---FLKWLQEMIFHALDEDHVPKLDTYSNPIICLD 504
           I           L+ I  + K  +L   FL W  + I   LDED+ PK +   +P    D
Sbjct: 375 I----------TLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYKPKFEFEDDPYFGYD 424

Query: 505 LSNFLNKLIVLSTDKNKEDREEDQNPLVNDDDENELFCSMEETTTMLQRINYLSRSIDEK 564
           L NF  K +   +D+N E        L  D               ++  +  + + I + 
Sbjct: 425 LLNFFEKFL---SDRNTESSSVIDMKLYRD---------------LINSMTAMEKDIAKN 466

Query: 565 GIQPTLQQCLYLGPNIQFITEREFDPSKEITVKDVVKVLNGSILLYLLQV---KSLDSRD 621
            + P +Q+ + +       ++R   PS +I + D +K+   + ++YL+QV   K +    
Sbjct: 467 NVNPHIQRQVLVQSRADVFSQRY--PSSKINLLDAIKLSKQNYIVYLIQVTEKKDIQEAS 524

Query: 622 L------FYVGTINVVDLKPICHPKLIQFP 645
           L       Y+GT+    L  +     I+ P
Sbjct: 525 LERNTQKLYIGTLKDESLDIVSRESSIKMP 554

>KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa]
           {ON} Anc_8.270 YDR118W
          Length = 610

 Score =  221 bits (562), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 174/650 (26%), Positives = 302/650 (46%), Gaps = 111/650 (17%)

Query: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87
           N   PLY  K    ++  R  D   I++ II+  + V  I WD  +GKYL+I F DG+ R
Sbjct: 15  NKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLSIFFRDGSIR 74

Query: 88  IYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNSIQELEFNHDITKLMPTLI 147
           I D+F+DGKL+  +R Q           VD   WDR+    + +  +FN +I  LMP+LI
Sbjct: 75  IIDVFKDGKLVAFLRTQFK--------NVDCTYWDRIEEQTTNEMKQFNKNIVDLMPSLI 126

Query: 148 KFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYLDLH 207
           +FV  +  + ++PY+ +     WRE             +DA          K  R +D+H
Sbjct: 127 QFVSSANKLSLIPYTPSNAN--WRE-------------LDA--------KWKKNRVIDMH 163

Query: 208 IIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGSIRSLY 267
            +H  + D F + +NG Y + L     + + +     ++KS  + +Y C +++GS R + 
Sbjct: 164 CLHQSETDSFLMVLNGDYYLTLKTPETDLSEKVPACSLIKS-ANSLYQCIYKDGSARKID 222

Query: 268 FSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNG--G 325
            S F SS   ++LLE  + + +M KY + HLDL+ + ++K + DFL     E+  +G  G
Sbjct: 223 TSSFLSSKSCIDLLECILSLKDMSKYTRNHLDLLERVIIKPYLDFL-----EKICDGAFG 277

Query: 326 GNSMXXXXXXXXXXXXXXXXXIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPAC 385
              +                  +WL  S+G+KN+ +W+ L  + Y ++ ++F++AL+ AC
Sbjct: 278 REKLINELKITFLLGTISDELQDWLHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCAC 337

Query: 386 ELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKILTEFSPSFLEL 445
           E  +LLS++C  ++ A + E  A                 + NSR    L E +    EL
Sbjct: 338 ERMILLSERCFGLIMAFQFESGA-----------------DDNSR----LHELN----EL 372

Query: 446 IEILQKFGSRCLQNLRKISYIEKQSS-------LFLKWLQEMIFHALDEDHVPKLDTYSN 498
           +  LQ         L+ I Y  ++S+       +FL WL + +   LD+D+ P+L    N
Sbjct: 373 MSNLQDM-------LKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQLSITQN 425

Query: 499 PIICLDLSNFLNKLIVLSTDKNKEDREEDQNPLVNDDDENELFCSMEETTTMLQRINYLS 558
              C  L      L+        ++ ++D   ++N D       ++E+    + R+N   
Sbjct: 426 SNTCYKLGKSFEYLL--------QEGKKDSEDILNFDIIKH---TLEKIEANISRMN--- 471

Query: 559 RSIDEKGIQPTLQQCLYLGPNIQFITEREFDPSKEITVKDVVKVLNGSILLYLLQVKSLD 618
                K I+P L+  + +   I F  +  + P   +TV+D+VK+     +LY++Q+ S+ 
Sbjct: 472 ----TKYIEPILENKIAIDTKIPFF-KANYSPELTVTVRDIVKISQIPYVLYVVQLSSVT 526

Query: 619 SRDL--FYVGTINVVDLKPICHPKLIQFPLTSNEIINITDVQLLTDIKLV 666
              +    VGT N            I    T+ +I+ ++ VQ+  DI ++
Sbjct: 527 PTPINEVRVGTAN------------IDGTSTNEKILPLSVVQMSNDIAVI 564

>YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subunit
           of the Anaphase-Promoting Complex/Cyclosome (APC/C),
           which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors, including mitotic
           cyclins, during the metaphase/anaphase transition;
           component of the platform domain of the APC/C, based on
           structural analysis
          Length = 652

 Score =  216 bits (549), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 168/627 (26%), Positives = 283/627 (45%), Gaps = 90/627 (14%)

Query: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87
           NP FP++ T+ +  +   R  D  +++ I IRN+  V   DWD+ TGK+L+I F DGT R
Sbjct: 13  NPLFPIFATRIAKGLAIYRVSDHARLAVIPIRNINLVANYDWDTTTGKFLSIFFKDGTIR 72

Query: 88  IYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNSIQELEFNHDITKLMPTLI 147
           I+DIF+DG+L++ +R           TK+   IWDR+ +       +F  +I   +P LI
Sbjct: 73  IHDIFKDGRLVSFLRIP--------STKISKGIWDRIPLRYEPNNRDFACNIIDDLPKLI 124

Query: 148 KFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYLDLH 207
           +FVKDS  I IVPY+  +  ++WR               D  D+ +N++       LD+H
Sbjct: 125 RFVKDSKRINIVPYT--QPNSLWR-------------GPDEDDLDSNEK-------LDVH 162

Query: 208 IIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGSIRSLY 267
           ++     D  T+  NG Y + L     N  N N +  I+K    G Y CF+E+G++++L 
Sbjct: 163 VVFNEGNDKITVFFNGDYAVFL--SVDNIENENSLKSIIK-VQDGFYQCFYEDGTVQTLN 219

Query: 268 FSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNGGGN 327
                 S   V LL   M I E+I Y   HL+ IN+ L   + DF+     E     G  
Sbjct: 220 LGPLLQSKSSVNLLNYIMVIKELIGYMLTHLEFINRELATPYLDFVKRLCDEAY---GYG 276

Query: 328 SMXXXXXXXXXXXXXXXXXIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPACEL 387
            +                  +WL  S+GEKN K+WK L  E Y K++QI +L  +PACE 
Sbjct: 277 KLKSELEALFLLGEISCDLEDWLCNSVGEKNFKRWKYLGCEAYQKTVQILTLIFVPACER 336

Query: 388 TLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKILTEFSPSFLELIE 447
            ++  +K  AIL A  I+        +KLS  S  T +E+                 L++
Sbjct: 337 IIIYVEKLRAILQAFSIQ--------NKLSYTSDLTAVEV-----------------LLK 371

Query: 448 ILQKFGSRCLQNLRKISYIEKQSSLFLKWLQEMIFHALDEDHVPKLDTYSNPIICLDLSN 507
             QK  +  L ++  +   E     F  W  + +  ALDED+  K     +     DL +
Sbjct: 372 SSQKLLTMTLNSIIGLGRDETLFEKFFIWFNDRLHEALDEDYKLKFQFEDDLYFGYDLLS 431

Query: 508 FLNKLIVLSTDKNKEDREEDQNPLVNDDDENELFCSMEETTTMLQRINYLSRSIDEKGIQ 567
           + ++++          +  + + +++     +L  SM +          + + I +  + 
Sbjct: 432 YFDRIL--------SKKGTEPSSIIDVKLYRDLINSMSD----------MEKDIAQSNVN 473

Query: 568 PTLQQCLYLGPNIQFITEREFDPSKEITVKDVVKVLNGSILLYLLQVK---------SLD 618
             +QQ + +        ++   PS +I + D +K+   + ++YL+QV          S +
Sbjct: 474 SHIQQHILVDLKTDVFAQKY--PSSQINLLDAIKLPKHNYIVYLIQVTKHNSAQEPFSEE 531

Query: 619 SRDLFYVGTINVVDLKPICHPKLIQFP 645
           ++   Y+GT+   +L  I     ++ P
Sbjct: 532 NKKKLYIGTLKDENLGIISKESSVKIP 558

>TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.270
           YDR118W
          Length = 619

 Score =  215 bits (547), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 140/497 (28%), Positives = 233/497 (46%), Gaps = 68/497 (13%)

Query: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87
           NP + LY  K +  +   R  D  +I+ + +R++  +    WD  TGK +T+ + DG  R
Sbjct: 12  NPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGNAR 71

Query: 88  IYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNSIQELEFNHDITKLMPTLI 147
           IYD FQ GKL+ L+R          KT+VD AIWDR+ +       +F+H +   MP +I
Sbjct: 72  IYDAFQAGKLLALLRIS--------KTRVDGAIWDRIELSRQEVTFKFDHFVLNSMPKMI 123

Query: 148 KFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQE--VEKSMRYLD 205
           +F +D+  I+I+PY    K   WR                   + T +E  V++    LD
Sbjct: 124 RFARDTRQIFILPYEPPNK--TWR-------------------LATEEEDGVKREKEILD 162

Query: 206 LHIIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGSIRS 265
           +H++H  D +   + ++G + + L         ++ +V        G+YHCF+E+ ++ S
Sbjct: 163 VHLVHQED-NGLVLMLDGDFILRLAAGPSGPALKDIVV-----ADRGLYHCFYEDATVES 216

Query: 266 LYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNGG 325
           L           ++L++ F+ I ++  Y Q HLDLI + L+  +T+FL           G
Sbjct: 217 LSLDQLIQCDATIQLIQHFIAIKQLNHYLQDHLDLIKRDLVAPYTEFLTKIC---DAAFG 273

Query: 326 GNSMXXXXXXXXXXXXXXXXXIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPAC 385
              +                   W   ++GEKN KKWK++  E+Y K+IQI +L+ IPAC
Sbjct: 274 YEILHEELESLLLGGGLSVELENWFCYTVGEKNFKKWKKMGLEMYQKTIQILTLSFIPAC 333

Query: 386 ELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKILTEFSPSFLEL 445
           E  +LLS++C A L A++            L  +ST T+              S  F  L
Sbjct: 334 ERVILLSERCRACLKALQ------------LIESSTTTD--------------SSEFANL 367

Query: 446 IEILQKFGSRCLQNLRKISYIEKQSSLFLKWLQEMIFHALDEDHVPKLDTYSNPIICLDL 505
             + Q +    ++ ++ +S  E     FL+W  + +  ALDED+  KL   SN  I   +
Sbjct: 368 TSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKLSIDSNCKIGYQI 427

Query: 506 SNFLNKLIVLSTDKNKE 522
           + +L+  + ++ DK  E
Sbjct: 428 ATYLD--LRINPDKQSE 442

>Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W
           (REAL)
          Length = 648

 Score =  213 bits (542), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 168/627 (26%), Positives = 281/627 (44%), Gaps = 91/627 (14%)

Query: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87
           NP FP++ T+T+  +   R  D  +++ I IRN+  V   +WD+ TGK+L+I F DGT R
Sbjct: 13  NPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIFFKDGTIR 72

Query: 88  IYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNSIQELEFNHDITKLMPTLI 147
           I+DIF+DG+L++ +R           TK+    WDR+ + +        ++I   +P LI
Sbjct: 73  IHDIFKDGRLVSFLRIP--------STKISKGTWDRIPLESESGNGNLAYNIIDYLPKLI 124

Query: 148 KFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYLDLH 207
           ++VKDS  I IVPY+     ++WR                      +++  ++   LD+H
Sbjct: 125 RYVKDSKRINIVPYT--PPNSLWR--------------------GPDEDEPENNEKLDIH 162

Query: 208 IIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGSIRSLY 267
           II     D  T+  NG Y I +    +      + V+ +     G YHCF+++G++R+L 
Sbjct: 163 IIFNEGHDKITVFFNGDYAIFV---PVGADENERFVKSIVKIQDGFYHCFYDDGTVRTLN 219

Query: 268 FSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNGGGN 327
                 S   + +L+  M I E+I Y   H++ IN+ L+  + +F+     E     G +
Sbjct: 220 LGPLLRSEPSMNILKYIMAIKELIGYLLNHIEFINRELVTPYLEFVNRLCDEAY---GYD 276

Query: 328 SMXXXXXXXXXXXXXXXXXIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPACEL 387
            +                  +WL  S+GEKN K+WK L  E Y K+ QI +L  +PACE 
Sbjct: 277 KLISELECLFLLGEVSCDLEDWLCNSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACER 336

Query: 388 TLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKILTEFSPSFLELIE 447
            ++  +K   IL A  I+ K         S++ T  +  L + Q            EL+ 
Sbjct: 337 IIIFVEKLRGILEAFSIQNKFND------SSDLTAVDTLLKNSQ------------ELLT 378

Query: 448 ILQKFGSRCLQNLRKISYIEKQSSLFLKWLQEMIFHALDEDHVPKLDTYSNPIICLDLSN 507
           I        L+++  +   E     F  WL + I   LDED+  K+    +P    DL  
Sbjct: 379 I-------TLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKVQFEDDPYFGYDLLT 431

Query: 508 FLNKLIVLSTDKNKEDREEDQNPLVNDDDENELFCSMEETTTMLQRINYLSRSIDEKGIQ 567
           + +         N  +R  + +P++N     +L  SM +          + + I E  + 
Sbjct: 432 YFH---------NISNRGAETSPVLNMKLYRDLINSMSD----------MEKEIAESNVN 472

Query: 568 PTLQQCLYLGPNIQFITEREFDPSKEITVKDVVKVLNGSILLYLLQV---------KSLD 618
             +QQ + +      +  +E+ PS +I V D VK+   + +LYL+QV          S  
Sbjct: 473 SHIQQHILVESRTD-VYSKEY-PSSQIYVFDAVKLPKHNYILYLIQVTEQKHTQEAPSEG 530

Query: 619 SRDLFYVGTINVVDLKPICHPKLIQFP 645
           S +  Y+GT+   +L  I     I+ P
Sbjct: 531 SIEKLYIGTLKDDNLDVISRESSIKIP 557

>ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {ON}
           weakly similar to uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 599

 Score =  188 bits (478), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 123/486 (25%), Positives = 225/486 (46%), Gaps = 77/486 (15%)

Query: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87
           NP +PLY+ + +      R  D  +I+ II+R+M  V    WD  TGK+L+I + DGT R
Sbjct: 9   NPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYKDGTVR 68

Query: 88  IYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNS---IQELEFNHDITKLMP 144
           IYD F+ G+L++L+R   N           + IWDR+ +L+S   I++   +HD+T++MP
Sbjct: 69  IYDGFRSGRLVSLLRASSN--------GAVSGIWDRIELLHSEENIKDWSIDHDVTEMMP 120

Query: 145 TLIKFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYL 204
            ++KF +DS  + +VPY+     ++WR                       Q  + +   L
Sbjct: 121 KMVKFARDSRQLCVVPYTL--PSDVWRP----------------------QAADDTNALL 156

Query: 205 DLHIIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGSIR 264
           D H+I     D  ++  +G + I++    I +     +V+ +  +    Y  F+++GS+ 
Sbjct: 157 DAHVIRC--HDSLSVMFDGEFTISIQLAAIPS----PLVKFV--SAQHQYLAFYQDGSVE 208

Query: 265 SLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNG 324
               ++       + LL+  + + ++ +Y Q H++LI + LL+ + +FL      +   G
Sbjct: 209 RFDLANLVKDPFSLRLLKNVITMRQLHRYLQDHIELIQRDLLQPYDEFLERCC--QGAFG 266

Query: 325 GGNSMXXXXXXXXXXXXXXXXXIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPA 384
           G + +                  +WL  S+GEKNLK+W++L  + Y K++Q+ +LA +PA
Sbjct: 267 GYDLLREQLIDLMLVGDVTPELEDWLVNSMGEKNLKRWRKLGTDAYHKTLQVLTLACLPA 326

Query: 385 CELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKILTEFSPSFLE 444
           CE  + L Q+C                               L SRQ  +          
Sbjct: 327 CERLISLGQRCTG----------------------------NLLSRQLTLQLPLL----P 354

Query: 445 LIEILQKFGSRCLQNLRKISYIEKQSSLFLKWLQEMIFHALDEDHVPKLDTYSNPIICLD 504
            I+ LQ F    L+ +  +S  ++    FL W  + +  ++DED+  + + + N  +  D
Sbjct: 355 PIDCLQFFLKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYKLRFNLHDNSSLGPD 414

Query: 505 LSNFLN 510
            +++L 
Sbjct: 415 TASYLQ 420

>Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON}
           complement(1..1272) [1272 nt, 424 aa]
          Length = 424

 Score =  183 bits (465), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 112/374 (29%), Positives = 199/374 (53%), Gaps = 27/374 (7%)

Query: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87
           NP F LY+T++   +   R  D  Q+++I I++   V   +WD+ +G+++++   DGT R
Sbjct: 15  NPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLTDGTIR 74

Query: 88  IYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNSIQELEFNHDITKLMPTLI 147
           IYDIF++G+L++ +R          +  VD+ +WDR       +   F+ +I + +PTLI
Sbjct: 75  IYDIFKNGRLVSYIRSS-------SQKNVDSCLWDRAEFSIPSKLQLFDSNIIECLPTLI 127

Query: 148 KFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYLDLH 207
           KFVKDS NI I+ Y           + P  S++ +    D     T++E++     LD+H
Sbjct: 128 KFVKDSRNINIIDY-----------YPPNHSWRHV----DKESQDTDKEID-FRNLLDVH 171

Query: 208 IIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGSIRSLY 267
           I H  + D FTI +NG Y+IN +   +   +++++ ++LK   +G Y  F++NG  R + 
Sbjct: 172 IQHNPNEDNFTIILNGVYEINGI--VMPDISKSEVYQLLK-LHNGEYMSFYKNGHYRKIN 228

Query: 268 FSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNGGGN 327
           F++  S  +   LL   +EI  + +Y   HLDLI + L+  ++DF+   I  +   GG  
Sbjct: 229 FNNLLSCNVSNGLLSNILEIRNLNRYVNDHLDLIKRELIIPYSDFV-KKICIDAYAGGMT 287

Query: 328 SMXXXXXXXXXXXXXXXXXIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPACEL 387
            +                  +WL   IG++N KKW++L  +++ K ++I +LA+IP+CE 
Sbjct: 288 KLNDELESLLLTGEINNEFKDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCER 347

Query: 388 TLLLSQKCLAILNA 401
            ++  ++    LN 
Sbjct: 348 FMIYLERTDGYLNG 361

>TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8.270
           YDR118W
          Length = 685

 Score =  159 bits (401), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 115/409 (28%), Positives = 205/409 (50%), Gaps = 49/409 (11%)

Query: 14  HRDEQWNFAPISYINPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKT 73
           H D Q  +  +   NP + LY  K+   +      D   ++ I I++   V+   WDS T
Sbjct: 4   HSDSQLYYYKL---NPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSIT 60

Query: 74  GKYLTINFDDGTFRIYDIFQDGKLITLVR-PQRNLLDIHRKTKVDNAIWDRLIILNSI-Q 131
           GK+L   F+DG+ R+YDIF+ G+L++  R P + +  ++         WDR+II  ++ Q
Sbjct: 61  GKFLLFAFNDGSIRVYDIFKLGRLVSFFRSPLKQIKCVY---------WDRIIITETLDQ 111

Query: 132 ELE-FNHDITKLMPTLIKFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAID 190
           +L+ F++D+T  MPTL+KFVKD   + +VP   N +   WR+                ID
Sbjct: 112 QLKIFDYDLTNSMPTLVKFVKDPQGLQLVPVLKNTQA--WRQ----------------ID 153

Query: 191 MTTNQEVEKSMR------YLDLHIIHVIDP-DCFTIAINGTYQINLVRKTINTTNR--NK 241
           +  N ++E S         LD+H+++     D F + +NG Y ++     I+  NR  NK
Sbjct: 154 VDLNLKLENSKTEVSTDDVLDIHLLYTESGMDNFAVLVNGVYDLS----DIHVPNRSPNK 209

Query: 242 IVRILKSTVHGVYHCFHENGSIRSLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLI 301
           +++++K++  G Y  F+EN S R +  + F+S+ + V LL   +++   +   +  +++I
Sbjct: 210 VIKLVKAS-QGKYLGFYENASYRLIDVTPFSSNDIRVNLLNNSIDLRNSVSLLKEQIEII 268

Query: 302 NKHLLKTFTDFLYPTIFEEKQNGGGNSMXXXXXXXXXXXXXXXXXIEWLTLSIGEKNLKK 361
            K L+  F  F+     +  +  G +++                  +WL  +IGE+NL+K
Sbjct: 269 KKELISPFESFINLVCVDAYE--GYDNLYRSMTNLLLTGEISEEFEDWLINTIGERNLRK 326

Query: 362 WKRLSEELYSKSIQIFSLALIPACELTLLLSQKCLAILNAIEIEKKARI 410
           WK L  EL  K +QI SL  IP  E  ++ +++    + A+ +   ++I
Sbjct: 327 WKNLGIELLDKLVQILSLIFIPITEKFIITAERIQNYITAMRLSDNSKI 375

>KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {ON}
           Anc_8.270 YDR118W
          Length = 622

 Score =  156 bits (394), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 112/467 (23%), Positives = 211/467 (45%), Gaps = 62/467 (13%)

Query: 27  INPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTF 86
           +N   PLY+T+ +  ++  R  D   I++  IR+   V++  WD+  G+ +++ F DG+ 
Sbjct: 15  VNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQDGSI 74

Query: 87  RIYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNSIQELEFNHDI-TKLMPT 145
           RI D+  D KL+ L+R QR        T +D  +WDR+ + +  Q +E++ DI T+ +P 
Sbjct: 75  RINDVMYDAKLVALLRTQR--------TGLDCVLWDRIRLPSRAQSMEWDPDIITQSLPR 126

Query: 146 LIKFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYLD 205
           L+KF+    +  + PY        WR         P S     I              LD
Sbjct: 127 LVKFMGSDASPSMSPYLPTNHS--WR--------FPNSGAAGGI--------------LD 162

Query: 206 LHIIHVIDPDCFTIAINGTYQINLVRK-TINTTNRNKIVRILKSTVHGVYHCFHENGSIR 264
           +H +H    D     +NG YQ+ L      + +   KI+    S  H VY+C+++ G +R
Sbjct: 163 VHFLHQKLGDTLVALLNGEYQLQLTGPHQEDQSELRKIIARTDSKRH-VYNCYYKTGPVR 221

Query: 265 SLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNG 324
            +  + F      ++LLE F+   + + YF  HL+ I    ++ + +F+       +   
Sbjct: 222 QVDLTGFVEDKDTIKLLERFLLFQDYLGYFLAHLEPIQTECVEPYQEFIERLC---EDAF 278

Query: 325 GGNSMXXXXXXXXXXXXXXXXXIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPA 384
           G   +                  +WL  S+GE+NL++WK L    Y ++ Q+  + L+P 
Sbjct: 279 GKEKLQESLTDHFLVGSMDEELRDWLVYSLGERNLEEWKSLMNTAYRRTSQVVLMCLVPV 338

Query: 385 CELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKILTEFSPSFLE 444
            E  ++L ++  A++              ++LS      ++E++             F +
Sbjct: 339 SERLIILCEQLQALV------------LTAQLSEGMVGDSLEIS------------EFTD 374

Query: 445 LIEILQKFGSRCLQNLRKISYIEKQSSLFLKWLQEMIFHALDEDHVP 491
           L+E  Q+     LQ +++++   K   +FL WL+ ++   +++D+ P
Sbjct: 375 LLENCQELLQLVLQTVKQLAKDIKDIKVFLLWLENVLKTTINKDYPP 421

>CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly
           similar to uniprot|Q04601 Saccharomyces cerevisiae
           YDR118w APC4 subunit of the anaphase promoting complex
          Length = 622

 Score =  134 bits (337), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 112/386 (29%), Positives = 182/386 (47%), Gaps = 44/386 (11%)

Query: 28  NPSFPLY-LTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTF 86
           NP + L+ + + ++S++ RRT D   I  I +RN+  ++   WD   GKYL +   DG+ 
Sbjct: 14  NPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFLKDGSV 73

Query: 87  RIYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNS-IQELEF-NHDITKLMP 144
           RIYDIF  GKLI+ +R    +L    K  +D  +WDR+II  S   EL   N+D+T+ MP
Sbjct: 74  RIYDIFNGGKLISFLRVLPVVLG-SNKPSLDCCLWDRIIIPKSGSSELRIPNNDLTESMP 132

Query: 145 TLIKFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYL 204
           TL+KFV+D+  I I+P     K  +WR          I  N            EK  + +
Sbjct: 133 TLVKFVQDAKQIDIIPNRSITK--LWR---------SIGNN------------EK--KVV 167

Query: 205 DLHIIHVIDPDCFTIAINGTYQINLVRKTINTTN--RNKIVRIL--KSTVHGVYHCFHEN 260
           D+H+ +       TI ING Y   L+ K+++  N  + KI   L  K     +Y    ++
Sbjct: 168 DVHLGYSCSSAQVTILINGEY---LIEKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDD 224

Query: 261 GSIRSLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEE 320
            S   +  +    +   ++L+E  +++       + H +LI K +L  + +FL       
Sbjct: 225 YSRLQIDLTGILLNDDKLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESI---- 280

Query: 321 KQNGGGNSMXXXXXXXXXXXXXXXXXIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLA 380
              GG N +                   W   +I EKNLKKW RL  E YS   Q+  + 
Sbjct: 281 ---GGINDLDVLERLFLIGELDTKLG-NWFKETINEKNLKKWSRLGNEFYSNFKQVLIIV 336

Query: 381 LIPACELTLLLSQKCLAILNAIEIEK 406
            +P CE  ++L+ +   ++  I++++
Sbjct: 337 FVPICERLMVLTNRINGMIKGIDLQE 362

>TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON}
           Anc_8.270 YDR118W
          Length = 608

 Score =  134 bits (336), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 100/385 (25%), Positives = 169/385 (43%), Gaps = 40/385 (10%)

Query: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87
           NP+ PL L K+ + +   RT D   I N  IRN  ++I   W++  G Y+ I F  GT  
Sbjct: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72

Query: 88  IYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNSIQELEFNHDITKLMPTLI 147
           IYD  +  +L+ ++           K  VD  IWDR    N  ++  F+ DIT  MPTLI
Sbjct: 73  IYDGIKTSRLLAMLNGG--------KPNVDAGIWDRYYFPNDNEKDIFDSDITLYMPTLI 124

Query: 148 KFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYLDLH 207
           + ++D     I P ++    + WR                       +E      +LD+H
Sbjct: 125 QIIRDKEK--ICPGTYFPPHSTWR---------------------AKKEESLKNEFLDIH 161

Query: 208 IIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGSIRSLY 267
           ++H    D FT  +NG  ++ L   + +T+ R   + I+K   +  + CF+++ ++R + 
Sbjct: 162 LLHHSVDDSFTFILNG--ELKLPFPSNSTSGR--AIGIIKGE-NNCFICFYQDLTVRMID 216

Query: 268 FSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNGGGN 327
                    +  L++ F+ IN ++KY + H+  I  ++   F +FL     E  Q     
Sbjct: 217 CHDLLQLKGNEILVDHFIRINHLLKYLKEHIMFIKDNMSTPFNEFLTSVKGEATQ----E 272

Query: 328 SMXXXXXXXXXXXXXXXXXIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPACEL 387
            M                  EW+  +IG KNL +W  L    Y K + I +L +IPACE 
Sbjct: 273 MMMENLITMLVSGYISTELEEWIRNTIGIKNLTRWATLGGIFYEKGVDIITLMVIPACER 332

Query: 388 TLLLSQKCLAILNAIEIEKKARIRA 412
            ++L  +   ++  + +  +   R 
Sbjct: 333 FMILVARLQGLIEYVIVRNRCDNRG 357

>KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C)
          Length = 645

 Score =  110 bits (274), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 110/487 (22%), Positives = 197/487 (40%), Gaps = 76/487 (15%)

Query: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87
           NP   LYL     ++   R +DG +I+ + +R    +I   W+   GK   + F +G  R
Sbjct: 22  NPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNGAVR 81

Query: 88  IYDIFQDGKLITLVRPQRNLLDIHRKTK--VDNAIWDRLIILNSIQELE-FNHDITKLMP 144
           IYD    G L  +V    +L+D  +     VD A+W         QE +  N +ITK +P
Sbjct: 82  IYDCATGGSLREVV----DLVDEGQSADVTVDTAVWSGAQWAQFRQEYKGLNIEITKQLP 137

Query: 145 TLIKFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYL 204
            +++ V+D+  + +VP    +     R          I    D          EKS  YL
Sbjct: 138 GMVRLVRDAKQLSVVPLETGKL----RWLADPGKDAAIFLGHD----------EKSGDYL 183

Query: 205 DLHIIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGSIR 264
                         + ++G   + +       +   K+ +IL+    G +     +G+++
Sbjct: 184 --------------MTVDGLLSVRV------PSGIKKMHKILRQGEDGTFVGVGADGTVQ 223

Query: 265 SLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNG 324
            +    F +S L  EL+    +I  +  Y   ++++    L++ +  FL  T   +   G
Sbjct: 224 WVVL-RFLNSALMRELIRYSGQIRFLCSYLTENINMCKTDLIEPYRQFL--TRIADAYEG 280

Query: 325 GGNSMXXXXXXXXXXXXXXXXXIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPA 384
           G   +                  +WL  SIG+KN K+WK+LS  +Y     + +LA+IPA
Sbjct: 281 G--ELASRFRDIILSGYIPEDLEDWLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPA 338

Query: 385 CELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKILTEF-SPSFL 443
           CE  +L +++   I   +++++                    L S Q     EF S    
Sbjct: 339 CERLILAAEQLQGIHKGLKLQE------------------FGLASPQ-----EFESAEVT 375

Query: 444 ELIEILQKFGSRCLQNLRKISYIEKQSSLFLKWLQEMIFHALDEDHV-PK-----LDTYS 497
           ELI   Q      L+ +  ++   +  ++F  W  +++   +DED+  P+      D Y 
Sbjct: 376 ELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDEDYKRPQNRDSHQDCYG 435

Query: 498 NPIICLD 504
           +  + LD
Sbjct: 436 DRALALD 442

>Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {ON}
           YDR118W (APC4) - subunit of the anaphase promoting
           complex (APC) [contig 173] FULL
          Length = 740

 Score =  108 bits (269), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 103/467 (22%), Positives = 198/467 (42%), Gaps = 72/467 (15%)

Query: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87
           NP   LYL  T   I   R +DG QI+ + +R+   ++ I W+    K   +   +G  R
Sbjct: 22  NPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGVVR 81

Query: 88  IYDIFQDGKLITLVRPQRNLLDIHR--KTKVDNAIW---DRLIILNSIQELEFNHDITKL 142
           IYD    G L  +V    NL++  +  + KVD  +W   +      S + L+F  DIT L
Sbjct: 82  IYDCSIGGSLREMV----NLVEEGQAAEVKVDAVVWMTVEWAKFPESYRGLDF--DITTL 135

Query: 143 MPTLIKFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMR 202
           MP +++ V+DS  + + P                            +D+     ++    
Sbjct: 136 MPGMVRLVRDSKQLSLAP----------------------------LDLGKLSWLDGKYG 167

Query: 203 YLDLHIIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGS 262
              + + H  +   + +AI+G   +       N      + +IL     G +    ++G+
Sbjct: 168 DAAIFLAHDCESTEYMVAIDGQLSLRFPSGIRN------VHKILPQGGSGSFLAVGKDGT 221

Query: 263 IRSLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQ 322
           ++ +    F    L  EL++   +I  + +Y   ++ L +  L++ +  FL   +   + 
Sbjct: 222 LQWVTLK-FLECALMRELVKSSGQIRFLCRYLAENVSLCHTELIEPYRVFLTRLMGAYE- 279

Query: 323 NGGGNSMXXXXXXXXXXXXXXXXXIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALI 382
              G+ +                  EWL  S+G+KN K+WK+LS  +Y     + +LA++
Sbjct: 280 ---GDDLATRLRDILLTGYIPDDLEEWLCNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVV 336

Query: 383 PACELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKILTEFSPSF 442
           PACE  +L +++   I  ++++++  +  A  +L+T    T I     + + L EF+   
Sbjct: 337 PACERLILAAERMQGIHKSLKLQRFCKDYA-GELTTVELQTLIS----ECQTLLEFT--- 388

Query: 443 LELIEILQKFGSRCLQNLRKISYIEKQSSLFLKWLQEMIFHALDEDH 489
           L LI  L +  +     L ++         F +W  +++   +DED+
Sbjct: 389 LNLITELNRDAA-----LHQV---------FAEWFYDVVMETVDEDY 421

>SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 644

 Score =  106 bits (264), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 99/483 (20%), Positives = 201/483 (41%), Gaps = 72/483 (14%)

Query: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87
           NP   L+L  T   I   R +DG +I+ + +++   ++   W+   G+   +   +G  R
Sbjct: 21  NPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNGIIR 80

Query: 88  IYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNSIQELEFNHDITKLMPTLI 147
           +YD    GK +  V    +  D+ +     ++ W      +++    F+H+IT LMP L+
Sbjct: 81  LYDSSLAGKSVGSVILGDSDCDVLKFCWSQDS-WTFGSKFSNV----FDHEITSLMPRLV 135

Query: 148 KFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYLDLH 207
           KFVKDS  + ++P    +          V  +  +  N   I +  + + +K +      
Sbjct: 136 KFVKDSRQLTMLPTDVGDG---------VPRWSKLDGNKSFIFLGYDSKRQKIL------ 180

Query: 208 IIHVIDPDCFTIAINGTYQINL-VRKTINTTNR--------NKIVRILKSTVHGVYHCFH 258
                      +AI+G ++++  V   +    R        N +  ILK   +G Y    
Sbjct: 181 -----------MAIDGAFKLSFSVAALVAAGERLDEGDSVPNNVRDILKYD-NGEYLVIT 228

Query: 259 ENGSIRSLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIF 318
           ++  I+ + F  F +  L  E++     I  + K     + L+   L++ +T F+     
Sbjct: 229 DDWYIQKIKFD-FLNCNLTREMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFI----- 282

Query: 319 EEKQNGGGNSMXXXXXXXXXXXXXXXXXIE-WLTLSIGEKNLKKWKRLSEELYSKSIQIF 377
            E+  G                      +E WL+ +IG+KNL++WK+LS  +Y  +++I 
Sbjct: 283 -ERVLGAYEGDLIGDLTELLFTGSVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIM 341

Query: 378 SLALIPACELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKILTE 437
            L ++P CE  +L  ++   I+  +++           +       N+E+   Q      
Sbjct: 342 VLTMVPVCERLILCGERLHGIIKGLKL-----------IGLKELEDNLEVLEAQ------ 384

Query: 438 FSPSFLELIEILQKFGSRCLQNLRKISYIEKQSSLFLKWLQEMIFHALDEDHVPKLDTYS 497
                 +L+ + Q+     + ++++I+        F+ W  +M+  A+DED+  K     
Sbjct: 385 ------KLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHDMVMEAVDEDYKRKTSYNC 438

Query: 498 NPI 500
           +P+
Sbjct: 439 DPL 441

>Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AGR078C
          Length = 715

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 37/187 (19%), Positives = 81/187 (43%), Gaps = 9/187 (4%)

Query: 219 IAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGSIRSLYFSHFTSSTLHV 278
           ++I+GT+      K    T   K+  IL    +       E+  ++ +      S  +H 
Sbjct: 193 VSIDGTFNFRYGEKNKFPT---KVTNILSGNANNYVFLNDEDWQLQIIKLEFTESHQMH- 248

Query: 279 ELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNGGGNSMXXXXXXXXX 338
           EL++   +I  ++KY + +  +I   L++    F+  ++F ++Q    + +         
Sbjct: 249 ELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFIN-SLFPDEQ---ASRLLKGLKDVFY 304

Query: 339 XXXXXXXXIE-WLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPACELTLLLSQKCLA 397
                   IE W TL +G   +  WK+ +   +S S  I    +IPACE  ++  ++   
Sbjct: 305 LGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVKRLQG 364

Query: 398 ILNAIEI 404
           ++ ++++
Sbjct: 365 LIKSLKL 371

>AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR118W
           (APC4)
          Length = 715

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 71/406 (17%), Positives = 153/406 (37%), Gaps = 62/406 (15%)

Query: 17  EQWNFAPISYINPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQN--VIAIDWDSKTG 74
           +QW+     + N    L+       +   R +DG ++  I +R  QN  ++   W+   G
Sbjct: 10  KQWDGKLEPFWNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELLRCQWEPDDG 69

Query: 75  KYLTINFDDGTFRIY---------DIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLI 125
           +   +    G+ +IY         +  +  +L+  V     +L      +++  +W+R  
Sbjct: 70  ELFAVALRSGSVKIYRGRLDPEGTEGSEGAELVGTV-----VLGRGDAFQMEQFVWNR-- 122

Query: 126 ILNSIQEL---EFNHDITKLMPTLIKF-VKDSTNIYIVPYSHNEKQNIWREFQPVSSYKP 181
           I   ++E    EF+  + + +P L +  +     +   P  +   +  W           
Sbjct: 123 IKWRVREPFCGEFDSPLVQWLPRLTEMSISAQGKLLCTPLGYEGPE--WN--------AG 172

Query: 182 ISTNMDAIDMTTNQEVEKSMRYLDLHIIHVIDPDCFTIAINGTYQINLVRKTINTTNRNK 241
           ++ +   + +T +    K                   ++I+GT+      K+   T   K
Sbjct: 173 LAADESNMFLTFDNNTRK-----------------VVLSIDGTFNFRYGEKSKFPT---K 212

Query: 242 IVRILKSTVHGVYHCFHENGSIRSLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLI 301
           +  IL    +       E+  ++ +         +H EL++    I  ++KY + +  LI
Sbjct: 213 VTSILPGNENHYVFINDEDWQLQVIRLEFTEYHQVH-ELMKCCSHIQFLLKYIRDNHRLI 271

Query: 302 NKHLLK---TFTDFLYPTIFEEKQNGGGNSMXXXXXXXXXXXXXXXXXIEWLTLSIGEKN 358
              L++   TFT  L+P   EE+       M                   W TL +G   
Sbjct: 272 GTKLMEPHATFTGSLFP---EEQFT---KFMKGLKDVFYLGYSDDKTVENWFTLKLGRHG 325

Query: 359 LKKWKRLSEELYSKSIQIFSLALIPACELTLLLSQKCLAILNAIEI 404
              WK+ +   +S S  +    +IPACE  ++ +++ L ++ ++++
Sbjct: 326 TAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAKRLLGLVKSLKL 371

>Kpol_1018.107 s1018 complement(282640..286023) [3384 bp, 1127 aa]
            {ON} complement(282640..286023) [3384 nt, 1128 aa]
          Length = 1127

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 38/68 (55%), Gaps = 7/68 (10%)

Query: 475  KWLQEMIFHALDED-HVPKLDTYSNPIICLDLSNFLNKLIVLSTDKNKEDREEDQNPLVN 533
            +W+  +I  ++D D +VP + +YS P + L      NK   + +   +E R  ++N  +N
Sbjct: 960  EWMAALIKTSIDIDTNVPVVSSYSTPTVSL------NKAQEMLSQAREETRLREENKFLN 1013

Query: 534  DDDENELF 541
            ++DE++L 
Sbjct: 1014 EEDEDQLL 1021

>ZYRO0E01496g Chr5 complement(108148..110756,110823..110847) [2634
           bp, 877 aa] {ON} similar to uniprot|P37296 Saccharomyces
           cerevisiae YMR054W STV1 Subunit of vacuolar-ATPase V0
           domain one of two isoforms (Stv1p and Vph1p) Stv1p is
           located in V- ATPase complexes of the Golgi and
           endosomes while Vph1p is located in V-ATPase complexes
           of the vacuole
          Length = 877

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 46/94 (48%), Gaps = 18/94 (19%)

Query: 212 IDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHE-----NGSIRSL 266
           ++ DCF +  +G Y +  V++ +++ N  ++V +         HC H      N  I  +
Sbjct: 283 VEKDCFFVFTHGEYLLQKVQRVVDSLN-GRVVSLA--------HCTHREIQKLNDRISEI 333

Query: 267 -YFSHFTSSTLHVELLEIFMEI---NEMIKYFQY 296
              ++ T STLH ELL +  ++   N M+K  +Y
Sbjct: 334 QQIAYATESTLHAELLVVSDQLPVWNAMVKREKY 367

>Suva_10.191 Chr10 complement(353936..368659) [14724 bp, 4907 aa] {ON}
            YLR106C (REAL)
          Length = 4907

 Score = 32.0 bits (71), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 72/150 (48%), Gaps = 21/150 (14%)

Query: 441  SFLELIEILQKFGSRCLQNLRKIS-YIEKQSSLFLKWLQEMIFHALDEDHVPKLDTYSNP 499
            S LE   +L++ G    QN+ ++S  + K+ S+  +W   M+  A+++ H   LD   N 
Sbjct: 2162 SHLEEHSLLKQIG----QNIEEMSDIVNKEVSVRFEWFDGMLVKAVEKGHWLILD---NA 2214

Query: 500  IICLDLSNFLNKL-IVLSTDKN---KEDREEDQNPLVNDDDEN-ELFCSMEETTTMLQRI 554
             +C    + L++L  +L TD +    E  +ED  P V     N  LF +M+       R 
Sbjct: 2215 NLCS--PSVLDRLNSLLETDGSLLINECSQEDGQPRVIKPHPNFRLFLTMD------PRY 2266

Query: 555  NYLSRSIDEKGIQPTLQQCLYLGPNIQFIT 584
              LSR++  +G++  +++  Y   N   +T
Sbjct: 2267 GELSRAMRNRGVEIYMEELNYRSTNFDSLT 2296

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,975,081
Number of extensions: 3601116
Number of successful extensions: 15295
Number of sequences better than 10.0: 55
Number of HSP's gapped: 15684
Number of HSP's successfully gapped: 61
Length of query: 735
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 618
Effective length of database: 40,065,477
Effective search space: 24760464786
Effective search space used: 24760464786
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 70 (31.6 bits)