Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0J010308.318ON65265227280.0
NCAS0B035608.318ON58635012121e-159
YLR120C (YPS1)8.318ON5693539691e-123
Smik_12.1868.318ON5723529661e-122
Suva_10.2118.318ON5663519631e-122
Skud_12.1928.318ON5693499541e-120
KNAG0I009108.318ON5693579491e-120
KAFR0B057108.318ON5753379481e-119
YDR144C (MKC7)8.318ON5963579261e-116
Skud_4.4038.318ON5903629251e-116
Skud_12.1938.319ON4973509111e-115
Suva_2.3058.318ON5973479191e-115
Kwal_26.7254singletonON5703529131e-114
TPHA0A015808.318ON6003459141e-114
CAGL0M04191g8.318ON6013469131e-114
YLR121C (YPS3)8.319ON5083499031e-114
Smik_4.3888.318ON5973519091e-113
Smik_12.1878.319ON5073498991e-113
Kpol_543.618.318ON5883429061e-113
KNAG0G024108.318ON5303608961e-112
SAKL0H15664g8.318ON5563568971e-112
TBLA0H012908.318ON6674188741e-107
NCAS0C033008.318ON5593478561e-106
KAFR0H023008.318ON5214218491e-105
NDAI0G026208.318ON5903498541e-105
Suva_10.2128.319ON7453548651e-105
TBLA0E02630singletonON6893448521e-104
TDEL0F044508.318ON5243378321e-103
KAFR0B06530singletonON5383528141e-100
Ecym_42518.318ON5023517974e-98
KLLA0E04049g8.318ON5893498011e-97
ZYRO0F10274gsingletonON5723487948e-97
ZYRO0G02904gsingletonON5313437856e-96
KLTH0G12386g8.318ON5803477834e-95
TBLA0A039108.318ON5963327741e-93
Kwal_56.239028.318ON6293507733e-93
ZYRO0F10230g8.318ON5803427478e-90
KNAG0E03220singletonON5403707309e-88
KAFR0I01700singletonON5523627249e-87
AGL192W8.318ON4993457182e-86
ZYRO0F10318g8.319ON4863607092e-85
ZYRO0F10252gsingletonON5513447116e-85
TBLA0D00140singletonON6073767131e-84
SAKL0C02970gsingletonON5923767093e-84
KNAG0I009008.319ON5313616564e-77
CAGL0E01793gsingletonON5163606512e-76
KAFR0E03940singletonON6383466557e-76
CAGL0E01419g8.318ON5913886465e-75
CAGL0E01837gsingletonON5213606363e-74
KLTH0F06754gsingletonON7673376495e-74
CAGL0E01815gsingletonON5194216337e-74
Kwal_33.14239singletonON6513386392e-73
CAGL0E01749gsingletonON4823626239e-73
CAGL0E01771gsingletonON5193596196e-72
KNAG0I01200singletonON6773466211e-70
CAGL0E01859gsingletonON5053606021e-69
SAKL0F07172g7.182ON5422975771e-65
CAGL0E01881gsingletonON5083525322e-59
NCAS0A124607.182ON5403305323e-59
TPHA0C008408.318ON10003465495e-59
ZYRO0E02266gsingletonON5063455286e-59
YIR039C (YPS6)singletonON5373405281e-58
ZYRO0F10296gsingletonON5283315235e-58
Smik_65.1singletonON3423215061e-57
CAGL0E01727gsingletonON5393625192e-57
Suva_9.13singletonON4643325124e-57
Suva_16.14singletonON5403475089e-56
KAFR0B06700singletonON5313394876e-53
Suva_34.1singletonON3873364751e-52
KLLA0D15917g7.182ON5112974752e-51
Smik_9.1757.182ON5933494713e-50
ZYRO0D15554g7.182ON5213514664e-50
YIL015W (BAR1)7.182ON5873524634e-49
NDAI0B017207.182ON5473834596e-49
Skud_9.1547.182ON5163494569e-49
TDEL0H026507.182ON5523574518e-48
Ecym_43947.182ON5182954481e-47
SAKL0E15356gsingletonON5573474465e-47
KNAG0H027607.182ON5633534431e-46
CAGL0J02288g7.182ON5413404351e-45
Smik_5.7singletonON3042433541e-36
AGR240W7.182ON4523003604e-36
Suva_79.1singletonON2272053225e-33
SAKL0H00330gsingletonON5783373062e-28
TBLA0D045807.182ON3953152965e-28
Kpol_1063.227.182ON3362282704e-25
ZYRO0F07392g8.677ON4183172497e-22
TBLA0B038308.677ON4133182461e-21
Kwal_26.88028.677ON4123182425e-21
KLTH0D11264g8.677ON4173182409e-21
KNAG0J017108.677ON4153192329e-20
SAKL0H06512g8.677ON4043082292e-19
Smik_6.3518.677ON4053212231e-18
NDAI0E021058.677ON4083112221e-18
Kpol_1013.68.677ON4023062222e-18
Skud_16.1288.677ON4053212222e-18
YPL154C (PEP4)8.677ON4053182212e-18
NCAS0C013608.677ON4063182212e-18
ACR144W8.677ON4083192194e-18
KLLA0D05929g8.677ON4093082142e-17
Suva_9.1877.182ON3331862093e-17
Ecym_23968.677ON4152972123e-17
Smik_5.6singletonON123951954e-17
TPHA0D012608.677ON4193192114e-17
Suva_16.1568.677ON4063182105e-17
Suva_9.186singletonOFF5431922063e-16
KLLA0F22088g5.401ON5583032054e-16
TDEL0A062308.677ON4083101946e-15
Kpol_1072.158.677ON3993011892e-14
KAFR0H024208.677ON4163051794e-13
TPHA0E019205.401ON6243591717e-12
TDEL0E022305.401ON5732951635e-11
TBLA0H016805.401ON6092261611e-10
AGR407CsingletonON2682941551e-10
NDAI0C046105.401ON6092221592e-10
CAGL0M02211g8.677ON4153171572e-10
Ecym_13245.401ON5763471582e-10
Skud_4.6185.401ON5862371573e-10
YDR349C (YPS7)5.401ON5962801564e-10
Suva_62.1singletonON2521041488e-10
Suva_2.5205.401ON5982051521e-09
ACR143WsingletonON3933051511e-09
ZYRO0A06578g5.401ON7202851521e-09
SAKL0G07524g5.401ON6322791502e-09
KLTH0E02596g5.401ON5962811493e-09
Smik_4.6135.401ON5962971422e-08
CAGL0A02431g5.401ON5873221394e-08
ACR150W5.401ON5532221332e-07
Kwal_55.200345.401ON5932301332e-07
KNAG0C051405.401ON5983551281e-06
KAFR0E040805.401ON5963151217e-06
Smik_67.1singletonON110841045e-05
YGL258W-AsingletonON77481016e-05
YGL259W (YPS5)singletonON165861032e-04
Kpol_1059.335.401ON6622831082e-04
NCAS0F031505.401ON6452261064e-04
TPHA0E038101.29ON743131752.2
Ecym_4614na 1ON481110715.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0J01030
         (652 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON}            1055   0.0  
NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {O...   471   e-159
YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON} ...   377   e-123
Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {...   376   e-122
Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {...   375   e-122
Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {...   372   e-120
KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON}              370   e-120
KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa] ...   369   e-119
YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}  ...   361   e-116
Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON...   360   e-116
Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {...   355   e-115
Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON...   358   e-115
Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C...   356   e-114
TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.3...   356   e-114
CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa] ...   356   e-114
YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON} ...   352   e-114
Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON...   354   e-113
Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {...   350   e-113
Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {O...   353   e-113
KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {O...   349   e-112
SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} simi...   350   e-112
TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.3...   341   e-107
NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON}              334   e-106
KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.3...   331   e-105
NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A   333   e-105
Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {...   337   e-105
TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {O...   332   e-104
TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {O...   325   e-103
KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON}            318   e-100
Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}...   311   4e-98
KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} simila...   313   1e-97
ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {...   310   8e-97
ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} simila...   306   6e-96
KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} simi...   306   4e-95
TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {O...   302   1e-93
Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {...   302   3e-93
ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {...   292   8e-90
KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {O...   285   9e-88
KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {O...   283   9e-87
AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic ho...   281   2e-86
ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {...   277   2e-85
ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {...   278   6e-85
TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON}                279   1e-84
SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some s...   277   3e-84
KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON}              257   4e-77
CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {...   255   2e-76
KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON}              256   7e-76
CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} simila...   253   5e-75
CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {...   249   3e-74
KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly...   254   5e-74
CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {...   248   7e-74
Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144...   250   2e-73
CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {...   244   9e-73
CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {...   243   6e-72
KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON}              243   1e-70
CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {...   236   1e-69
SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {...   226   1e-65
CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} simila...   209   2e-59
NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa] ...   209   3e-59
TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8....   216   5e-59
ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {...   207   6e-59
YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}  ...   207   1e-58
ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {...   206   5e-58
Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)       199   1e-57
CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} simila...   204   2e-57
Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)   201   4e-57
Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C (...   200   9e-56
KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa] ...   192   6e-53
Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR0...   187   1e-52
KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]...   187   2e-51
Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W ...   186   3e-50
ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]...   184   4e-50
YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspart...   182   4e-49
NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {O...   181   6e-49
Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W ...   180   9e-49
TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.1...   178   8e-48
Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar t...   177   1e-47
SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weak...   176   5e-47
KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.1...   175   1e-46
CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa] ...   172   1e-45
Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)       140   1e-36
AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic ...   143   4e-36
Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C...   128   5e-33
SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON...   122   2e-28
TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa] ...   118   5e-28
Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON} (50979....   108   4e-25
ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly...   100   7e-22
TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {O...    99   1e-21
Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C...    98   5e-21
KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly...    97   9e-21
KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8....    94   9e-20
SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {...    93   2e-19
Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C ...    91   1e-18
NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}     90   1e-18
Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON} (10059.....    90   2e-18
Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {...    90   2e-18
YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON} ...    90   2e-18
NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {O...    90   2e-18
ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic ho...    89   4e-18
KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly...    87   2e-17
Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W ...    85   3e-17
Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}...    86   3e-17
Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)        80   4e-17
TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.6...    86   4e-17
Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {...    86   5e-17
Suva_9.186 Chr9 (310161..310220,310267..310332,310362..310451,31...    84   3e-16
KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weak...    84   4e-16
TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON} Anc_8...    79   6e-15
Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {O...    77   2e-14
KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {O...    74   4e-13
TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.4...    70   7e-12
TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.4...    67   5e-11
TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.4...    67   1e-10
AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON} ...    64   1e-10
NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa] ...    66   2e-10
CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa] ...    65   2e-10
Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}...    65   2e-10
Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {...    65   3e-10
YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}...    65   4e-10
Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C...    62   8e-10
Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON...    63   1e-09
ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic ho...    63   1e-09
ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} simila...    63   1e-09
SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} simila...    62   2e-09
KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly...    62   3e-09
Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {...    59   2e-08
CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {...    58   4e-08
ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic ho...    56   2e-07
Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349...    56   2e-07
KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5....    54   1e-06
KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.4...    51   7e-06
Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)        45   5e-05
YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protei...    44   6e-05
YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein wit...    44   2e-04
Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON} (70588....    46   2e-04
NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {O...    45   4e-04
TPHA0E03810 Chr5 (802496..804727) [2232 bp, 743 aa] {ON} Anc_1.2...    33   2.2  
Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {O...    32   5.7  

>NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON} 
          Length = 652

 Score = 1055 bits (2728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/652 (81%), Positives = 534/652 (81%)

Query: 1   MKIPSILRDXXXXXXXXXXXXXXXKNVIATTSIPSQQEQNKKQGEASENQPAPTLKYVKL 60
           MKIPSILRD               KNVIATTSIPSQQEQNKKQGEASENQPAPTLKYVKL
Sbjct: 1   MKIPSILRDTILTTTSSLLLLSTIKNVIATTSIPSQQEQNKKQGEASENQPAPTLKYVKL 60

Query: 61  PFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPPQHVT 120
           PFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPPQHVT
Sbjct: 61  PFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPPQHVT 120

Query: 121 VLVDTGSADLWVTGSMNPFCQSSLNSRNVVIKRXXXXXXXXXXXXTQQAAGMFTEILVTX 180
           VLVDTGSADLWVTGSMNPFCQSSLNSRNVVIKR            TQQAAGMFTEILVT 
Sbjct: 121 VLVDTGSADLWVTGSMNPFCQSSLNSRNVVIKRDDDDDDDDDDDDTQQAAGMFTEILVTN 180

Query: 181 XXXXXXXXXXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDIPRSER 240
                        F                                      NDIPRSER
Sbjct: 181 LSDLGNLSDLLGSFTIISTGIPGGIIPTGVTTATTTGGGGGAGGAGGLPTATNDIPRSER 240

Query: 241 TLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVAN 300
           TLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVAN
Sbjct: 241 TLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVAN 300

Query: 301 MTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLD 360
           MTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLD
Sbjct: 301 MTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLD 360

Query: 361 ESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXXXXX 420
           ESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERN     
Sbjct: 361 ESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNLTLTT 420

Query: 421 XXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFH 480
                  DSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFH
Sbjct: 421 TKLAALLDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFH 480

Query: 481 ISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXXXXXX 540
           ISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIAL        
Sbjct: 481 ISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALAQADTSTS 540

Query: 541 XXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIFAGNGTVIYNQGSGSMTTL 600
                  IELITNSTIPRAIRAPLYSETWTANRPVQSGGNIFAGNGTVIYNQGSGSMTTL
Sbjct: 541 NQSSSSDIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIFAGNGTVIYNQGSGSMTTL 600

Query: 601 SGTAGAQQFXXXXXXXXXXXXRRENEANAKVAKSYVGSTFALLVTIFMVSLV 652
           SGTAGAQQF            RRENEANAKVAKSYVGSTFALLVTIFMVSLV
Sbjct: 601 SGTAGAQQFTSSSTGSASSGTRRENEANAKVAKSYVGSTFALLVTIFMVSLV 652

>NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score =  471 bits (1212), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 225/350 (64%), Positives = 273/350 (78%), Gaps = 7/350 (2%)

Query: 233 NDIPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT 292
           N+I  SERT+DC +YGTF+ ++SSTF+ N+TSF  SYGDSTFASGTWA DVLNL  LN+T
Sbjct: 186 NNIALSERTIDCSQYGTFDKNQSSTFQTNFTSFLTSYGDSTFASGTWAHDVLNLGGLNIT 245

Query: 293 GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTY 352
           GLSFAVANM+NSTVGVLGIGLP LE+TYSG++     ++YQY NFPM+LKQSGAI +T+Y
Sbjct: 246 GLSFAVANMSNSTVGVLGIGLPGLETTYSGST----SKLYQYNNFPMLLKQSGAIDSTSY 301

Query: 353 SLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNG 412
           SLFLDDLD   GSVLFGA+DH+KY G LYTVPM+NI+ + GY NPIQFDVTL GIG+QN 
Sbjct: 302 SLFLDDLDAKQGSVLFGAVDHTKYVGNLYTVPMVNILASKGYPNPIQFDVTLAGIGIQND 361

Query: 413 ERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNL 472
            +N            DSGTTISYFP  VV+ +ARQ+ A+YS+ LGFY + C  VSS+TN 
Sbjct: 362 SKNYTVTTNKFPALLDSGTTISYFPQEVVQTIARQLGARYSSALGFYAMSCNGVSSSTNF 421

Query: 473 VFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIAL 532
           VFDFGGFHI+GP+ DFL+ TS  TC+LAMAPQESQH++LGDIFLTHAYVVYDLDNY I+L
Sbjct: 422 VFDFGGFHITGPVSDFLLPTSGNTCVLAMAPQESQHILLGDIFLTHAYVVYDLDNYEISL 481

Query: 533 XXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
                          I++I++S +P AI+APLYSETW+   P+ +GGNIF
Sbjct: 482 --AQANTGTQNLDSNIQIISDS-VPSAIKAPLYSETWSKAMPISTGGNIF 528

 Score =  120 bits (301), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 63/127 (49%), Positives = 81/127 (63%), Gaps = 17/127 (13%)

Query: 26  NVIATTSIPSQQEQNKKQGEASENQPAPTLKYVKLPFEKYTGDSFESATRNNKPLNQLLK 85
           N++A+T IP  +  ++              KYV LPF K  GDS+E AT + KP   L+K
Sbjct: 18  NILAST-IPEHETTDQSS------------KYVILPFNKLVGDSYEDATPDKKPHFALVK 64

Query: 86  RDNEDGAGYEDVKITNQQSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLN 145
           RD      YE+V I N+QSFYSVEL IGTP Q +TVLVDTGS+DLW+ GS NP+C S+ N
Sbjct: 65  RD----GSYENVAIKNEQSFYSVELLIGTPSQKITVLVDTGSSDLWIMGSDNPYCASTSN 120

Query: 146 SRNVVIK 152
            +NV+ K
Sbjct: 121 GKNVMRK 127

>YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON}
           YPS1Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 569

 Score =  377 bits (969), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 190/353 (53%), Positives = 253/353 (71%), Gaps = 9/353 (2%)

Query: 235 IPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGL 294
           +P SE T+DCQ+YGTF++S SSTF++N T FSISYGD TFASGT+  DVL+LSDLNVTGL
Sbjct: 177 VPASEATMDCQQYGTFSTSGSSTFRSNNTYFSISYGDGTFASGTFGTDVLDLSDLNVTGL 236

Query: 295 SFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSL 354
           SFAVAN TNST+GVLGIGLP LE TYSG++ +   + Y+Y NFP+VLK SGAI + TYSL
Sbjct: 237 SFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSL 296

Query: 355 FLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQN-GE 413
           +L+D D  HG++LFGA+DHSKYTG LYT+P++N +  SG+S+PIQFDVT+ GIG+ + G 
Sbjct: 297 YLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGISDSGS 356

Query: 414 RNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLV 473
            N            DSGTT++Y P +VV ++A ++ AQYS+R+G+Y + C S  S   +V
Sbjct: 357 SNKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDS-MEIV 415

Query: 474 FDFGGFHISGPLQDFLIQTSQQTCILAMAP-QESQHVILGDIFLTHAYVVYDLDNYVIAL 532
           FDFGGFHI+ PL  F++ T   TC+L + P  +    ILGD FLT+AYVVYDL+N  I++
Sbjct: 416 FDFGGFHINAPLSSFILSTG-TTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISM 474

Query: 533 XXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIFAGN 585
                          IE+IT S++P A++AP Y+ TW+ +  + +GGNIF  N
Sbjct: 475 ----AQARYNTTSENIEIIT-SSVPSAVKAPGYTNTWSTSASIVTGGNIFTVN 522

 Score =  119 bits (298), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 75/101 (74%), Gaps = 7/101 (6%)

Query: 56  KYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTP 115
           K+VKLPF K  GDS E+   + KP  +LLKR +    GYE++ ITNQQSFYSV+L +GTP
Sbjct: 37  KFVKLPFHKLYGDSLENVGSDKKPEVRLLKRAD----GYEEIIITNQQSFYSVDLEVGTP 92

Query: 116 PQHVTVLVDTGSADLWVTGSMNPFCQS-SLNS--RNVVIKR 153
           PQ+VTVLVDTGS+DLW+ GS NP+C S S+ S  R V+ KR
Sbjct: 93  PQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKR 133

>Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {ON}
           YLR120C (REAL)
          Length = 572

 Score =  376 bits (966), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 194/352 (55%), Positives = 253/352 (71%), Gaps = 13/352 (3%)

Query: 235 IPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGL 294
           +P SE T+DC+EYGTF +S SSTF++N T FSISYGD TFASGT+  DVL+LSDLNVTGL
Sbjct: 180 VPASEATMDCKEYGTFTTSDSSTFRSNNTYFSISYGDGTFASGTFGTDVLDLSDLNVTGL 239

Query: 295 SFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSL 354
           SFAVAN TNST+GVLGIGLP LE TYSG++ +  R+ ++Y NFP+VLK SGAI T  YSL
Sbjct: 240 SFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSL 299

Query: 355 FLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGL---QN 411
           +L+D D  HG++LFGA+DHSKYTG LYT+P++N +  SG+S+PIQFDVT+ GIG+   +N
Sbjct: 300 YLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKN 359

Query: 412 GERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTN 471
           GE+             DSGTT++Y P +VV L+A +I AQYS RLG+Y + C S  S T 
Sbjct: 360 GEK--TLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDS-TQ 416

Query: 472 LVFDFGGFHISGPLQDFLIQTSQQTCILAMAP-QESQHVILGDIFLTHAYVVYDLDNYVI 530
           +VFDFGGFHI+  L  F++ T   TC+L + P  ++   ILGD FLT+AYVVYDLDN  I
Sbjct: 417 IVFDFGGFHINASLSSFILSTG-STCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEI 475

Query: 531 ALXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
           ++               IE+I+ S+IP A++AP Y+ TW+ +  + +GGNIF
Sbjct: 476 SM----AQAQYNTTTENIEVIS-SSIPSAVKAPGYTNTWSTSATIVTGGNIF 522

 Score =  120 bits (301), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 72/100 (72%), Gaps = 6/100 (6%)

Query: 56  KYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTP 115
           K+VKLPF K  GDS ++  R+ KP   L KR +    GYE++ ITNQQSFYSVEL +G+P
Sbjct: 40  KFVKLPFHKLYGDSLDNVGRDKKPEAHLFKRAD----GYEEIIITNQQSFYSVELDVGSP 95

Query: 116 PQHVTVLVDTGSADLWVTGSMNPFCQSSL--NSRNVVIKR 153
           PQ+VTVLVDTGS+DLW+ GS NP+C S    NSR  VI +
Sbjct: 96  PQNVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDK 135

>Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {ON}
           YLR120C (REAL)
          Length = 566

 Score =  375 bits (963), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 186/351 (52%), Positives = 249/351 (70%), Gaps = 11/351 (3%)

Query: 235 IPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGL 294
           +P SE T+DC+EYGTF SS SSTFK+N T+F ISYGD TFA+GT+  DVLNLSDLNVTGL
Sbjct: 173 VPASEATMDCEEYGTFTSSDSSTFKSNNTAFEISYGDGTFAAGTFGTDVLNLSDLNVTGL 232

Query: 295 SFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSL 354
           SFAVAN TNST+GVLGIGLP+LE TYSG+S +   + Y+Y NFP+VLK SGAI +  YSL
Sbjct: 233 SFAVANETNSTMGVLGIGLPSLEVTYSGSSASNGGKSYKYDNFPIVLKNSGAIKSNAYSL 292

Query: 355 FLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGL--QNG 412
           +L+D D  HG++LFG +DH+KY+G LYTV ++N +  SG+++PIQFD+TL G+G+   NG
Sbjct: 293 YLNDSDAKHGTILFGGVDHNKYSGTLYTVALVNTL--SGFTSPIQFDITLNGLGIIDDNG 350

Query: 413 ERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNL 472
           +              DSGTT++Y P  +VEL+A  + AQYS+R+G+Y + C S  ++T +
Sbjct: 351 DEK-TLTTTKIPVLLDSGTTLTYLPVEMVELIAENVGAQYSSRIGYYVMECPSSDNSTEI 409

Query: 473 VFDFGGFHISGPLQDFLIQTSQQTCILAMAP-QESQHVILGDIFLTHAYVVYDLDNYVIA 531
           VFDFGGFHI+  L  F++ TS  TC+L + P  +S   ILGD FLT+AYVVYDL+N  I+
Sbjct: 410 VFDFGGFHINASLSSFILSTSGNTCLLGIIPTSDSTGSILGDSFLTNAYVVYDLENLEIS 469

Query: 532 LXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
           +               IE+I+ S +P A++AP Y+ TW+    + +GGNIF
Sbjct: 470 M----AQAKYNVTSEDIEVISTS-VPNAVKAPGYTNTWSTTASIATGGNIF 515

 Score =  117 bits (293), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (75%), Gaps = 4/98 (4%)

Query: 56  KYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTP 115
           K+VKL F+K  GDS ++A R+ KP  +L KR +    GYE++ ITNQQSFYSV+L +GTP
Sbjct: 38  KFVKLSFDKLYGDSLDTAGRDKKPEVRLSKRAD----GYEEIIITNQQSFYSVDLEVGTP 93

Query: 116 PQHVTVLVDTGSADLWVTGSMNPFCQSSLNSRNVVIKR 153
            Q++TVLVDTGS+DLW+ GS NP+C S  +S+ V+ KR
Sbjct: 94  AQNITVLVDTGSSDLWIMGSSNPYCSSDDSSKYVLRKR 131

>Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {ON}
           YLR120C (REAL)
          Length = 569

 Score =  372 bits (954), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 188/349 (53%), Positives = 250/349 (71%), Gaps = 8/349 (2%)

Query: 235 IPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGL 294
           +P SE T++CQE+GTF +S SSTF++N T FSISYGD TFASGT+  D+L+LSDLNVTGL
Sbjct: 177 VPASEATMNCQEFGTFTTSDSSTFRSNNTYFSISYGDGTFASGTFGTDILDLSDLNVTGL 236

Query: 295 SFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSL 354
           SFAVAN TNST+GVLGIGLP LE TYSG++ ++ R+ Y Y NFPMVLK SGAI T  YSL
Sbjct: 237 SFAVANETNSTMGVLGIGLPELEVTYSGSTASSSRRPYTYDNFPMVLKNSGAIKTNAYSL 296

Query: 355 FLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGER 414
           +L+D D  HG++LFGA+DHSKY G LYTVP++N +  SG+S+PIQFDVT+ GIG+   + 
Sbjct: 297 YLNDSDAKHGTILFGAVDHSKYAGTLYTVPIVNTLSASGFSSPIQFDVTINGIGISYPDN 356

Query: 415 NXXXXXXXXX-XXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLV 473
           +             DSGTT++Y P +VV ++A +++AQYS+RLG+Y + C S S++T +V
Sbjct: 357 SQKTLTTTQIPALLDSGTTLTYLPQAVVAMIADELDAQYSSRLGYYVLDCPSNSNSTQIV 416

Query: 474 FDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALX 533
           FDFGGFHI+  L  F++  +   C+L +   +    ILGD FLT+AYVVYDLDN  I++ 
Sbjct: 417 FDFGGFHINASLSSFILN-AGNICLLGIIATD-DTTILGDSFLTNAYVVYDLDNLEISM- 473

Query: 534 XXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
                         IE+IT S+IP AI+AP Y+ TW+ +  + +GGNIF
Sbjct: 474 ---AQAQYNITNENIEVIT-SSIPSAIKAPGYTSTWSTSASIVTGGNIF 518

 Score =  111 bits (278), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 53/95 (55%), Positives = 68/95 (71%), Gaps = 4/95 (4%)

Query: 46  ASENQPAPTLKYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSF 105
           AS+       K+VKLPF K  GD+ +    + KP  +LLKR +    GYE++ ITNQQSF
Sbjct: 27  ASKRDDDSNSKFVKLPFHKLYGDTRDDVGTDKKPEVRLLKRAD----GYEEIIITNQQSF 82

Query: 106 YSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFC 140
           YSV+L +GTPPQ+VTVLVDTGS+DLW+ GS NP+C
Sbjct: 83  YSVDLEVGTPPQNVTVLVDTGSSDLWIMGSNNPYC 117

>KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score =  370 bits (949), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 180/357 (50%), Positives = 244/357 (68%), Gaps = 12/357 (3%)

Query: 238 SERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFA 297
           +E T+ C  YGTF+ S+SSTFK+N T+F+ISYGD+++ASG+W  D ++++ LNV+G+SFA
Sbjct: 153 AEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFA 212

Query: 298 VANMTNSTVGVLGIGLPALEST---YSGASG-----ATQRQMYQYMNFPMVLKQSGAIHT 349
           VAN +NS++GVLGIGLP LE T    + ASG     A    +YQY NFPMVLK  G IH 
Sbjct: 213 VANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHK 272

Query: 350 TTYSLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGL 409
             YSLFL+D  E  GSVLFGA+DHSKYTG LYTVP+++I  +S  S P++FD+TL+G+G+
Sbjct: 273 VAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGV 332

Query: 410 QNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSN 469
                             DSGTTISYFP  +   +AR+ NA Y +R GFYT+ C   +SN
Sbjct: 333 DKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSN 392

Query: 470 TNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYV 529
           TNLVFDFGGFHI+ PL DF++Q S QTC+LA+ PQ+   V+LGD+FL++AYVVYDL+N  
Sbjct: 393 TNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLE 452

Query: 530 IALXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIFAGNG 586
           +++               +E+I+ ST+P A++A  YS  W++   + +GGNIF   G
Sbjct: 453 VSM---AQANFDSSLPESVEVIS-STVPSAVKAASYSNPWSSAVMMSTGGNIFTVEG 505

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 45/60 (75%), Gaps = 2/60 (3%)

Query: 83  LLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQS 142
           L KRDN DG    DV+  NQ SFYSV+L IGTPPQ VTVLVDTGS+DLWV G+ NP C S
Sbjct: 5   LAKRDNTDGYSLMDVQ--NQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCAS 62

>KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa]
           {ON} Anc_8.318 YLR120C
          Length = 575

 Score =  369 bits (948), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 179/337 (53%), Positives = 240/337 (71%), Gaps = 8/337 (2%)

Query: 246 EYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANMTNST 305
           EYGTFN++ SST+ +N+TSF ISYGDS+ A G W QDVL++SD++V+G+SFAVAN TNST
Sbjct: 186 EYGTFNTNDSSTWSSNHTSFFISYGDSSVAEGVWGQDVLSISDVDVSGVSFAVANYTNST 245

Query: 306 VGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLDESHGS 365
           VGVLGIGL  LE+TYSG S +   + Y Y N PM+LK SG I T  YSLFL++  ++ G+
Sbjct: 246 VGVLGIGLSGLETTYSGTSSS---ESYIYENLPMLLKSSGVIDTIAYSLFLNEKSDTTGN 302

Query: 366 VLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXXXXXXXXXX 425
           +LFGA+DHSKY+G LYT+P++N+  + GY NP++FDVT++G+G+   + N          
Sbjct: 303 LLFGAVDHSKYSGSLYTLPIVNVYASEGYKNPLEFDVTMYGLGISTSDSNTTIATMKIPA 362

Query: 426 XXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGPL 485
             DSGTTI YFP +++ELVA Q+ A YS  LGFY + C S S +T  VFDFGGFHI+ PL
Sbjct: 363 LLDSGTTIVYFPETLLELVADQLGASYSDELGFYAMSCVSSSDDTEFVFDFGGFHITVPL 422

Query: 486 QDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXXXXXXXXXXX 545
            DFLI+ S   CILAMA Q+ + +ILGD FLT+AYVVYDL+NY I++             
Sbjct: 423 SDFLIRVSGSECILAMAAQDDESIILGDYFLTNAYVVYDLENYEISM----AQANYDSED 478

Query: 546 XXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
             IE+I+ ST+P A++A  YS +W++   + SGG+IF
Sbjct: 479 EDIEVIS-STVPSAVKAASYSNSWSSTGSITSGGDIF 514

 Score = 99.4 bits (246), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 63/87 (72%), Gaps = 10/87 (11%)

Query: 56  KYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTP 115
           KY+KL F+KY G+SF+ +++++     L KR     A Y    +TNQ SFYSVELAIGTP
Sbjct: 38  KYLKLGFDKYVGESFDKSSKDS-----LQKR-----AEYAIFNLTNQASFYSVELAIGTP 87

Query: 116 PQHVTVLVDTGSADLWVTGSMNPFCQS 142
            Q+VTVLVDTGS+DLWVTGS NP C +
Sbjct: 88  SQNVTVLVDTGSSDLWVTGSDNPLCST 114

>YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}
           MKC7GPI-anchored aspartyl protease, member of the yapsin
           family of proteases involved in cell wall growth and
           maintenance; shares functions with Yap3p and Kex2p
          Length = 596

 Score =  361 bits (926), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 182/357 (50%), Positives = 242/357 (67%), Gaps = 13/357 (3%)

Query: 242 LDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANM 301
           +DC  YGTFN+S+SSTF +N T FSI+YGD+TFASGTW  D L+L+DLN+TGLSFAVAN 
Sbjct: 171 IDCATYGTFNTSKSSTFNSNNTEFSIAYGDTTFASGTWGHDQLSLNDLNITGLSFAVANE 230

Query: 302 TNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLDE 361
           TNSTVGVLGIGLP LESTYSG S ++ ++ Y Y NFPMVLK SG I +T YSLF +D D 
Sbjct: 231 TNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGVIKSTAYSLFANDSDS 290

Query: 362 SHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXXXXXX 421
            HG++LFGA+DH KY G LYT+P+IN +++ GY +PIQF VTL G+G   G++       
Sbjct: 291 KHGTILFGAVDHGKYAGDLYTIPIINTLQHRGYKDPIQFQVTLQGLGTSKGDKEDNLTTL 350

Query: 422 XXXX---XXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPC-RSVSSNTNLVFDFG 477
                    DSGTTISY PT +V+++A Q+ A YS+  G+Y + C + +   ++++FDFG
Sbjct: 351 TTTKIPVLLDSGTTISYMPTELVKMLADQVGATYSSAYGYYIMDCIKEMEEESSIIFDFG 410

Query: 478 GFHISGPLQDFLIQTSQQT--CILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXX 535
           GF++S  L DF + T  ++  CIL +APQ    +ILGD FL + YVVYDLDN  I++   
Sbjct: 411 GFYLSNWLSDFQLVTDSRSNICILGIAPQSDPTIILGDNFLANTYVVYDLDNMEISM--- 467

Query: 536 XXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF--AGNGTVIY 590
                       IE+I  S +P A++AP YS TW+    + SGGN+F  A N ++ Y
Sbjct: 468 -AQANFSDDGEYIEII-ESAVPSALKAPGYSSTWSTYESIVSGGNMFSTAANSSISY 522

 Score =  107 bits (268), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (75%), Gaps = 4/86 (4%)

Query: 57  YVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPP 116
           YVK+ F+K  G SFE+A  + K   +L+ RD++    YE V++TNQ SFYSVEL IGTPP
Sbjct: 36  YVKMNFQKKYGSSFENALDDTKGRTRLMTRDDD----YELVELTNQNSFYSVELDIGTPP 91

Query: 117 QHVTVLVDTGSADLWVTGSMNPFCQS 142
           Q VTVLVDTGS+DLWVTGS NP+C +
Sbjct: 92  QKVTVLVDTGSSDLWVTGSDNPYCST 117

>Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON}
           YDR144C (REAL)
          Length = 590

 Score =  360 bits (925), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 185/362 (51%), Positives = 240/362 (66%), Gaps = 11/362 (3%)

Query: 233 NDIPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT 292
           ++ P + + ++C  YGTF+SS+SSTF++N T FSI+YGDSTFASGTW  D LNL++LNVT
Sbjct: 162 DNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVT 221

Query: 293 GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTY 352
           GLSFAVAN TNSTVGVLGIGLP LESTYSG S ++ ++ Y Y NFPMVLK SGAI ++ Y
Sbjct: 222 GLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAY 281

Query: 353 SLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNG 412
           SLF +  +  HG++LFGA+DH KYTG LYT+P+INI++N+GY +PIQF VTL GI +  G
Sbjct: 282 SLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATG 341

Query: 413 ---ERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPC-RSVSS 468
              +              DSGTTISY P  +VEL+A ++ A YS+  G+Y + C   V  
Sbjct: 342 DGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKK 401

Query: 469 NTNLVFDFGGFHISGPLQDF--LIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLD 526
           +  +VFDFGGFHIS  L +F     +S   CIL  APQ    VILGD FL   Y+VYDLD
Sbjct: 402 DITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLD 461

Query: 527 NYVIALXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIFAGNG 586
           N  I++               I++I  S +P A++AP YS TW+    +  GGNIF+ + 
Sbjct: 462 NMEISM----ANADFSDNDEYIDVI-ESAVPSALKAPNYSNTWSTYESIVPGGNIFSTSS 516

Query: 587 TV 588
            V
Sbjct: 517 NV 518

 Score =  107 bits (266), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 67/91 (73%), Gaps = 4/91 (4%)

Query: 52  APTLKYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELA 111
           A +  YV + FEK  GDSFE+A+ +      L++R+++    YE VK+TN+ SFYSVEL 
Sbjct: 31  ATSESYVIMNFEKKYGDSFENASNDRNAGAHLVRREDD----YELVKLTNENSFYSVELD 86

Query: 112 IGTPPQHVTVLVDTGSADLWVTGSMNPFCQS 142
           IGTPPQ +TVLVDTGS+DLWVTGS NP+C +
Sbjct: 87  IGTPPQKITVLVDTGSSDLWVTGSNNPYCST 117

>Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {ON}
           YLR121C (REAL)
          Length = 497

 Score =  355 bits (911), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 180/350 (51%), Positives = 231/350 (66%), Gaps = 8/350 (2%)

Query: 236 PRSERTLDCQEYGTFNSSRSSTFKNNYTS-FSISYGDSTFASGTWAQDVLNLSDLNVTGL 294
           P     +DC +YG F+ ++SSTFK N +S F  +YGD TFA G + QD L  + L+++GL
Sbjct: 95  PYCGSVMDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTFAQGAFGQDRLKYNGLDLSGL 154

Query: 295 SFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSL 354
           SFAVAN +NST GVLGIGLPALE TYSG      ++ Y+Y NFP+ LK+SGAI  T YSL
Sbjct: 155 SFAVANESNSTFGVLGIGLPALEVTYSGKVAVVDKKSYEYDNFPLFLKRSGAIDATAYSL 214

Query: 355 FLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGER 414
           FL+D  +S GS+LFGA+DHSKY G+LYTVP++N+ R+ GY +P+ FDVTL GIGLQ    
Sbjct: 215 FLNDESQSSGSILFGAVDHSKYEGRLYTVPLVNLYRSQGYQHPVAFDVTLHGIGLQTDRH 274

Query: 415 NXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVF 474
           N            DSGTT++Y P+  V L+A+ +NA YS  LG+Y   C S  ++T++ F
Sbjct: 275 NTTLTATKIPALLDSGTTLTYLPSQAVALLAKSLNATYSKALGYYEYACPSSDNDTSVAF 334

Query: 475 DFGGFHISGPLQDFLIQTS-QQTCILAMAPQESQH-VILGDIFLTHAYVVYDLDNYVIAL 532
           DFGGFHI+ P+ DF +QTS   TC+LA+ PQ      ILGD FL +AYVVYDLDNY ++L
Sbjct: 335 DFGGFHINAPVSDFTMQTSVGGTCVLAVIPQAGNATAILGDSFLRNAYVVYDLDNYEVSL 394

Query: 533 XXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
                          IE I  ST+P A RAP Y+ TW+    V SGGNIF
Sbjct: 395 ----AQAKYGTGAEDIEAI-KSTVPSATRAPGYNSTWSNYASVTSGGNIF 439

 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 56/93 (60%), Gaps = 14/93 (15%)

Query: 53  PTLKYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAI 112
           P  KYVK+PF K            +   N L KR N    G+E   + N+QSFYSVELAI
Sbjct: 24  PREKYVKIPFVK----------NQDGAGNVLGKRSN----GHEKFVLANEQSFYSVELAI 69

Query: 113 GTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLN 145
           GTP Q +TVL+DTGSADLWV    NP+C S ++
Sbjct: 70  GTPSQSLTVLLDTGSADLWVPSKGNPYCGSVMD 102

>Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  358 bits (919), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 180/347 (51%), Positives = 241/347 (69%), Gaps = 9/347 (2%)

Query: 240 RTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVA 299
           +T+DC  YG F+SS+SSTF++N T FSI+YGD TFASGTW  D LNL++LNVTGLSFAVA
Sbjct: 173 QTIDCTTYGVFDSSKSSTFQSNKTDFSITYGDLTFASGTWGHDQLNLNNLNVTGLSFAVA 232

Query: 300 NMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDL 359
           N TNSTVGVLGIGL  LESTYSGA+ ++ ++ Y Y NFPMVLK SGAI +  YSLFL++ 
Sbjct: 233 NETNSTVGVLGIGLAGLESTYSGATLSSAQESYTYNNFPMVLKNSGAIKSAAYSLFLNET 292

Query: 360 DESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGE-RNXXX 418
           +  HGS+LFGA+DH KY+G LYT+P+IN +++ GY +PIQF VTL G+GL  G+  +   
Sbjct: 293 NAKHGSILFGAVDHGKYSGDLYTIPIINTLQDHGYKDPIQFQVTLQGLGLAKGDSESTTI 352

Query: 419 XXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTV-PCRSVSSNTNLVFDFG 477
                    DSGTTISY P  ++E++A ++ A YS+++G+Y +        + N+VFDFG
Sbjct: 353 TTTKIPALLDSGTTISYMPVELMEMLADKLGASYSSKVGYYLMDCITDTDDDINVVFDFG 412

Query: 478 GFHISGPLQDFLI--QTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXX 535
           GF+ISG L  + +   +S   CIL  APQ    VILGD FL++AYVVYDLDN  I++   
Sbjct: 413 GFYISGNLSSYQLSADSSSDVCILGFAPQSDSTVILGDNFLSNAYVVYDLDNMEISM--- 469

Query: 536 XXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
                       I++I +S +P A++AP YS TW+ +  + SGG+IF
Sbjct: 470 -AQVDLSGRSEDIDVIEDS-VPSAVKAPSYSSTWSTDGSIVSGGDIF 514

 Score =  105 bits (263), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 64/86 (74%), Gaps = 4/86 (4%)

Query: 57  YVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPP 116
           YV++ F+K  GDSFE+A+ N K   +L+KR    G  YE V ++NQ SFYSV+L IGTP 
Sbjct: 36  YVRIQFQKKYGDSFENASSNKKTEARLVKR----GDDYEVVDLSNQNSFYSVDLDIGTPS 91

Query: 117 QHVTVLVDTGSADLWVTGSMNPFCQS 142
           Q VTVLVDTGS+DLWVTGS NP+C +
Sbjct: 92  QKVTVLVDTGSSDLWVTGSNNPYCST 117

>Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C
           (YPS1) - GPI-anchored aspartic protease [contig 47] FULL
          Length = 570

 Score =  356 bits (913), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 177/352 (50%), Positives = 230/352 (65%), Gaps = 5/352 (1%)

Query: 235 IPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGL 294
           +  S+ TL C  YGTF +  SS+FK+N T F I YGD T+A GTW  D + L D+ V+ L
Sbjct: 168 VAASDATLSCSSYGTFATGSSSSFKSNNTDFYIQYGDLTYALGTWGHDDVTLQDITVSDL 227

Query: 295 SFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSL 354
           S AVAN +NST GVLGIGL  LE T  G+  ++ R  Y Y N P +L   G IH   YSL
Sbjct: 228 SMAVANESNSTFGVLGIGLTGLEVTNVGSLVSSSRSAYTYQNLPALLVDQGKIHQNAYSL 287

Query: 355 FLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGER 414
           FLDDLD  HGSVLFGA+DHSKYTG LYTVP++NI ++SG+ +PIQ DVTL G+G+   + 
Sbjct: 288 FLDDLDAEHGSVLFGAVDHSKYTGNLYTVPLVNIYKSSGFPDPIQLDVTLQGLGMSANKT 347

Query: 415 NXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVF 474
           N            DSGTT++Y P+S+V+ +AR+++AQYS  +G+Y + C  VS +  LVF
Sbjct: 348 NITFTTTPIPALLDSGTTLTYLPSSMVQSIARRLSAQYSYDVGYYVLECSEVSDSDELVF 407

Query: 475 DFGGFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXX 534
           DFGGFHI   LQ+FLI+ S   C L + PQ S   ILGD FLT AYVVYDL+N  +++  
Sbjct: 408 DFGGFHIKSKLQNFLIKASSNFCALGLVPQSSSRAILGDNFLTAAYVVYDLENLEVSM-- 465

Query: 535 XXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIFAGNG 586
                        IE+I+ STIP A++AP YS TW++  P+ +GGNIF  +G
Sbjct: 466 --AQANYDGGSEDIEVIS-STIPGAVKAPGYSSTWSSRIPISTGGNIFTVSG 514

 Score =  102 bits (253), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 73/105 (69%), Gaps = 5/105 (4%)

Query: 48  ENQPAPTLKYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYS 107
           E +P    KYV++ F+K  GD+ E A     P  +L+KR +    G E +KI NQ +FYS
Sbjct: 25  EIEPQDVSKYVRISFDKLRGDTAEDARVGLMPRAELVKRAD----GSETIKIKNQNNFYS 80

Query: 108 VELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQ-SSLNSRNVVI 151
           VE+ +G+P Q+VT+L+DTGS+D+WV GS NPFC+ SS +S++V++
Sbjct: 81  VEVGVGSPAQNVTLLIDTGSSDMWVMGSNNPFCEGSSRSSKHVLL 125

>TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.318
           YLR120C
          Length = 600

 Score =  356 bits (914), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 173/345 (50%), Positives = 234/345 (67%), Gaps = 7/345 (2%)

Query: 238 SERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFA 297
           S+ ++DC  YGTF+   SS+F +N TSF+I+YGD ++A G W QDVL+L D++VTGLSFA
Sbjct: 136 SQSSIDCSLYGTFDIDDSSSFTSNDTSFAITYGDGSYALGNWGQDVLSLQDIDVTGLSFA 195

Query: 298 VANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLD 357
           VAN TNSTVGVLGIGLP+LE+TYSG+   +    YQY N P+VL+ SGA+ +  YSLFL+
Sbjct: 196 VANYTNSTVGVLGIGLPSLEATYSGSLAGSNP--YQYDNLPLVLRNSGAVKSYAYSLFLN 253

Query: 358 DLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXX 417
           D D S GS+LFG +DHSKY G L T+P++N  ++SG+ +P +FD+TL G+G+    +N  
Sbjct: 254 DEDSSEGSILFGGVDHSKYEGTLNTLPLVNYQKSSGFQSPYEFDITLQGLGISTSSKNTT 313

Query: 418 XXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFG 477
                     DSGTT++Y P ++  L+A ++NA YSARLG+YT+ C S S +T +VFDFG
Sbjct: 314 VSDTQIVALLDSGTTLTYLPVTLTSLLAAELNASYSARLGYYTMSCPSSSDSTEIVFDFG 373

Query: 478 GFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXXX 537
           GFHI+ PL  F++ +S   CIL + P+     ILGD FL HAYVVYDL+N  I+L     
Sbjct: 374 GFHINVPLTSFIVTSSMNVCILGIIPRSGDQAILGDSFLQHAYVVYDLENLEISL----A 429

Query: 538 XXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
                     IE I  S++P A+RA  YS TW+    + SGG+IF
Sbjct: 430 QAKYGSSSEDIEAIV-SSVPSAVRAASYSNTWSTAATINSGGDIF 473

 Score =  106 bits (265), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 72/102 (70%), Gaps = 12/102 (11%)

Query: 41  KKQGEASENQPAPTLKYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKIT 100
           K+ G   +N       ++K  F+K  GDS++++++ NKP   ++KRD     GYE++++ 
Sbjct: 35  KRDGSEIDN-------FIKFKFDKSYGDSYKNSSKRNKPKLDIVKRD-----GYEEIELK 82

Query: 101 NQQSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQS 142
           N+ SFYS++L+IGTP Q+VTVL+DTGS+DLWVTGS NP C S
Sbjct: 83  NESSFYSIKLSIGTPAQNVTVLIDTGSSDLWVTGSDNPLCSS 124

>CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa]
           {ON} similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 601

 Score =  356 bits (913), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 238/346 (68%), Gaps = 6/346 (1%)

Query: 238 SERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFA 297
           +  T++C +YGTF++S+SST+ +N T+F I YGDSTFASGTW  D L+LSDLNVTGLSFA
Sbjct: 188 ARATINCAKYGTFDTSKSSTWHSNDTAFMIQYGDSTFASGTWGMDNLHLSDLNVTGLSFA 247

Query: 298 VANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLD 357
           VAN TNSTVGVLGIGLPALE TYSG +  + ++ YQY NFP+VL ++GAI + +YSLFL+
Sbjct: 248 VANRTNSTVGVLGIGLPALEVTYSGRTAVSGQRPYQYDNFPLVLLRNGAIKSNSYSLFLN 307

Query: 358 DLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXX 417
           +     GSVLFGA+DHSKY G LYT+PM+N   + GY NPIQF+VTL G+G+ +   N  
Sbjct: 308 NASAETGSVLFGAVDHSKYLGDLYTIPMVNTYASQGYKNPIQFEVTLNGLGISSSSDNTT 367

Query: 418 XXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFG 477
                     DSGTT++Y P ++V  + +++ A YS R G+Y   C S S +T +VFDFG
Sbjct: 368 ITTTKIPALLDSGTTLTYLPQALVTRIVQKLQATYSNRAGYYVFSCPSQSDDTEVVFDFG 427

Query: 478 GFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXXX 537
           GFHI+ P+ +F+I +S  +CIL + PQ    +ILGD FL  AYVVYDL+NY I++     
Sbjct: 428 GFHINAPITNFIIGSSGDSCILGIMPQSGGGIILGDSFLNSAYVVYDLENYEISM----A 483

Query: 538 XXXXXXXXXXIELITNSTIPRAIRAPLYSETW-TANRPVQSGGNIF 582
                     IE+I+ S++P A+RAP +S TW T      + G+IF
Sbjct: 484 QANYAGGQEDIEVIS-SSVPGAVRAPGFSSTWSTLATSFNTQGDIF 528

 Score =  111 bits (277), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 53/89 (59%), Positives = 66/89 (74%), Gaps = 3/89 (3%)

Query: 55  LKYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGT 114
           L YVKL F+KY G++FE+A R     +Q   R N+   GYE+V+ITNQ SFYSV L +GT
Sbjct: 25  LSYVKLDFDKYYGETFETAKRGR---SQADIRVNKRANGYEEVQITNQNSFYSVTLEVGT 81

Query: 115 PPQHVTVLVDTGSADLWVTGSMNPFCQSS 143
           PPQ V VLVDTGS+DLW+TGS NP+C+ S
Sbjct: 82  PPQSVVVLVDTGSSDLWITGSDNPYCRGS 110

>YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON}
           YPS3Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 508

 Score =  352 bits (903), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 176/349 (50%), Positives = 230/349 (65%), Gaps = 7/349 (2%)

Query: 236 PRSERTLDCQEYGTFNSSRSSTFKNNYTS-FSISYGDSTFASGTWAQDVLNLSDLNVTGL 294
           P     +DC +YG F+ ++SSTFK N +S F  +YGD T+A G + QD L  ++L+++GL
Sbjct: 95  PYCGSVMDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTYAEGAFGQDKLKYNELDLSGL 154

Query: 295 SFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSL 354
           SFAVAN +NST GVLGIGL  LE TYSG      ++ Y+Y NFP+ LK SGAI  T YSL
Sbjct: 155 SFAVANESNSTFGVLGIGLSTLEVTYSGKVAIMDKRSYEYDNFPLFLKHSGAIDATAYSL 214

Query: 355 FLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGER 414
           FL+D  +S GS+LFGA+DHSKY GQLYT+P++N+ ++ GY +P+ FDVTL G+GLQ  +R
Sbjct: 215 FLNDESQSSGSILFGAVDHSKYEGQLYTIPLVNLYKSQGYQHPVAFDVTLQGLGLQTDKR 274

Query: 415 NXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVF 474
           N            DSGTT++Y P+  V L+A+ +NA YS  LG+Y   C S  + T++ F
Sbjct: 275 NITLTTTKLPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSDNKTSVAF 334

Query: 475 DFGGFHISGPLQDFLIQTSQQTCILAMAPQESQH-VILGDIFLTHAYVVYDLDNYVIALX 533
           DFGGF I+ PL DF +QTS  TC+LA+ PQ      ILGD FL +AYVVYDLDNY I+L 
Sbjct: 335 DFGGFRINAPLSDFTMQTSVGTCVLAIIPQAGNATAILGDSFLRNAYVVYDLDNYEISL- 393

Query: 534 XXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
                         +E+I  ST+P AIRAP Y+ TW+      SGGNIF
Sbjct: 394 ---AQAKYGTGKENVEVI-KSTVPSAIRAPSYNNTWSNYASATSGGNIF 438

 Score = 90.9 bits (224), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/93 (50%), Positives = 59/93 (63%), Gaps = 14/93 (15%)

Query: 53  PTLKYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAI 112
           P  KYVK+PF K          + N    +L KR N    G+E   + N+QSFYSVELAI
Sbjct: 24  PDGKYVKIPFTK----------KKNGDNGELSKRSN----GHEKFVLANEQSFYSVELAI 69

Query: 113 GTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLN 145
           GTP Q++TVL+DTGSADLWV G  NP+C S ++
Sbjct: 70  GTPSQNLTVLLDTGSADLWVPGKGNPYCGSVMD 102

>Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  354 bits (909), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 178/351 (50%), Positives = 238/351 (67%), Gaps = 11/351 (3%)

Query: 238 SERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFA 297
           + + ++C  YGTF++S+SSTF++N T FSI+YGDSTFASGTW  D L+L++LNVTGLSFA
Sbjct: 167 TSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFA 226

Query: 298 VANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLD 357
           VAN TNSTVGVLGIGLP LESTYSG S ++ ++ Y Y NFPM+LK SGAI +T YSLF +
Sbjct: 227 VANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTN 286

Query: 358 DLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXX 417
             D  HG++LFGA+DH KY G LYT+P+IN ++N GY +PIQF VTL GIG+ +GER+  
Sbjct: 287 HSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDEN 346

Query: 418 XXXXXXXX---XXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPC-RSVSSNTNLV 473
                        DSGTTISY P  +VE++A ++ A YS   G+Y + C   +   ++L+
Sbjct: 347 MTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLI 406

Query: 474 FDFGGFHISGPLQDFLIQTSQQT--CILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIA 531
           FDFGGF+I+  L +F + T  ++  CIL +APQ    +ILGD FL   YVVYDLDN  I+
Sbjct: 407 FDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEIS 466

Query: 532 LXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
           +               I+ I +S +P A++AP YS TW+    +  GGN+F
Sbjct: 467 M----AHADFSDGGEYIDTIKDS-VPSALKAPGYSSTWSTYESIVPGGNMF 512

 Score =  110 bits (275), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 64/84 (76%), Gaps = 4/84 (4%)

Query: 57  YVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPP 116
           YVK+ F++  GDSFESAT + K   +L+ R    G  YE V++TNQ SFYSVEL IGTPP
Sbjct: 36  YVKMNFQRKYGDSFESATNDTKARARLVTR----GDDYELVELTNQNSFYSVELDIGTPP 91

Query: 117 QHVTVLVDTGSADLWVTGSMNPFC 140
           Q VTVLVDTGS+DLWVTGS NP+C
Sbjct: 92  QKVTVLVDTGSSDLWVTGSDNPYC 115

>Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {ON}
           YLR121C (REAL)
          Length = 507

 Score =  350 bits (899), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 177/349 (50%), Positives = 227/349 (65%), Gaps = 7/349 (2%)

Query: 236 PRSERTLDCQEYGTFNSSRSSTFKNNYTS-FSISYGDSTFASGTWAQDVLNLSDLNVTGL 294
           P     +DC +YG F+ S+SSTFK N +S F  +YGD TFA G + QD L  ++L+++GL
Sbjct: 95  PYCGSVMDCDQYGVFDKSKSSTFKANKSSPFYAAYGDGTFAEGAFGQDKLKYNNLDLSGL 154

Query: 295 SFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSL 354
            FAVAN +NST GVLGIGL  LE TYSG      ++ Y+Y NFP+ LK SGAI  T YSL
Sbjct: 155 PFAVANESNSTFGVLGIGLSTLEVTYSGKVAVMDKRSYEYDNFPLFLKHSGAIDATAYSL 214

Query: 355 FLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGER 414
           FL+D  ++ GS+LFGA+DHSKY GQLYT+P++N+ ++ GY +P+ FDVTL G+GLQ  +R
Sbjct: 215 FLNDESQASGSILFGAVDHSKYEGQLYTIPLVNMYKSQGYQHPVAFDVTLQGLGLQTDKR 274

Query: 415 NXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVF 474
           N            DSGTT++Y P+  V L+A+ +NA YS  LG+Y   C S  + T++ F
Sbjct: 275 NTTLTTTKFPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSDNKTSIAF 334

Query: 475 DFGGFHISGPLQDFLIQTSQQTCILAMAPQESQH-VILGDIFLTHAYVVYDLDNYVIALX 533
           DFGGF I+ PL DF +QTS  TC LA+ PQ      ILGD FL +AYVVYDLDNY I+L 
Sbjct: 335 DFGGFRINAPLSDFTMQTSVGTCALALIPQAGNATAILGDSFLRNAYVVYDLDNYEISL- 393

Query: 534 XXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
                         IE I  ST+P A RAP Y+ TW+    V SGGNIF
Sbjct: 394 ---AQAKYGKAKENIEAI-KSTVPGATRAPSYNNTWSTYASVTSGGNIF 438

 Score = 88.6 bits (218), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 60/93 (64%), Gaps = 14/93 (15%)

Query: 53  PTLKYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAI 112
           P  KYVK+PF K          + N   + L KR     +G+E+  + N+QSFYSVELAI
Sbjct: 24  PEGKYVKMPFVK----------KGNSESSVLSKRS----SGHENFVLANEQSFYSVELAI 69

Query: 113 GTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLN 145
           GTP Q++TVL+DTGSADLWV G  NP+C S ++
Sbjct: 70  GTPSQNLTVLLDTGSADLWVPGKGNPYCGSVMD 102

>Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {ON}
           complement(141395..143161) [1767 nt, 589 aa]
          Length = 588

 Score =  353 bits (906), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 175/342 (51%), Positives = 233/342 (68%), Gaps = 7/342 (2%)

Query: 242 LDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANM 301
           +DC ++GTFN S S T+ +N TSFSISY DS++ASGTW QD L L DL+VTGLSFAVAN 
Sbjct: 153 VDCAKFGTFNPSTSDTWSSNETSFSISYADSSYASGTWGQDTLKLQDLDVTGLSFAVANY 212

Query: 302 TNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLDE 361
           TNSTVGVLGIGLP+LE TYSG++     + YQY NFP++LK SGA     YSL+L+DLD 
Sbjct: 213 TNSTVGVLGIGLPSLEVTYSGSNNVAGTR-YQYENFPLLLKNSGATKANAYSLYLNDLDS 271

Query: 362 SHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGER-NXXXXX 420
             GSVLFG +DH+KY+G LYT+P++N +R +G+S P++FDVTL G+G+ + E  N     
Sbjct: 272 RTGSVLFGGVDHNKYSGTLYTIPLVNTLRAAGFSQPVEFDVTLQGMGISDDEHGNVTLTT 331

Query: 421 XXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFH 480
                  DSGTT+ Y P+++V L+A + +A Y++R G+Y + C     ++ +VFDFGGFH
Sbjct: 332 TKIPALLDSGTTLVYLPSALVSLIADEYDAVYNSRTGYYVMNCPDSDEDSQIVFDFGGFH 391

Query: 481 ISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXXXXXX 540
           IS  L  ++IQ     C+L + PQ S   ILGD FL HAYVVYDLDN  I++        
Sbjct: 392 ISTNLTTYIIQAVGGICVLGILPQSSGTAILGDSFLQHAYVVYDLDNLEISM----AQAS 447

Query: 541 XXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
                  +E+I+ S+IP A++AP YS TW+    + SGGNIF
Sbjct: 448 FETDDENVEVIS-SSIPSAVKAPGYSSTWSTFSSISSGGNIF 488

 Score =  105 bits (262), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 77/117 (65%), Gaps = 10/117 (8%)

Query: 25  KNVIATTSIPSQQEQNKKQ-GEASENQPAPTLKYVKLPFEKYTGDSFESATRNNKPLNQL 83
           K V++   IP  +    +Q G ++E+Q      +V+  F+K  GDSFE+A+  NK    +
Sbjct: 36  KRVVSELEIPHGKHAKAQQPGASNESQ-----GFVRYHFDKLVGDSFENASNKNKRYANI 90

Query: 84  LKRDNEDGAGYEDVKITNQQSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFC 140
           +KRDN    G E+V+I NQ +FYSV L+IG+  Q+VTVL+DTGS+DLWVTGS NP C
Sbjct: 91  VKRDN----GVEEVEIMNQSNFYSVSLSIGSNAQNVTVLLDTGSSDLWVTGSNNPLC 143

>KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score =  349 bits (896), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 185/360 (51%), Positives = 242/360 (67%), Gaps = 16/360 (4%)

Query: 233 NDIPRSERTLDCQEYGTFNSSRSSTFKNNYTS--FSISYGDSTFASGTWAQDVLNLSDLN 290
           + IPR +R +DC EYGTF+   SST+  N ++  F I+YGD+TFASG W QD L+L D+N
Sbjct: 109 DSIPRRDR-VDCSEYGTFSLEDSSTWSQNSSAPPFYITYGDTTFASGVWGQDHLHLQDVN 167

Query: 291 VTGLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTT 350
           VTG+SFAVAN TNSTVGV+GIGLP LE+T SG+      + Y Y NFP VLK SGA  + 
Sbjct: 168 VTGVSFAVANRTNSTVGVMGIGLPGLETTNSGS------RPYTYANFPQVLKNSGATQSA 221

Query: 351 TYSLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQ 410
            YSL+L+DL+E  GS+LFGA+DHSKYTG +YT+P+IN +++ GY+ PIQFD+TL GIGL 
Sbjct: 222 LYSLYLNDLEEERGSILFGAVDHSKYTGSMYTLPIINRLQSYGYTTPIQFDITLQGIGLS 281

Query: 411 NGERN---XXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVS 467
           + E N               DSGTT++Y P+++V  +A+Q+ A  SAR G Y +PC +V 
Sbjct: 282 SSESNGDEVTITSTKMPALLDSGTTMTYLPSNIVSQIAQQLGASMSARFGQYVLPCSNVP 341

Query: 468 SNTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDN 527
            N +LV+DFGGFHI+  L ++++Q SQ  CIL + P++S   ILGD FLT AYVVYDL+N
Sbjct: 342 ENMHLVYDFGGFHINSNLTNYIVQASQTLCILGLFPRDSNTAILGDTFLTDAYVVYDLEN 401

Query: 528 YVIALXXXXXXXXXXXXXXXIELITNST-IPRAIRAPLYSETW-TANRPVQSGGNIFAGN 585
             I L               I+++T S  IP A RAP YS TW T+   V +GGNIF  N
Sbjct: 402 LQIGL--AQAKFGVSDSDAKIDIVTGSAGIPSAQRAPDYSSTWSTSVGTVTTGGNIFTLN 459

 Score =  103 bits (257), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 48/89 (53%), Positives = 65/89 (73%), Gaps = 4/89 (4%)

Query: 52  APTLKYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELA 111
           A    YV + FEK  GD++  AT+  +P  +L KR+     GYE++ +TNQQSF+SVEL 
Sbjct: 16  AAAKDYVGMRFEKKFGDNYAGATKWQRPQMRLAKRNT----GYEEITLTNQQSFFSVELD 71

Query: 112 IGTPPQHVTVLVDTGSADLWVTGSMNPFC 140
           +GTP Q+VTVLVDTGS+DLW+TG+ NP+C
Sbjct: 72  VGTPAQNVTVLVDTGSSDLWITGADNPYC 100

>SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 556

 Score =  350 bits (897), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 175/356 (49%), Positives = 240/356 (67%), Gaps = 7/356 (1%)

Query: 233 NDIPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT 292
           N +  +  T+DC +YGTFN+S SSTF +N T F I YGDS++A GTW QD L L D+++ 
Sbjct: 170 NSLSSALATIDCSQYGTFNTSASSTFSSNDTLFVIFYGDSSYAYGTWGQDELYLHDIDIG 229

Query: 293 GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTY 352
           GLSFAVAN TNSTVGVLGIGLP LE TYSG + ++ R  YQY NFP++LK++  I    Y
Sbjct: 230 GLSFAVANQTNSTVGVLGIGLPGLEVTYSGYA-SSARNRYQYDNFPLILKRNNVIKANAY 288

Query: 353 SLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNG 412
           SLFL+  + S GS+LFGA+DHSKY+GQLYTVP++N + +SGY++PIQF+V + GIG++  
Sbjct: 289 SLFLNSTNSSSGSLLFGAVDHSKYSGQLYTVPLLNTLESSGYTDPIQFEVAVQGIGVRTS 348

Query: 413 ERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNL 472
             N            DSG T+SYFP  V E++A  ++A YS+  G+Y V C S   +T +
Sbjct: 349 GSNTTLTTTVIPALLDSGATLSYFPVQVAEMIADALDATYSSSYGYYIVDCPSSDDDTEI 408

Query: 473 VFDFGGFHISGPLQDFLIQTSQQT-CILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIA 531
           ++DFGGFHI+  L D+++ T++ + C+L + PQ S   ILGD+FLT AYVVYDLDN+ I+
Sbjct: 409 IYDFGGFHIASKLTDYILTTNRPSICVLGIVPQNSNRFILGDVFLTSAYVVYDLDNFEIS 468

Query: 532 LXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIFAGNGT 587
           L               IE+I+ S +P AI+AP YS T  ++    +GG+IF   G+
Sbjct: 469 L----AQANYEGGDEQIEVISES-VPSAIKAPSYSSTRFSSASASTGGDIFTVTGS 519

 Score =  110 bits (275), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 69/87 (79%), Gaps = 4/87 (4%)

Query: 56  KYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTP 115
           KYV LPF+K  G ++E ++++NKP   L KRD+    G++++++ NQ SF+SVEL IGTP
Sbjct: 27  KYVSLPFDKSRGSTYEESSKHNKPYAVLSKRDD----GFQEIELKNQVSFFSVELEIGTP 82

Query: 116 PQHVTVLVDTGSADLWVTGSMNPFCQS 142
            Q+VTVLVDTGS+DLWVTGS NP+C++
Sbjct: 83  RQNVTVLVDTGSSDLWVTGSNNPYCRA 109

>TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.318
           YLR120C
          Length = 667

 Score =  341 bits (874), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 191/418 (45%), Positives = 257/418 (61%), Gaps = 10/418 (2%)

Query: 238 SERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSD-LNVTGLSF 296
           S+ T++C  YGTF+   SSTF++N TSF+I Y D+++A+G W +DVL  SD LNVTGLSF
Sbjct: 257 SQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSF 316

Query: 297 AVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFL 356
           AVAN TNSTVGVLGIGLP LE TYSG   +T+   Y Y NFP+VLK SGAIH + YSL+L
Sbjct: 317 AVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKP--YIYDNFPLVLKNSGAIHKSVYSLYL 374

Query: 357 DDLDESHGSVLFGAIDHSKYTGQ-LYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERN 415
           +  +  +G+VLFGA+DHS+Y G  LYTVP++N   +SGYS PI+FD+TL G+G+ +   N
Sbjct: 375 NKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGVTDNTNN 434

Query: 416 XXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFD 475
                       DSGTT++YFP  ++ L+A+ INA YS  LG+Y + C     NT +VFD
Sbjct: 435 YTVTTTQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFD 494

Query: 476 FGGFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXX 535
           FGGFHI+  L +F++ ++   C+L + P      ILGD+FLTHAYVVY+LD+  I++   
Sbjct: 495 FGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISM--- 551

Query: 536 XXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIFAGNGTVIYNQGSG 595
                       IE+IT ST+P A++AP YS T++ ++ + SGGNIF      I    S 
Sbjct: 552 -AQANYDNSNEDIEVIT-STVPNAVKAPGYSYTYSTSKSIVSGGNIFGSTTYSINPSSSN 609

Query: 596 SMTTLSGTAGAQQFXXXXXXXXXXXXRRENEAN-AKVAKSYVGSTFALLVTIFMVSLV 652
           S  +   T+  Q               +  +AN A    S   S F LL T     LV
Sbjct: 610 SGDSHDSTSTVQGTGSTSSRISTRTTSKTKQANDASNLFSPTNSLFTLLFTFICTLLV 667

 Score = 94.0 bits (232), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 56/138 (40%), Positives = 73/138 (52%), Gaps = 30/138 (21%)

Query: 26  NVIATTSIPSQQEQNKKQGEASENQPAPTLKYVKLPFEKYTGDSFESAT----------- 74
           NV  +  IP  +  N      S N       ++KL FEK+  DS                
Sbjct: 15  NVSISDPIPPVENSNNDGKVNSVNS-----NFLKLGFEKFYADSINDIVIEYDNDTDDYR 69

Query: 75  ----------RNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPPQHVTVLVD 124
                     + +KP   L+KR++    GYE+++I NQQSFYSV L IGTP Q +TVLVD
Sbjct: 70  LQKRDSIIDLKESKPYVNLIKRND----GYEEIQIINQQSFYSVNLRIGTPAQSITVLVD 125

Query: 125 TGSADLWVTGSMNPFCQS 142
           TGS+DLWVTGS NP+C+S
Sbjct: 126 TGSSDLWVTGSDNPYCKS 143

>NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score =  334 bits (856), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 166/347 (47%), Positives = 231/347 (66%), Gaps = 6/347 (1%)

Query: 242 LDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANM 301
           +DC E+GTF+SS SSTF NN T+F+I YGD +FA GTW  D +++ D+ +  LS AVAN 
Sbjct: 123 IDCSEFGTFDSSSSSTFHNNGTAFNIHYGDGSFALGTWGTDTVSIDDITLDALSLAVANS 182

Query: 302 TNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLDE 361
           +NS++GV+G+GL  LE+TYS +      Q YQY NFP+ LK +G +    YSL+L+D +E
Sbjct: 183 SNSSMGVIGLGLAGLETTYSSSHAVKSGQTYQYANFPLALKNAGIVAANAYSLYLNDPEE 242

Query: 362 SHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXXXXXX 421
           + G++LFGA+DHS Y+GQLYT+P++NI   SG+ N ++FDVTL GIG+ +   +      
Sbjct: 243 TTGNILFGAVDHSLYSGQLYTIPLVNIYSGSGFKNAVEFDVTLNGIGIVDSSGSATTVST 302

Query: 422 X-XXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSV-SSNTNLVFDFGGF 479
                  DSGTT++YFPT  V L+A Q+ AQYS+  G+YT+ C ++  + T LVFDFGGF
Sbjct: 303 TPIIALLDSGTTLTYFPTQYVSLLAAQLGAQYSSSNGYYTISCDAMQDTTTKLVFDFGGF 362

Query: 480 HISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXXXXX 539
           HI+  L DF++Q+   TC L++ PQ S   ILGD FL +AYVVYDLDN  I++       
Sbjct: 363 HINATLADFVVQSGTSTCFLSIIPQNSSSAILGDTFLNNAYVVYDLDNLEISM---AQAK 419

Query: 540 XXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIFAGNG 586
                   IE+I+ S++P A++AP YS TW+    + SGGNIF  N 
Sbjct: 420 WDQSSDEDIEVIS-SSVPSAVKAPGYSNTWSTTMSITSGGNIFTVNA 465

 Score =  102 bits (254), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 49/86 (56%), Positives = 65/86 (75%), Gaps = 4/86 (4%)

Query: 56  KYVKLPFEKYTGDSFESA-TRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGT 114
           K+V L F K  GD +++A T + KP  +L+KRD   G+ YE+V++TNQQSFYSVE+ +GT
Sbjct: 32  KFVNLRFNKKYGDHYDTASTDSRKPKLELVKRD---GSDYEEVELTNQQSFYSVEVDVGT 88

Query: 115 PPQHVTVLVDTGSADLWVTGSMNPFC 140
           P Q VTVL+DTGS+D WV GS NP+C
Sbjct: 89  PSQRVTVLLDTGSSDFWVMGSDNPYC 114

>KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.319
           YLR121C
          Length = 521

 Score =  331 bits (849), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 186/421 (44%), Positives = 257/421 (61%), Gaps = 17/421 (4%)

Query: 234 DIPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTG 293
           ++  S    DC  YGTF+ ++SST+ +N T FSI+YGD++FA GTW QD L+L DL+V+G
Sbjct: 115 NLVSSTNKFDCNTYGTFDKNQSSTWSSNDTLFSITYGDTSFARGTWGQDKLHLDDLDVSG 174

Query: 294 LSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYS 353
           LSFAVAN+TNSTVGVLGIGLP LE TY  A     R  YQY NFPM+LK SGA H+  YS
Sbjct: 175 LSFAVANVTNSTVGVLGIGLPGLEVTYINA----PRNRYQYDNFPMILKNSGATHSNLYS 230

Query: 354 LFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGE 413
           L LD  +  HG+VLFGA+DHSKYTG LYT+P++N ++  G+S+P +F+VTL G+G+    
Sbjct: 231 LHLDHPEAEHGTVLFGAVDHSKYTGSLYTIPLVNTLKTHGFSDPAKFEVTLQGVGIVANN 290

Query: 414 RNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSV-SSNTNL 472
                         DSGTT++Y P ++V+++A  I A++S+R G+Y V CR+V +S+T L
Sbjct: 291 TQTTLTNTKIAALLDSGTTLTYLPQALVQVIADSIGARWSSRYGYYIVSCRAVENSDTTL 350

Query: 473 VFDFGGFHISGPLQDFLIQTSQQTCILAMAPQE-SQHVILGDIFLTHAYVVYDLDNYVIA 531
           VFDFGGFHI+G L DF+++T    C+L +  +  S   ILGD FL +AYVV+DL+N  I+
Sbjct: 351 VFDFGGFHINGKLTDFIVETFGNVCLLTIIEETGSNSAILGDNFLINAYVVFDLENNEIS 410

Query: 532 LXXXXXXXXXXXXXXXIELIT-NSTIPRAIRAPLYSETWTANRPVQSGGNIFAGNGTVIY 590
           +               IE++T N+ +  A+ A  YS TWTA     S    FAG+   I+
Sbjct: 411 M---AQALHNVDDDQDIEIVTSNAGVASAVTALGYSSTWTAE---PSTIETFAGD---IF 461

Query: 591 NQGSGSMTTLSGTAGAQQFXXXXXXXXXXXXRRENEANAKVAKSYVGSTFALLVTIFMVS 650
              +G+    +     Q               R+N AN  V  +++ S F LL +I    
Sbjct: 462 TVSAGATANYTTAKTRQSSSDTESNTASTSMNRKNLANMNVPFTFLYS-FPLLGSIIACI 520

Query: 651 L 651
           L
Sbjct: 521 L 521

 Score = 94.4 bits (233), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 66/110 (60%), Gaps = 12/110 (10%)

Query: 33  IPSQQEQNKKQGEASENQPAPTLKYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGA 92
           IP+      + G     QP     YV L F+K  GDSFE +T      + L KR      
Sbjct: 14  IPNYSLSLPQIGGGDSKQP----DYVNLKFKKTYGDSFEGSTT----WSALAKRTR---- 61

Query: 93  GYEDVKITNQQSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQS 142
           GYE V + N+Q+FYSV+L IGTP Q +TVLVDTGS+DLWVTGS NP+C S
Sbjct: 62  GYELVDLVNRQNFYSVDLDIGTPSQTITVLVDTGSSDLWVTGSDNPYCVS 111

>NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A
          Length = 590

 Score =  333 bits (854), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 169/349 (48%), Positives = 234/349 (67%), Gaps = 10/349 (2%)

Query: 237 RSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSD-LNVTGLS 295
            ++ T+DC  YGTF+SS+SSTF++N T F ISYGD +FA GTW  DV+ L D L++  +S
Sbjct: 125 ETQDTIDCSTYGTFDSSKSSTFQSNDTDFLISYGDGSFAEGTWGTDVIKLDDSLSLNDVS 184

Query: 296 FAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLF 355
            AVA+ TNS++GVLGIGL  LE+TYS      ++  Y Y NFP+ LK+SG I +T YSL+
Sbjct: 185 VAVASSTNSSMGVLGIGLRPLETTYSSTKSVNEKTSYMYDNFPISLKKSGLIESTAYSLY 244

Query: 356 LDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERN 415
           L+D     G++LFG +DHSKYTGQLYTVPM++    + Y  P++FDVTL GIG+ +   N
Sbjct: 245 LNDPSSKSGNILFGGVDHSKYTGQLYTVPMLS--STTSYKTPVEFDVTLNGIGIIDSSGN 302

Query: 416 XXXXXXXX-XXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSV-SSNTNLV 473
                        DSGTT SY P+++V ++  ++ A Y + +G+YT+ C +  S +T +V
Sbjct: 303 KKTLTATQFYGLLDSGTTFSYLPSALVAMIGEELGASYDSNIGYYTIDCSAEDSDDTKIV 362

Query: 474 FDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALX 533
           FD GGFHI+  L DF+IQ S  TCIL++ PQ+ + V+LGD FL +AY+VYDLDNY IA+ 
Sbjct: 363 FDMGGFHINTTLSDFVIQISTSTCILSIVPQDGK-VVLGDSFLNNAYIVYDLDNYEIAM- 420

Query: 534 XXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
                         I++I+ +TIP AIRAP YS TW+ +R + SGG+IF
Sbjct: 421 --AQAAWDSTREANIDVIS-TTIPSAIRAPGYSSTWSTSRSISSGGDIF 466

 Score =  108 bits (269), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 67/98 (68%), Gaps = 4/98 (4%)

Query: 43  QGEASENQPAPTLKYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQ 102
           Q  AS        KY+ L FEK  GDSF +++ +N P  QL+KRD+    GYE V +TNQ
Sbjct: 19  QASASSKDNTSPPKYLALNFEKRYGDSFLNSSSSNGPSAQLIKRDD----GYEQVTLTNQ 74

Query: 103 QSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFC 140
           QSFYSVE+ +GTP Q +TVL+DTGS+D WVT S NP+C
Sbjct: 75  QSFYSVEVEMGTPSQKLTVLLDTGSSDFWVTSSDNPYC 112

>Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {ON}
           YLR121C (REAL)
          Length = 745

 Score =  337 bits (865), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 177/354 (50%), Positives = 226/354 (63%), Gaps = 9/354 (2%)

Query: 233 NDIPRSERTLDCQEYGTFNSSRSSTFKNNYTS-FSISYGDSTFASGTWAQDVLNLSD-LN 290
           N  P     ++C +YG F+ + SSTF  N+++ F  SYGD TFA G + QD L+ S  L+
Sbjct: 93  NANPYCGSAMNCDQYGVFDKANSSTFTANHSAPFYASYGDGTFAEGVFGQDKLHYSGGLD 152

Query: 291 VTGLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTT 350
           ++GLSFAVAN +NSTVGVLGIGLP LE TYSG      ++ YQY NFP+ LK+SGAI  T
Sbjct: 153 LSGLSFAVANKSNSTVGVLGIGLPMLEVTYSGKVAVADKRSYQYDNFPLFLKRSGAIDAT 212

Query: 351 TYSLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQ 410
            YSLFL+D  ++ GSVLFGA+DHSKY GQLYT+P++N+ +  GY  P+ FDVTL G+GLQ
Sbjct: 213 AYSLFLNDETQTSGSVLFGAVDHSKYLGQLYTIPLVNLYKAQGYQRPVAFDVTLQGLGLQ 272

Query: 411 NGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSN- 469
               N            DSGTT++Y P   V L+A+ +NA +S  LG+Y   C +   N 
Sbjct: 273 TRAHNTTLTTTRIPALLDSGTTLTYLPADAVALMAKSLNATFSKELGYYEYACPTSGDNA 332

Query: 470 TNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQH-VILGDIFLTHAYVVYDLDNY 528
           T++VFD GGFHI+ PL DF +QT+  TC+LA+ PQ      ILGD FL  AYVVYDLDNY
Sbjct: 333 TSVVFDLGGFHINAPLSDFTMQTNVGTCVLAIVPQAGNATAILGDSFLRSAYVVYDLDNY 392

Query: 529 VIALXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
            ++L               IE I  S++P A RAP Y+ TW     V SGGNIF
Sbjct: 393 EVSL----AQAKYGSGKEDIEAI-RSSVPGATRAPGYNSTWVNYASVTSGGNIF 441

 Score = 95.1 bits (235), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/93 (50%), Positives = 63/93 (67%), Gaps = 14/93 (15%)

Query: 53  PTLKYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAI 112
           P +KYV++PF K          R N P ++L KR   D    E+  ++N+QSFYSVELA+
Sbjct: 25  PNVKYVRIPFAK----------RQNGPGSELGKRAGGD----ENFVLSNEQSFYSVELAL 70

Query: 113 GTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLN 145
           GTP Q+VTVL+DTGSADLWV  + NP+C S++N
Sbjct: 71  GTPSQNVTVLLDTGSADLWVPSNANPYCGSAMN 103

>TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {ON} 
          Length = 689

 Score =  332 bits (852), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 174/344 (50%), Positives = 230/344 (66%), Gaps = 9/344 (2%)

Query: 242 LDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSD-LNVTGLSFAVAN 300
           ++C  YGTF+   SST+++N T F+I Y D++FASG W +DVL  SD LNVTGLSFAVAN
Sbjct: 282 INCDAYGTFDIENSSTYQSNQTGFAIRYADTSFASGDWGRDVLTFSDGLNVTGLSFAVAN 341

Query: 301 MTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLD 360
            TNSTVGVLGIGLP LE TY+G    T+   Y Y NFP+VLK SGAIH + YSL+L+   
Sbjct: 342 QTNSTVGVLGIGLPQLEVTYAGVYQTTKP--YTYDNFPLVLKNSGAIHKSAYSLYLNKQS 399

Query: 361 ESHGSVLFGAIDHSKYTGQ-LYTVPMINIMRNSGYSNPIQFDVTLFGIGL-QNGERNXXX 418
             +G+VLFGAIDHS+Y G  LYT+P++N   +SGYS PI+FDVTL G+G+  N   N   
Sbjct: 400 AKNGNVLFGAIDHSQYQGDTLYTIPLVNSDTSSGYSKPIEFDVTLQGLGVSDNRNGNFTV 459

Query: 419 XXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGG 478
                    DSGTT++YFP  ++ L+A++INA YS  LG+Y + C     NT LVFDFGG
Sbjct: 460 TTTQIVALLDSGTTLTYFPKDMLNLLAKRINASYSEALGYYVMNCPDSRDNTQLVFDFGG 519

Query: 479 FHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXXXX 538
           FHI   L +F++ ++   C+L + P      ILGDIFLTHAYVVY+LD+  I++      
Sbjct: 520 FHIKTNLTNFVLSSASGKCVLGLLPYNGNSAILGDIFLTHAYVVYNLDDLEISM---AQA 576

Query: 539 XXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
                    IE+I+ STIP A++AP YS T++ ++ +  GG+IF
Sbjct: 577 NFNNGNDEDIEVIS-STIPNAVKAPGYSYTYSVSKSIVPGGDIF 619

 Score = 95.9 bits (237), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 49/101 (48%), Positives = 64/101 (63%), Gaps = 19/101 (18%)

Query: 56  KYVKLPFEKYTGDSFESA---------------TRNNKPLNQLLKRDNEDGAGYEDVKIT 100
           K++KL F+K+  DS                    +N+KP  +L+KR +    GYE ++I 
Sbjct: 39  KFLKLEFQKFYADSVNDIPPRDYSFNKRDSVLDLKNSKPYIKLIKRHD----GYEKIQII 94

Query: 101 NQQSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQ 141
           NQQSFYSV L IGTP Q +TVLVDTGS+DLWVTGS NP+C+
Sbjct: 95  NQQSFYSVNLQIGTPAQSITVLVDTGSSDLWVTGSNNPYCK 135

>TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {ON}
           Anc_8.318 YLR120C
          Length = 524

 Score =  325 bits (832), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 171/337 (50%), Positives = 222/337 (65%), Gaps = 8/337 (2%)

Query: 241 TLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVAN 300
           T+DC EYGTF+ S+S++F++N T+FSISYGD+TFASGTW  D  +L DLNVT LSFAVAN
Sbjct: 144 TVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVAN 203

Query: 301 MTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLD 360
            +NSTVGV+GIGL  L+STY G + A+    YQY NFPM LK  G I    YSLFL++ D
Sbjct: 204 QSNSTVGVMGIGLAGLQSTYVGVNSASS-GAYQYENFPMALKSQGIIDRNAYSLFLNEPD 262

Query: 361 ESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXXXXX 420
              GSVLFGA+DHSKY+GQLYTVPM+N+ RN G  NPI+FDVT+ G+ + +G        
Sbjct: 263 ADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDVTVQGVSVTSGSTIRNLTN 322

Query: 421 XXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFH 480
                  DSGTT+SY P ++ +L+A  + AQYS   G+Y++ C S +++T L FDFGGF 
Sbjct: 323 TQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGGFQ 382

Query: 481 I--SGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXXXX 538
           I  +        ++S  TC L M P  S   I GD FL HAYVVYDL+NY I++      
Sbjct: 383 ISANLSSYLLSSRSSSSTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISM----AQ 438

Query: 539 XXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPV 575
                    IE+I++S IP A+RA  YS TW+ N+ +
Sbjct: 439 AAFNNSDSQIEVISDS-IPSAVRAQGYSSTWSTNQAI 474

 Score =  108 bits (270), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 70/94 (74%), Gaps = 4/94 (4%)

Query: 56  KYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTP 115
           KYV L F+K  G+S+E A + NKP  +L KRD+    GYE+++I N+Q+FYS+EL IGTP
Sbjct: 30  KYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDD----GYEEIEIYNEQNFYSIELEIGTP 85

Query: 116 PQHVTVLVDTGSADLWVTGSMNPFCQSSLNSRNV 149
            Q+VTVL+DTGS+DLWV+   NP+C  S +++ V
Sbjct: 86  SQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPV 119

>KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON} 
          Length = 538

 Score =  318 bits (814), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 162/352 (46%), Positives = 230/352 (65%), Gaps = 10/352 (2%)

Query: 234 DIPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTG 293
           D   S    +C +YGTFN+++SST+ +N + F I YGD+TFASGTW +DV++++ LNVTG
Sbjct: 133 DTVPSRELFNCSQYGTFNTNKSSTWSSNNSRFFIQYGDTTFASGTWGRDVMSINGLNVTG 192

Query: 294 LSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYS 353
           L+FAVAN +NS+  VLGIGL  LE+TY+G++ +     Y Y NFP+VLK +G   + +YS
Sbjct: 193 LTFAVANASNSSNSVLGIGLTQLETTYNGSNSS---HSYTYANFPVVLKNAGLTESISYS 249

Query: 354 LFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGE 413
           LFL++LD   GS+LFGA+DHSKY+G LYT+P++N  ++ G+ NPI+F VTL GIG+ +G 
Sbjct: 250 LFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGS 309

Query: 414 RNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCR-SVSSNTNL 472
           +             DSGT+++  P +++  +A  +N +YS  +  Y V C    S+NTNL
Sbjct: 310 KKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNL 369

Query: 473 VFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIAL 532
           VFDFGGF I G L +F+++     CIL ++  +   VILGD FL  AYVVYDL+N  I++
Sbjct: 370 VFDFGGFTIKGTLSNFILEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISM 429

Query: 533 XXXXXXXXXXXXXXXIELIT-NSTIPRAIRAPLYSETWTAN-RPVQSGGNIF 582
                          I++I  NS +P AI+AP YS TWTA    + +GGNIF
Sbjct: 430 ----AQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 64/103 (62%), Gaps = 13/103 (12%)

Query: 57  YVKLPFEKYTGDSFESATRN----------NKPLNQLLKRDNEDGAGYEDVKITNQQSFY 106
           ++ L F K  G SF+ A +           N   ++L KR + D   Y++++I NQQSFY
Sbjct: 36  FLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSD---YQELEIKNQQSFY 92

Query: 107 SVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLNSRNV 149
           S++L IGTP Q+VTV +DTGS+DLWVTGS NP+C  S  S  V
Sbjct: 93  SLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTV 135

>Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}
           similar to Ashbya gossypii AGL192W
          Length = 502

 Score =  311 bits (797), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 156/351 (44%), Positives = 223/351 (63%), Gaps = 10/351 (2%)

Query: 234 DIPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTG 293
           D   S   LDC EYG F+ S+SS++KNN+T F ISYGD++FASG W  D L+L DLN  G
Sbjct: 112 DNSDSTEPLDCFEYGAFDKSKSSSWKNNHTEFYISYGDTSFASGEWGTDKLDLGDLNADG 171

Query: 294 LSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYS 353
           L+FAVA  +NS+V VLGIGL  +E T      A+    Y+Y N P+VLK++G I  T YS
Sbjct: 172 LTFAVATASNSSVAVLGIGLTGIEVTR-----ASGDNGYEYDNLPIVLKRNGVIDKTAYS 226

Query: 354 LFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGE 413
           L+L+DLD + GSVLFGA+DHSKYTG L TVP++N+    G+  PI+  +TL G+G  +G+
Sbjct: 227 LYLNDLDATSGSVLFGAVDHSKYTGTLATVPLVNVNARYGFPKPIELHITLNGLGFSSGK 286

Query: 414 RNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPC-RSVSSNTNL 472
           +             DSGTT+SYFPT +   +A  + A ++ARL  + +PC ++  +N +L
Sbjct: 287 KRGTISATKVPALLDSGTTLSYFPTELAAAIASNVGAVWNARLRKFLIPCSQAKRNNIDL 346

Query: 473 VFDFGGFHISGPLQDFLIQTS-QQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIA 531
           +++FGG  I+ PL ++L +T+ +  C+L + P  S  +ILGD+FLT  Y VYDL+   ++
Sbjct: 347 IYNFGGVEITSPLVNYLSETNVEDVCLLGIVPTSSNDIILGDVFLTSVYTVYDLEALEVS 406

Query: 532 LXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
           +               IE+I  ST+P A +AP YS TW+   P+ +GGN+F
Sbjct: 407 I--AQAAYGASAEKENIEVI-KSTVPGATKAPGYSNTWSTYAPISTGGNMF 454

 Score = 91.3 bits (225), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 58/86 (67%), Gaps = 4/86 (4%)

Query: 50  QPAPTLKYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVE 109
           Q A +  YV+   +K  G+ F S+ +   P  +L KRD+E    Y DVKI N+Q+FYSV 
Sbjct: 24  QRAESAAYVRFDLDKTRGNDFRSSEKGVMPFGELKKRDDE----YVDVKIHNEQTFYSVN 79

Query: 110 LAIGTPPQHVTVLVDTGSADLWVTGS 135
           L+IGTP Q VTVLVDTGS+DLW+ G+
Sbjct: 80  LSIGTPAQEVTVLVDTGSSDLWIIGA 105

>KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 589

 Score =  313 bits (801), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 169/349 (48%), Positives = 225/349 (64%), Gaps = 9/349 (2%)

Query: 235 IPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGL 294
           +P S  TLDC E+GTF++S+SS++++N T F ISY D TFA G W  D ++L D+NVTGL
Sbjct: 182 VPSSLATLDCSEFGTFDTSKSSSWQSNDTRFYISYADGTFADGDWGVDEIHLDDVNVTGL 241

Query: 295 SFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSL 354
           SFAV+N T+S  GVLGIGL   ESTYSG      R  YQY NFP+VL+++G I    YS+
Sbjct: 242 SFAVSNYTDSQFGVLGIGLTGSESTYSGQLSTYNR--YQYDNFPIVLQRNGVIEKNAYSV 299

Query: 355 FLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGER 414
           FL+DLD   GS+LFGA+DHSKYTG LYTVPM+N +R+ GY+  I+  +TL GIG+ +   
Sbjct: 300 FLNDLDADSGSILFGAVDHSKYTGTLYTVPMVNALRSIGYTEQIRLSITLQGIGVTSSYG 359

Query: 415 NXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVF 474
           N            D+G T  YFP+S+   +A  ++A YS+  G+Y V C S  S+ +LVF
Sbjct: 360 NETVTQTKYPALLDTGATFCYFPSSLAAAIASSVSATYSSSSGYYFVDCDS-GSDYDLVF 418

Query: 475 DFGGFHISGPLQDFLIQTSQQT-CILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALX 533
           DFGGFHI  PL D+++ TS  + C+L + PQ    + LGD FLT AYVVYDL+   I+L 
Sbjct: 419 DFGGFHIISPLSDYIVTTSSSSQCVLGILPQSDNEITLGDAFLTSAYVVYDLEELEISL- 477

Query: 534 XXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
                         IE+I +S +P A+ AP YS TW+    + +GGNIF
Sbjct: 478 ---AQASYTSGDEKIEVIRDS-VPSAVAAPGYSSTWSTAASLSTGGNIF 522

 Score = 89.4 bits (220), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 43/85 (50%), Positives = 57/85 (67%), Gaps = 4/85 (4%)

Query: 56  KYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTP 115
           K+V + F+K  G+    A+ + + +  L KR +    GY DV+I NQ +FYSV+L IGTP
Sbjct: 35  KHVFMSFDKLRGNDASEASLSKRRVGHLKKRAD----GYVDVEIDNQNTFYSVDLEIGTP 90

Query: 116 PQHVTVLVDTGSADLWVTGSMNPFC 140
            Q V VL+DTGS+DLWV GS NPFC
Sbjct: 91  AQKVGVLIDTGSSDLWVPGSGNPFC 115

>ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 572

 Score =  310 bits (794), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 156/348 (44%), Positives = 219/348 (62%), Gaps = 11/348 (3%)

Query: 239 ERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAV 298
           E T+DC +YGTF+ ++S +F++N T F ISYGD +FASG W  D +N +++N+ G+SFAV
Sbjct: 175 EPTMDCSQYGTFDVNKSKSFRSNKTEFYISYGDGSFASGYWGTDSVNFANMNLEGVSFAV 234

Query: 299 ANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDD 358
           AN TNSTVGV GIGLP  E+TY+          Y+Y NFP VLK  GAI+   YSLFL+ 
Sbjct: 235 ANETNSTVGVFGIGLPENEATYTPDPSLNDFHPYEYQNFPQVLKSKGAINKAAYSLFLNS 294

Query: 359 LDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXXX 418
           LD S G +LFGA+D SKY G LYT+P++N    + Y NP++FDVTL G+G  NG      
Sbjct: 295 LDASSGDILFGAVDRSKYKGDLYTLPLLN-SDPTKYKNPMEFDVTLQGVGFTNGSSKTTF 353

Query: 419 XXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGG 478
                    DSGT++ Y P ++ + +A ++   Y+  +G+Y + C S + ++ LVFDFGG
Sbjct: 354 TTTKIPALLDSGTSLIYLPDALAKGIAHKLGGSYNEDIGYYVIGCPSENDDSQLVFDFGG 413

Query: 479 FHISGPLQDFLIQT----SQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXX 534
           F I   L ++L+ +        C+L + P + Q  ILGD+FL  AYVVYDLD+Y ++L  
Sbjct: 414 FTIKNNLSNYLLGSPDDGDDSQCVLGILPSDVQ-AILGDVFLADAYVVYDLDDYEVSL-- 470

Query: 535 XXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
                        I++I++S IP A RAP YS+TW+    ++SGGNIF
Sbjct: 471 --AQASFDNSKEDIQIISDS-IPGAKRAPGYSKTWSTPASIKSGGNIF 515

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 60/99 (60%), Gaps = 23/99 (23%)

Query: 58  VKLPFEKYTGDSFESA--------TRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVE 109
           VKL F K+ G ++E +        TRNNK  N +++               NQQ+FYSV+
Sbjct: 30  VKLSFNKWHGPTYEESSLERRSLETRNNKEFNFIVE---------------NQQNFYSVD 74

Query: 110 LAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLNSRN 148
           L +GTP Q++TVL+DTGS+DLW+T   NP+C+S+  S +
Sbjct: 75  LLVGTPGQNITVLLDTGSSDLWLTAKNNPYCKSNAGSND 113

>ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 531

 Score =  306 bits (785), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 145/343 (42%), Positives = 222/343 (64%), Gaps = 7/343 (2%)

Query: 241 TLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVAN 300
           TLDC+E+GTFN   S TF +N T FS+SYGD+++A GTW  D +N++D+N+T +S  VAN
Sbjct: 150 TLDCKEFGTFNREDSKTFHSNDTEFSVSYGDTSYAIGTWGYDSININDVNLTNVSIGVAN 209

Query: 301 MTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLD 360
            TNS+VG++GIGL  LE+TY+G      R  ++Y+NFPM+LK+ G I    YSLFL+  +
Sbjct: 210 KTNSSVGIMGIGLSNLENTYTGVENVKNRNTHKYLNFPMLLKEQGFIEKNVYSLFLNRRE 269

Query: 361 ESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXXXXX 420
              GS+LFGA+DHSKY+GQLYTVPM+N+ +  G  +P+Q  VTL G+G++          
Sbjct: 270 AFEGSILFGAVDHSKYSGQLYTVPMLNLYQQQGLKDPLQLQVTLQGVGIEANNMTNTTST 329

Query: 421 XXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFH 480
                  DSGTT+ Y P  ++ ++A Q+NA +   +G+Y   C  V  NTNL F+FGGF+
Sbjct: 330 TPVPALLDSGTTLVYLPDKMLAMLAEQLNAHWDRGIGYYVTDCSRV-DNTNLYFNFGGFN 388

Query: 481 ISGPLQDFLI-QTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXXXXX 539
           I   +  +++ ++++ +C+L + P   +  ILGD+F+ HAY+V+DLD++ I++       
Sbjct: 389 IVSNMSTYVVSRSNENSCVLGLQPGGPEAAILGDMFMQHAYIVFDLDDFEISM----AQA 444

Query: 540 XXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
                   +E +T   +P A++AP YS T++ ++ +  GGNIF
Sbjct: 445 NYAGGKNQLEAVTQQ-VPSAMKAPGYSHTFSGSQGITGGGNIF 486

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 61/98 (62%), Gaps = 16/98 (16%)

Query: 48  ENQPAPTLKYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDV--KITNQQSF 105
           E + A + K VK  F K+ G +F ++        +L KRD       +DV   + N+Q+F
Sbjct: 28  EEEEASSPKLVKFSFNKHQGRTFTAS-------EELSKRD-------KDVTFDLKNEQNF 73

Query: 106 YSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQSS 143
           YS++L++GTP Q V VL+DTGS+DLW+ GS NP+C+ S
Sbjct: 74  YSIKLSVGTPGQEVVVLLDTGSSDLWIPGSDNPYCKES 111

>KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  306 bits (783), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 166/347 (47%), Positives = 219/347 (63%), Gaps = 6/347 (1%)

Query: 241 TLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVAN 300
           TL C  YGTF +  SS+F++N T+F I YGDST+A GTW +D + L D+ ++G+S AVAN
Sbjct: 185 TLTCSSYGTFATDSSSSFQSNNTAFYIEYGDSTYALGTWGRDNVTLQDITLSGISMAVAN 244

Query: 301 MTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLD 360
            +NST GVLGIGL ALE T  G   AT+   Y Y N P  +   G IH   YSLFLD LD
Sbjct: 245 ESNSTFGVLGIGLAALEVTNVGTL-ATRGNSYTYENLPAKMVSEGIIHKNAYSLFLDSLD 303

Query: 361 ESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXXXXX 420
              GSVLFGA+DHSKYTG LYT+P+ N  ++ GYS+PIQ +VTL G G+     N     
Sbjct: 304 AKEGSVLFGAVDHSKYTGSLYTLPLSNSYKSMGYSDPIQLEVTLQGFGMTANNTNSTFTT 363

Query: 421 XXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFH 480
                  DSGTT++Y PT++V  VA +  A+Y +  G+Y + C  V     LVFDFGGFH
Sbjct: 364 TPLTALLDSGTTLTYLPTTLVRQVAAKYGARYDSSYGYYLLSCSDVKDTDELVFDFGGFH 423

Query: 481 ISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXXXXXX 540
           I+  +++FLI+ +   C L + PQ S  +ILGD FLT AYVVYDLDN  I+L        
Sbjct: 424 INSKVENFLIRATSNICALGLIPQSSSSLILGDNFLTAAYVVYDLDNLEISL----AQAN 479

Query: 541 XXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIFAGNGT 587
                  IE+I+ S++P A++ P YS TW+ + P+ +GGNIF  +G+
Sbjct: 480 YDGGSSNIEVIS-SSVPSAVKGPSYSSTWSTSVPISTGGNIFTVSGS 525

 Score = 97.8 bits (242), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 68/98 (69%), Gaps = 6/98 (6%)

Query: 56  KYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTP 115
           K+VK+ F+K  GD+ E AT        L KR +    G E V I NQQ+FYSVEL +G+P
Sbjct: 33  KFVKVSFDKLRGDTAEDATAGAVAHGVLAKRAD----GSETVVIKNQQTFYSVELGVGSP 88

Query: 116 PQHVTVLVDTGSADLWVTGSMNPFCQ--SSLNSRNVVI 151
            Q+VT+L+DTGS+D+WV GS NP+C+  SS NS++V++
Sbjct: 89  AQNVTLLIDTGSSDMWVMGSNNPYCEGGSSGNSKHVLL 126

>TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {ON}
           Anc_8.318 YLR120C
          Length = 596

 Score =  302 bits (774), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 160/332 (48%), Positives = 202/332 (60%), Gaps = 7/332 (2%)

Query: 239 ERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAV 298
           E  ++C E+GTFN+ +SSTFKNN+T F ISYGD+TFASG W +DVL+  D+NVTGLSF V
Sbjct: 193 EFLINCTEFGTFNTKKSSTFKNNHTDFFISYGDNTFASGYWGRDVLSFQDINVTGLSFGV 252

Query: 299 ANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDD 358
           AN+TNSTVGVLGIGLP LESTY G   +     Y Y NFP VLK SG I+ T YSLFL+ 
Sbjct: 253 ANVTNSTVGVLGIGLPELESTYFGTVNSVNESSYIYNNFPQVLKNSGIINKTAYSLFLNK 312

Query: 359 LDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXXX 418
            D + GS+L GA+D SK+  +LYTVPM+NI  + GY++P  F V +  +      +    
Sbjct: 313 SDSTQGSLLLGAVDTSKFADKLYTVPMLNINPSKGYTDPSAFLVLMQKMTRYKYGQGHLV 372

Query: 419 XXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSN--TNLVFDF 476
                    DSGTT+ Y P S+VE + R   AQY   L  Y + C S +    T+  FDF
Sbjct: 373 PSSRIPVLLDSGTTMVYLPRSIVEQIMRHEEAQYVEELDLYQIKCPSPNKKNQTSFSFDF 432

Query: 477 GGFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXX 536
           GGF I   L DF++ T    CI  M PQ+    ILGD FLTHAYVVYDL++Y I++    
Sbjct: 433 GGFQIKASLSDFIVPTDNGQCIFGMIPQDMNVGILGDSFLTHAYVVYDLEDYEISMAQAV 492

Query: 537 XXXXXXXXXXXIELITNSTIPRAIRAPLYSET 568
                      +     ST+P A+RA  YS T
Sbjct: 493 YDGGEPNYIPIV-----STVPSAVRAKYYSAT 519

 Score = 96.7 bits (239), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 71/108 (65%), Gaps = 6/108 (5%)

Query: 40  NKKQGEASEN---QPAPTLKYVKLPFEKYTGDSFESATRNNKPLNQLLKR--DNEDGAGY 94
           N++Q EA E    QP    K+++L F+++ G+S+E +T        L KR  D+     Y
Sbjct: 27  NREQVEAKEAKNIQPIKP-KFLELKFDRHYGESYEDSTLGKDGAVHLEKRTFDSAYNGSY 85

Query: 95  EDVKITNQQSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQS 142
           EDV +TNQ +FYSVEL IGTP Q VTV+VDTGS+DLW+T + NPFC +
Sbjct: 86  EDVILTNQLTFYSVELDIGTPAQKVTVVVDTGSSDLWITETSNPFCST 133

>Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {ON}
           YLR120C (YPS1) - GPI-anchored aspartic protease [contig
           171] FULL
          Length = 629

 Score =  302 bits (773), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 158/350 (45%), Positives = 213/350 (60%), Gaps = 13/350 (3%)

Query: 239 ERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAV 298
           + T+ C EYGTF +  SS+FK+N T F I YGD ++A G W +D + L D+ V+ +S AV
Sbjct: 191 QATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAV 250

Query: 299 ANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDD 358
           AN++NST GVLGIGLP LE T   A   +    Y Y NFP +L   G I  + YSLF++D
Sbjct: 251 ANISNSTFGVLGIGLPGLEVT--NALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVND 308

Query: 359 LDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXXX 418
           L+ +HGSVLFGA+DHSKYTG L T+P++N ++++    PIQFDVTL G+G+   + N   
Sbjct: 309 LNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHGLGITLNDTNTTI 368

Query: 419 XXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGG 478
                    DSGTT ++ P  +V  +A+++NA+Y    GFY   C  +S +  LVFDFGG
Sbjct: 369 TTTPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGG 428

Query: 479 FHISGPLQDFLIQT------SQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIAL 532
           FHI   L +F + T          C LA+ P     +ILGD FLT AYVVYDL+N  I++
Sbjct: 429 FHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISM 488

Query: 533 XXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
                          IE I  ST+P A++AP YS TWT+  P+ +GGNIF
Sbjct: 489 ----AQANLDGGSEDIEEIV-STVPSAVKAPGYSSTWTSAIPISTGGNIF 533

 Score = 89.4 bits (220), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 65/99 (65%), Gaps = 5/99 (5%)

Query: 56  KYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTP 115
           K+VKL F+K  GD  E+A     P  + +KRD+    G    +I NQ +FYSV + +G+P
Sbjct: 33  KFVKLSFDKLRGDLVENARAGQIPRVKRVKRDD----GTASFEIDNQDTFYSVTIGVGSP 88

Query: 116 PQHVTVLVDTGSADLWVTGSMNPFCQ-SSLNSRNVVIKR 153
            Q VT+L+DTGS+D+WV GS NP+C+ SS  S++V++  
Sbjct: 89  AQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHE 127

>ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  292 bits (747), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 153/342 (44%), Positives = 216/342 (63%), Gaps = 5/342 (1%)

Query: 242 LDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANM 301
           +DC  YGTF+ ++SST+K+N T+F ISYGD +FASG W +D + L  LN++ +S AVAN 
Sbjct: 199 IDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAND 258

Query: 302 TNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLDE 361
           TNSTVGVLGIGLP LE+TYS          + Y NFPMVLK+ G      YSL+L+  D 
Sbjct: 259 TNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDA 318

Query: 362 SHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXXXXXX 421
            +GS+LFGA+D SK+ G LYT+P++N+ ++ G S PIQFDVTL G+GL N          
Sbjct: 319 HNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQTSTTTLSTT 378

Query: 422 XXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHI 481
                 DSG+T++Y P  ++E+VA  + A++S  L +Y + C S    T +VF+FGGF+I
Sbjct: 379 KIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNI 438

Query: 482 SGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXXXXXXX 541
              L  +    S  TC+L + P      ILGD FL HAYVVYDL+++ I++         
Sbjct: 439 ETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISM----AQANF 494

Query: 542 XXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIFA 583
                 IE+++ S+IP+A  A  YS T+++++ + SGGNIF+
Sbjct: 495 DVNHEDIEVVS-SSIPQATAAAGYSSTYSSSKSITSGGNIFS 535

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 67/102 (65%), Gaps = 8/102 (7%)

Query: 45  EASENQPAPTLKYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQS 104
           E  E  P    K VKL F+K  G+++E +    +     +KRD+    G  ++ + N+Q+
Sbjct: 24  EVEEQTP----KIVKLSFDKRHGENYEESLLGKRDALPFVKRDD----GEYELSLRNRQN 75

Query: 105 FYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLNS 146
           FYSV+L +G+P Q +TVL+DTGS+DLW+TGS NP+C+S+ +S
Sbjct: 76  FYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHS 117

>KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {ON} 
          Length = 540

 Score =  285 bits (730), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 158/370 (42%), Positives = 212/370 (57%), Gaps = 14/370 (3%)

Query: 242 LDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANM 301
            DC   GTFN+S SS+FK+N T F   Y D+TFASG W  DV+ + D++V+ +S AV N+
Sbjct: 147 FDCALLGTFNNSESSSFKSNNTDFLTGYADNTFASGFWGTDVVRIGDVDVSDVSLAVVNL 206

Query: 302 TNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLDE 361
           TNST  VLGIG+P LES+ +G   A     Y+Y NFP+ LK  G I    YSLFL+D D 
Sbjct: 207 TNSTSPVLGIGMPVLESSNAGRLAAETNSSYEYDNFPVQLKNKGVIEKIAYSLFLNDSDA 266

Query: 362 SHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXXXXXX 421
           + GSVLFGA+DHSKY   L+TVPM+N  ++ G  +PI+F VT++G+G +           
Sbjct: 267 TEGSVLFGAVDHSKYENGLFTVPMVNTYKDQGVQHPIEFYVTMYGLGFKKDGFLNTITTT 326

Query: 422 XXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHI 481
                 DSG+T SY P ++V ++A  +NA +S ++  YT+ C S    T L FD GGF I
Sbjct: 327 NFPVLLDSGSTTSYLPDTLVSMLASALNATFSEKINGYTLKCPSEEDATFLSFDLGGFLI 386

Query: 482 SGPLQDFLIQTSQQTCILAMAPQESQH--VILGDIFLTHAYVVYDLDNYVIALXXXXXXX 539
             PL D + +  +  C+L +  Q       ILGD FL+ AYVVYDL++Y I++       
Sbjct: 387 DVPLSDLVAKRHKNQCVLMVKGQGEGEGGYILGDTFLSSAYVVYDLESYEISI----GQA 442

Query: 540 XXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIFAGNGTVIYN-------Q 592
                   IE+I  ST+P A+RAP Y   WT    +   GNI  G     YN       +
Sbjct: 443 STGDAAEDIEVI-KSTVPGAVRAPFYDRPWTGGTVISMSGNISTGPINGSYNGMGATKPR 501

Query: 593 GSGSMTTLSG 602
            S S TTLSG
Sbjct: 502 NSSSSTTLSG 511

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 59/94 (62%), Gaps = 13/94 (13%)

Query: 47  SENQPAPTLKYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFY 106
           + +Q +P  KYV++ F K    SF S        + L +R ++    Y  V + NQQ +Y
Sbjct: 18  ASSQASPN-KYVQMGFHK--SRSFSSGG------DSLARRADD----YLSVDVENQQLYY 64

Query: 107 SVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFC 140
           SVEL +GTPPQ+V+VL+DTGS+DLW+T   NP+C
Sbjct: 65  SVELYVGTPPQNVSVLIDTGSSDLWLTSPDNPYC 98

>KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score =  283 bits (724), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 149/362 (41%), Positives = 217/362 (59%), Gaps = 19/362 (5%)

Query: 238 SERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFA 297
           +E  +DC  +GTFN + SST+  N+T F I+Y D++ A G W QDVL++  L+++G+ FA
Sbjct: 160 AEGLVDCGFFGTFNPNDSSTWSTNHTDFVITYSDNSTAEGVWGQDVLSIGGLDISGVPFA 219

Query: 298 VANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLD 357
           VAN TNS++GVLGIGLP  E+TY           Y Y N PMVLK+SG I +  YSL L 
Sbjct: 220 VANYTNSSLGVLGIGLPGSETTY-------LTNSYMYDNLPMVLKKSGVIDSAAYSLLLA 272

Query: 358 DLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXX 417
             +     +LFGA+DHSKY+G LYT+PMINI  + GY +P++FDVT++G+G+ + + N  
Sbjct: 273 AYNNYTSGLLFGAVDHSKYSGSLYTIPMINIYESRGYESPVEFDVTIYGLGISSTDSNTT 332

Query: 418 XXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFG 477
                     DSG+T  +FPT+++ L A Q+NA YS   G YT+P     +N + VFDFG
Sbjct: 333 IATMKTPALLDSGSTAIFFPTTLLNLAAEQLNATYSEEKGLYTIPYS--PANISFVFDFG 390

Query: 478 GFHISGPLQDFL-IQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXX 536
           GFHI+ P+++   +   +   IL +       ++LG+ FL  AYVV+D +NY I++    
Sbjct: 391 GFHINLPIRELCSVSYGEPEYILNIVAHNENRIVLGEAFLARAYVVFDFENYEISM---- 446

Query: 537 XXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIFAGNGTVIYNQGSGS 596
                      IE I  ST+P A++   YS +W++   + SGG+IF    T+  N G   
Sbjct: 447 GQSSYDYAEEDIEAII-STVPGAVKVASYSNSWSSFGSITSGGDIF----TISSNAGKAV 501

Query: 597 MT 598
           +T
Sbjct: 502 VT 503

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 70/124 (56%), Gaps = 20/124 (16%)

Query: 26  NVIATTSIPSQQEQNKKQGEASENQPAPTLKYVKLPFEKYTGDSFESATRNNKPLNQLLK 85
           +VIA+ +     ++N +Q  ++EN      KY+KL F     ++FE ++R   PL    K
Sbjct: 13  SVIASLTSALIVDKNVEQLSSNEN------KYLKLDFAS---ETFEKSSR--LPLQ---K 58

Query: 86  RDNEDGAGYEDVKITNQQSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLN 145
           RD      Y  V I+  + +Y V+L++GTP Q+VT+LVDT S+D+WVT   NP C   + 
Sbjct: 59  RDT-----YATVNIS-AEFYYVVQLSVGTPGQNVTLLVDTCSSDIWVTSPDNPLCDGDIF 112

Query: 146 SRNV 149
             NV
Sbjct: 113 YDNV 116

>AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR121C (YPS3),
           YDR144C (MKC7) and YLR120C (YPS1); Tandem gene
           duplication in Saccharomyces cerevisiae
          Length = 499

 Score =  281 bits (718), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 151/345 (43%), Positives = 210/345 (60%), Gaps = 15/345 (4%)

Query: 242 LDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANM 301
           L+C E+G+F++SRSST+K+N T F I YGDST+A GTW  D L+L   NV GL+FAVA+ 
Sbjct: 118 LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFAVAHA 177

Query: 302 TNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLDE 361
           +NS+V VLGIGLPA+E+T S     +Q+  YQY N PMVLK++  I  T YS+F+++L+ 
Sbjct: 178 SNSSVAVLGIGLPAMETTMS-----SQQFGYQYDNLPMVLKRNNVIKKTVYSMFINELNA 232

Query: 362 SHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNG---ERNXXX 418
             GSVLFGA+DHSKY G L TVP++N       + P++  VTL  IGL  G   ++    
Sbjct: 233 KTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTL 292

Query: 419 XXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVS-SNTNLVFDFG 477
                    DSGTT++YFP  + + +AR   A++ +    Y V C S     T  ++DFG
Sbjct: 293 LGSKVPALLDSGTTLTYFPMQLADRLARAAGARWHSEEVGYIVDCNSRRLHQTAYIYDFG 352

Query: 478 GFHISGPLQDFLIQTS-QQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXX 536
           GF I  PL D+ + T+ + TC   + P  S +VILGD+FLT AYVV+DL+    AL    
Sbjct: 353 GFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLE----ALEVSM 408

Query: 537 XXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNI 581
                      IE+I  + +PRA+RAP Y++ W A  P+   G +
Sbjct: 409 AQANYEGGKEQIEVIAGA-VPRAVRAPGYNDPWKAYTPLVFNGEL 452

 Score = 80.1 bits (196), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 54/80 (67%), Gaps = 5/80 (6%)

Query: 56  KYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTP 115
           ++V++ F+K  G SF  A      + +L KR++     + D++I NQQ FYSV L+IGTP
Sbjct: 29  QFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRND-----WVDIEIDNQQMFYSVNLSIGTP 83

Query: 116 PQHVTVLVDTGSADLWVTGS 135
           PQ V VL+DTGS+DLWV G+
Sbjct: 84  PQEVRVLMDTGSSDLWVVGA 103

>ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 486

 Score =  277 bits (709), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 148/360 (41%), Positives = 207/360 (57%), Gaps = 20/360 (5%)

Query: 235 IPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGL 294
           +P  + T+DC +YGTF+ S+SS+FK N +S  I YGD ++A G + QD + ++ L++  +
Sbjct: 124 LPSPQPTIDCNQYGTFDYSKSSSFKANDSSLLIRYGDQSYALGRFGQDTVEMNSLSIPNV 183

Query: 295 SFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSL 354
           S  VA+  N T GVLGIGL  LE+T +G S     + Y Y NFP VLK  G I    YSL
Sbjct: 184 SLGVAHQANVTQGVLGIGLAGLETTNTGFSSTLNSKSYTYENFPQVLKSQGIIDANAYSL 243

Query: 355 FLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGL----Q 410
           FL+    S G +LFG +DHSKYTG LYTVP+IN        NPIQF VTL G+G+     
Sbjct: 244 FLNSPGASQGGILFGGVDHSKYTGPLYTVPIINT---GAPGNPIQFQVTLQGVGISLDKS 300

Query: 411 NGER--------NXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVP 462
           NG          N            DSGTT+   P  V + +A+Q+ A Y++   +Y + 
Sbjct: 301 NGTNTNAADSTSNVTLTASKFPVLLDSGTTLMTLPRPVTDQMAKQLGATYNSETSYYQLK 360

Query: 463 CRSVSSNTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVV 522
           C S + NT L+ DFGGF ++  + + + ++    C+L + P ++    LGD+FL  AYVV
Sbjct: 361 CPSQNDNTRLILDFGGFQVNAKITNHITRSQNGECLLGITPSDTDSGTLGDVFLVDAYVV 420

Query: 523 YDLDNYVIALXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
           YDLDNY I+L               IE I+ S++P A +AP YS TWT +  +++GGNIF
Sbjct: 421 YDLDNYEISL----AQADFSDSAQSIEPIS-SSVPSATKAPGYSNTWTGSESIKTGGNIF 475

 Score = 63.5 bits (153), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 51/86 (59%), Gaps = 11/86 (12%)

Query: 56  KYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTP 115
           K ++L F K+ G        NNK +     ++ +       V  TN+  FYSVEL++GTP
Sbjct: 31  KIIQLSFNKHGG------AANNKDILTPTSQNTD-----ISVNATNRYIFYSVELSVGTP 79

Query: 116 PQHVTVLVDTGSADLWVTGSMNPFCQ 141
            Q ++VL+DTGS+DLWV G+ N FC+
Sbjct: 80  AQKLSVLLDTGSSDLWVPGADNLFCE 105

>ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {ON}
           weakly similar to YYIL015W uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 551

 Score =  278 bits (711), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 149/344 (43%), Positives = 211/344 (61%), Gaps = 13/344 (3%)

Query: 234 DIPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTG 293
           + P S  T+DC +YGTFN   S TFK+N ++F ++YGD +FA G W  D + L  LNV+ 
Sbjct: 121 NFPSSSATIDCSQYGTFNLDGSETFKSNDSTFYLTYGDGSFAKGLWGMDHVYLDGLNVSD 180

Query: 294 LSFAVANMTNSTVGVLGIGLPALESTYS-GASGATQRQMYQYMNFPMVLKQSGAIHTTTY 352
           +SFAVAN +NSTVGV G+GLP  E+T + G +G      YQY NFP VLK +G +    Y
Sbjct: 181 VSFAVANESNSTVGVFGVGLPGEEATVTPGVNG----NHYQYKNFPQVLKDNGVVQKNAY 236

Query: 353 SLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNG 412
           SL+L+  D + G++LFGA+DHSKY+G LYT+P++N   + G + P +FDVT+ GI + N 
Sbjct: 237 SLYLNSPDSNSGNILFGAVDHSKYSGNLYTLPIVNTYADQGVA-PREFDVTVQGITVGNS 295

Query: 413 ERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNL 472
             N            DSGTT+ Y PT++ + +A+ +  ++S   G+Y +P  S + +T +
Sbjct: 296 SSNSTVSSDKTLALLDSGTTLMYLPTALADELAKSLGGKFSPSTGYYLIPKPSENDDTKI 355

Query: 473 VFDFGGFHISGPLQDFLIQTS--QQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVI 530
            FDFGGFHI   L ++++Q S  Q   IL +   E    I GD+FL  AYVVYDL++Y I
Sbjct: 356 TFDFGGFHIETKLSNYILQGSGPQDVAILGILRTEGDRAIFGDVFLVDAYVVYDLEDYEI 415

Query: 531 ALXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRP 574
           +L               IE I+ S +P A RAP YS+T+T N+P
Sbjct: 416 SL----AQANFNSGSSDIEAISGS-VPGASRAPGYSQTYTGNQP 454

 Score = 83.2 bits (204), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 53/85 (62%), Gaps = 14/85 (16%)

Query: 59  KLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPPQH 118
           KL F K  G++FE A  N+               G+ +  I NQQ+FYSVEL +GTP Q+
Sbjct: 27  KLSFNKLRGETFEKAVGNSN--------------GHANFDIKNQQNFYSVELKVGTPAQN 72

Query: 119 VTVLVDTGSADLWVTGSMNPFCQSS 143
           V VL+DTGS+DLW+TGS NP+C  S
Sbjct: 73  VLVLLDTGSSDLWITGSGNPYCSPS 97

>TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  279 bits (713), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 161/376 (42%), Positives = 215/376 (57%), Gaps = 17/376 (4%)

Query: 234 DIPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSD-LNVT 292
           D+   +  +DC  YGTF+ S+SSTF +N T+F I YGD TFASGTW +D +  SD LN+T
Sbjct: 176 DVTPQDAHIDCSTYGTFDPSKSSTFVSNDTNFMIRYGDRTFASGTWGRDSIEFSDHLNLT 235

Query: 293 GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTY 352
             SF VA++TNST+ VLG+GLP LE TYSG S    R  Y Y NFPM LKQSG I    Y
Sbjct: 236 DFSFGVADLTNSTISVLGMGLPRLEVTYSGLS--LDRSPYTYANFPMALKQSGLIDRMVY 293

Query: 353 SLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNG 412
           SL+L+    S GSVLFGA+DHSKY G L T+P+I++   SG   PI F+V L G+G+ + 
Sbjct: 294 SLYLNKAGASTGSVLFGAVDHSKYHGSLNTIPLISL---SGSGIPIAFNVALQGLGMSSD 350

Query: 413 ERNXXX-XXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTN 471
            +              DSGTT++Y P ++V  VA  + A +    G Y + C S S +  
Sbjct: 351 SQGTQTFLSTPLPALLDSGTTMTYLPDALVATVASTLGASFDEAQGLYLLDCPSGSDDRE 410

Query: 472 LVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIA 531
             FDFGGF IS PL +F+++     C+L +    ++  ILGD FLT AYVVYDL+N  I+
Sbjct: 411 FNFDFGGFQISVPLSNFILEALPDVCVLTLFESHAERAILGDSFLTEAYVVYDLENLEIS 470

Query: 532 LX--------XXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIFA 583
           +                       +E++T S IP A +AP YS T      +Q  GN++A
Sbjct: 471 MAQARYDDDNDSDIEKYNADNKVLLEVVT-SNIPSANQAPGYSSTLINRSTIQPSGNMYA 529

Query: 584 -GNGTVIYNQGSGSMT 598
             N T      +G+ T
Sbjct: 530 VSNATATGGPSAGNAT 545

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 71/107 (66%), Gaps = 9/107 (8%)

Query: 48  ENQPAPTLKYVKLPFEKYTGDS-FESATRNNK----PLNQLLKRDNEDGAGYEDVKITNQ 102
           EN  A   K ++L   K+ GDS F   +  ++    P  +L+KR++    G+E ++I NQ
Sbjct: 20  ENNDAFQDKVLRLDINKFYGDSKFNLGSEIDEDISTPSARLVKRED----GHEIIEIQNQ 75

Query: 103 QSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLNSRNV 149
           Q+FYSV+L +GTPPQ VTVLVDTGS+DLWVTG+ NP+C    +S+ V
Sbjct: 76  QAFYSVDLMLGTPPQKVTVLVDTGSSDLWVTGNNNPYCIDGTSSKAV 122

>SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some
           similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 592

 Score =  277 bits (709), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 155/376 (41%), Positives = 218/376 (57%), Gaps = 15/376 (3%)

Query: 235 IPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGL 294
           +P SE T+DC  +GTFN + SS+F  N T F ISY DST A G WAQDVL L DL ++ +
Sbjct: 157 VPSSEATIDCASFGTFNYTLSSSFSANDTEFYISYLDSTAAYGIWAQDVLKLGDLEISDM 216

Query: 295 SFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSL 354
            FAVA + +    V G+G P  EST    +G++ ++ Y+Y NFP++LK  G +    YSL
Sbjct: 217 PFAVAVVGDVQTPVFGVGFPGTEST----AGSSVKEPYEYANFPVLLKSQGYVKKVVYSL 272

Query: 355 FLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIM--RNSGYSNPIQFDVTLFGIGLQNG 412
           FLD  D S GS L GA+DHSKY+G LYT+PM +     ++  S P +F +TL G+G+ + 
Sbjct: 273 FLDAQDSSSGSFLLGAVDHSKYSGGLYTLPMYSGTDGDDTLSSTPSRFIITLQGLGISDK 332

Query: 413 ERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNL 472
             N            DSG+T + FP+   EL+A  + A YS     Y + C S   +TN 
Sbjct: 333 GENKTVATTRSLVYLDSGSTGTVFPSEYAELIADSLGASYSGDYEAYVMKCPSKDDDTNF 392

Query: 473 VFDFGGFHISGPLQDFLIQTSQQT-CILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIA 531
           V+DFGGF IS PL +++  T   + C+L +   +  +++LGD FL  AYVVYDL++Y I+
Sbjct: 393 VYDFGGFTISSPLSNYMEATGDDSVCVLDIDTDDIPYIVLGDAFLVSAYVVYDLEDYEIS 452

Query: 532 LXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF--AGNGTVI 589
           +               IE++++S IP A++AP YS TW+      SGGNIF    N    
Sbjct: 453 I----AQANYDGGSENIEVVSDS-IPSAVKAPFYSSTWSTYVTATSGGNIFTAVANAKTA 507

Query: 590 YNQGSGSMT-TLSGTA 604
            +  SGS + T SG+A
Sbjct: 508 SHTASGSASHTASGSA 523

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 57/95 (60%), Gaps = 4/95 (4%)

Query: 54  TLKYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIG 113
           T K+V +PF+K  G +F  +  +NK  N+L KR    G  YE++ +   +  Y VEL++G
Sbjct: 25  TSKHVSIPFKKAKGKTFSGSADSNKWRNRLSKR----GDDYENLGLKTDKLAYYVELSLG 80

Query: 114 TPPQHVTVLVDTGSADLWVTGSMNPFCQSSLNSRN 148
           TP Q   V +DTGS+DLWV  S NP+C  S  + N
Sbjct: 81  TPGQKFEVQLDTGSSDLWVYDSHNPYCMPSETTHN 115

>KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON} 
          Length = 531

 Score =  257 bits (656), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 143/361 (39%), Positives = 196/361 (54%), Gaps = 7/361 (1%)

Query: 242 LDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANM 301
           +DC  YGTFN S SS+FKNN T+F++ Y D T AS  W  DV+ +  L +  +SF VAN+
Sbjct: 153 IDCTNYGTFNHSSSSSFKNNGTNFTMFYADKTGASRFWGTDVVRVELLEILDMSFGVANV 212

Query: 302 TNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLDE 361
            N+T GV GIG P+LE+T    +       Y+Y NFP  L   G++    YSLFL+D   
Sbjct: 213 FNATEGVFGIGFPSLETTNMFNARIDPYSSYEYANFPQALNNQGSVDKVAYSLFLNDSHA 272

Query: 362 SHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXXXXXX 421
             GSVLFGA+DHSKY   L+TVP++N  R+ G  +P  F+V     G  N  R       
Sbjct: 273 MKGSVLFGAVDHSKYRNDLFTVPLVNDFRDKGMDHPHYFNVFNARRGCPNKRRPQNRRHD 332

Query: 422 XXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHI 481
                 DSG T+S  PT +V+ + + +NA +   L  YT+ C S    +   FD G FHI
Sbjct: 333 EFIVVLDSGATVSSLPTKLVDQLVQSLNATFDEELNSYTLKCPSKKDTSVASFDIGRFHI 392

Query: 482 SGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXXXXXXX 541
            GPL +F+ +  +  CIL + P ++Q  IL D FL+ AYVV+DL++Y I++         
Sbjct: 393 DGPLSNFVRKYEKNKCILRLDPADNQPYILCDNFLSRAYVVHDLESYEISM----GQANT 448

Query: 542 XXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF--AGNGTVIYNQGSGSMTT 599
                 IE I  S +P  +RAP Y +TW     V   GNI+  + NGT    Q S +   
Sbjct: 449 EYAPEQIEAI-KSKVPGTVRAPSYDKTWGNGTDVSPSGNIYTVSTNGTSTTTQSSNAREN 507

Query: 600 L 600
           L
Sbjct: 508 L 508

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 51/84 (60%), Gaps = 5/84 (5%)

Query: 58  VKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPPQ 117
           VKLP +KY    F+ +  +        KRD +    Y  V + N++  Y+V+LA+GTPPQ
Sbjct: 28  VKLP-KKYVQMGFDKSCTSATGDMVFAKRDGD----YVLVDLINEKILYTVQLAVGTPPQ 82

Query: 118 HVTVLVDTGSADLWVTGSMNPFCQ 141
           ++TV ++ GSAD W+T   NP+C+
Sbjct: 83  NITVSINIGSADPWMTSPDNPYCE 106

>CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 516

 Score =  255 bits (651), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 146/360 (40%), Positives = 207/360 (57%), Gaps = 11/360 (3%)

Query: 233 NDIPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT 292
           + I +  R LDC++YG FN S SSTFKNN T   + Y D +F  GTW  DV++L  LN++
Sbjct: 109 DQIGKKARNLDCKKYGFFNMSSSSTFKNNDTDIFLYYEDLSFVRGTWGTDVVSLGGLNIS 168

Query: 293 GLSFAVANMTNSTVGVLGIGLPALESTYS-GASGATQRQMYQYMNFPMVLKQSGAIHTTT 351
           G++FAVA ++NS+ GVLG+ LP+ ESTYS  ++G T    YQY N P+ LK+ G I   T
Sbjct: 169 GVNFAVAEISNSSSGVLGVSLPSEESTYSINSNGTTNATNYQYSNLPLQLKEQGIIDKVT 228

Query: 352 YSLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQN 411
           YS++L+D    +GS+LFGA+DHSKYTG LYT+P++N   +   + P + D+TL GIG Q+
Sbjct: 229 YSIYLNDTKSKYGSILFGAVDHSKYTGTLYTLPLVNSEYDV-VNKPYELDITLNGIGYQS 287

Query: 412 GERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSAR-LGFYTVPCRSVSSNT 470
              N            DSGTTIS FP  +VE+VA+Q+NA       G     C S   N 
Sbjct: 288 MSSNMTLYDQKVAALIDSGTTISEFPDEIVEVVAKQMNATVDPNGNGIRLAKCPSKKDNA 347

Query: 471 NLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQ--ESQHVILGDIFLTHAYVVYDLDNY 528
            L+F+ GG  I   +++F  +   + C L + P   ES  VILGD F+   Y V+DL+  
Sbjct: 348 KLLFNLGGALIYVDIKEFTTKVKGK-CYLEIIPSGAESDLVILGDNFMRSVYTVFDLEAN 406

Query: 529 VIALXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQS-GGNIFAGNGT 587
            +++               I+    ST+P A++AP Y  T++A   + S  G+IF    T
Sbjct: 407 EVSIAQANFNSSLPAQIEEIK----STVPSAVKAPQYYNTFSAIASISSVTGDIFGPEAT 462

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 35/46 (76%)

Query: 97  VKITNQQSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQS 142
           V + N    Y V+LA+GTPPQ V+V +DTGSADLW +G+ NP+C++
Sbjct: 40  VPLRNDVDQYIVQLAVGTPPQMVSVQLDTGSADLWFSGADNPYCKT 85

>KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  256 bits (655), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 148/346 (42%), Positives = 207/346 (59%), Gaps = 6/346 (1%)

Query: 238 SERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFA 297
           S   +DC  YGTF+ S SS+F  N T F   Y D + A+G W  DV++     ++ +S A
Sbjct: 114 SSDLIDCTTYGTFSVSDSSSFVYNNTDFQTQYADGSSATGFWGHDVVDFGGQELSDISIA 173

Query: 298 VANMTNSTVGVLGIGLPALESTYSGASGATQRQM-YQYMNFPMVLKQSGAIHTTTYSLFL 356
           VA+ T+S+ GVLGIGL  LESTYSG++ A+     YQY NFP+ L Q   I    YSL+L
Sbjct: 174 VADQTDSSFGVLGIGLTGLESTYSGSAAASSSTGRYQYDNFPIRLVQENVIQANAYSLYL 233

Query: 357 DDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNX 416
           D    S G++LFG +DH+KY+G L T+P+IN +  +GY++PI+  VTL G+G+ +G    
Sbjct: 234 DPATGSSGTILFGGVDHNKYSGDLNTIPLINTLEANGYTSPIKLQVTLNGLGVSDGSSTS 293

Query: 417 XXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDF 476
                      DSGTT++Y PT++ +L+A QI A YS+    Y + C +V  ++ +V+DF
Sbjct: 294 TVTTTQIPALLDSGTTLTYLPTAMFDLLAEQIGATYSSTSNGYVLSCANVDEDSMIVYDF 353

Query: 477 GGFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXX 536
           GGF I  PL   L Q S   C LA+    S +  LGD+FLTHAYVVYDLDN  I++    
Sbjct: 354 GGFQIQTPLAGSLYQLSDDQCELAIGSTSSSYATLGDLFLTHAYVVYDLDNKEISM---- 409

Query: 537 XXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
                      IE+I++S +P A +A  Y  TWT +  + +GGNIF
Sbjct: 410 AQINYNATTEDIEIISDS-VPGATKAAGYYNTWTTSESITAGGNIF 454

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 53/86 (61%), Gaps = 7/86 (8%)

Query: 57  YVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPP 116
           +V + F K  G S   ++        L+KR     +G ++V++ N+  FY++++ IGTP 
Sbjct: 27  FVGVQFSKRYGKSISDSSLAK---GNLVKR----SSGTDEVELINESVFYAIDMEIGTPK 79

Query: 117 QHVTVLVDTGSADLWVTGSMNPFCQS 142
           Q VTVLVDTGS+D WV  S NP+C+S
Sbjct: 80  QSVTVLVDTGSSDFWVPSSTNPYCES 105

>CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 591

 Score =  253 bits (646), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 144/388 (37%), Positives = 215/388 (55%), Gaps = 23/388 (5%)

Query: 234 DIPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTG 293
           +IP + +TLDCQ    F+  +SS+FK+N T F  SYGD+++ASG W  D + L +L++  
Sbjct: 159 EIPAAAKTLDCQSLSLFDLEKSSSFKSNSTPFFTSYGDNSYASGLWGTDDVRLGNLSIAD 218

Query: 294 LSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMY----------------QYMNF 337
           + FAVAN +NS+ GVLG+GLPALES     S       Y                 Y NF
Sbjct: 219 VFFAVANFSNSSTGVLGVGLPALESYNPALSDNFNVSDYLPVNASDADIDNISKPTYANF 278

Query: 338 PMVLKQSGAIHTTTYSLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNP 397
           P +LKQ   I    YSLFL+D + ++G +LFGA+DHSKYTG L T+P++N +   G ++ 
Sbjct: 279 PQILKQKNVIEKVAYSLFLNDTNATNGQILFGAVDHSKYTGSLSTLPLVNSLYVEGINDT 338

Query: 398 IQFDVTLFGIGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLG 457
            Q ++TL G+GL+N +              DSGTT+SY P  +  LVA+Q+      + G
Sbjct: 339 TQLEITLDGMGLKNSQGQFTIYNQKMPALLDSGTTVSYLPIDLHSLVAKQLKGIVDPQTG 398

Query: 458 FYTVP-CRSVSSNTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFL 516
           F  +  C + + NT LVF+FGG  IS    +F+ ++    C +   PQ    ++LGD FL
Sbjct: 399 FIELKNCPAKNDNTQLVFNFGGAFISIKYTEFIEKSDDDNCYVTFMPQGEPGILLGDNFL 458

Query: 517 THAYVVYDLDNYVIALXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTA-NRPV 575
            +AY+VYDL++  I++               IE I  + +P A++AP YS ++T      
Sbjct: 459 RNAYIVYDLEDMEISI----AQANFNGGAENIEAIVKN-VPSAVKAPGYSASFTEFPSSY 513

Query: 576 QSGGNIFAGNGTVIYNQGSGSMTTLSGT 603
            + GNIF+G  +      +GS TT++ +
Sbjct: 514 ATTGNIFSGYNSTNSTGSAGSKTTMTSS 541

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 63/95 (66%), Gaps = 4/95 (4%)

Query: 56  KYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTP 115
           KY+KL FEK+  D  E     +    QL KR ++D   +    +  Q+++YS+ L +GTP
Sbjct: 20  KYLKLDFEKHRADIDEELPLTHSAARQLRKRASDDSVAF---PLVAQENYYSINLEVGTP 76

Query: 116 PQHVTVLVDTGSADLWVTGSMNPFCQSSLN-SRNV 149
           PQ+V++L+DTGS+D+WV GS N +C++S N SRN+
Sbjct: 77  PQNVSLLLDTGSSDMWVIGSNNGYCKNSDNKSRNL 111

>CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3
          Length = 521

 Score =  249 bits (636), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 136/360 (37%), Positives = 206/360 (57%), Gaps = 11/360 (3%)

Query: 233 NDIPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT 292
           N +P+S+RTLDC++YG +N + SSTF +N T   I+YGD+ F  GTW  D +++ +LN++
Sbjct: 109 NQVPKSDRTLDCKKYGFYNRNESSTFNSNGTDLFITYGDNGFVRGTWGTDSVSVGNLNLS 168

Query: 293 GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTY 352
            LS  V+ MTN++ G+LG+GLP  EST++ +S  T    YQY NFP+ LK+ G I    Y
Sbjct: 169 NLSIGVSPMTNTSTGILGVGLPGEESTFNYSSNVTGPSNYQYSNFPIRLKEEGLIEKIAY 228

Query: 353 SLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNG 412
           S++L++    +GS+LFGA+DHSKY G LYT P++N     G S+P QF++T+ G+GL   
Sbjct: 229 SIYLNETGSKYGSILFGAVDHSKYQGPLYTFPLVNSKYKEG-SDPFQFEITMNGVGLVGK 287

Query: 413 ERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVP-CRSVSSNTN 471
             N            DSG+TIS  P  V +LVA+Q+N     +     +P C S   N  
Sbjct: 288 TDNITLYDQKLPTLLDSGSTISLLPRDVADLVAQQVNGTVDGKGNCIKLPKCPSKKDNQK 347

Query: 472 LVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQES-QHVILGDIFLTHAYVVYDLDNYVI 530
           L+F+F G   S  + DF+ +  +  C L  +  +     +LGD F+ + Y V++LD+  +
Sbjct: 348 LIFNFSGAEFSVNVTDFM-EKHKGKCYLQFSALDGINFALLGDNFMNNVYTVFNLDDKEL 406

Query: 531 ALXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSG--GNIFAGNGTV 588
           +L               I+     T+P A+ AP Y  T++A+ P  +   GNIFA   T+
Sbjct: 407 SLAQANYNSSLKPDIEEIK----DTVPSAVLAPQYYNTFSAD-PTATAVTGNIFAPEATM 461

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 45/84 (53%), Gaps = 16/84 (19%)

Query: 57  YVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPP 116
           YVKL F K  G             + L KRD  D    E  ++T  +  Y VE+A+GTPP
Sbjct: 17  YVKLDFTKTPG-------------SDLAKRDVVDP---EAAQLTFDKDQYIVEVAVGTPP 60

Query: 117 QHVTVLVDTGSADLWVTGSMNPFC 140
           Q V + +DTGS+DL+V    NP+C
Sbjct: 61  QKVLLQIDTGSSDLFVIEESNPYC 84

>KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 767

 Score =  254 bits (649), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 143/337 (42%), Positives = 197/337 (58%), Gaps = 13/337 (3%)

Query: 241 TLDCQEYGTFNSSRSSTFKNNYTS-FSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVA 299
           T+DC +YGTFN+ RS++   NY+  F +SY D ++A G WA+D L +   +++ L FAVA
Sbjct: 154 TIDCAQYGTFNADRSTSLFANYSKPFFVSYNDDSYALGYWARDKLVVDGDDISSLEFAVA 213

Query: 300 NMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDL 359
            ++NSTVGVLG+GL  LEST    S         Y NFPMVLK++GAI    YSL+L+ L
Sbjct: 214 EISNSTVGVLGVGLQGLESTVHYRSPNISSI---YPNFPMVLKENGAIDKIAYSLYLNSL 270

Query: 360 DESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGE--RNXX 417
           D   GSVLFG +DHSKYTG LYT+P++N  ++ G   P+QFDVT+ GIG+++ +  R   
Sbjct: 271 DAPSGSVLFGGVDHSKYTGGLYTLPLVNTYKDYGVKTPVQFDVTVQGIGIESEKACRQET 330

Query: 418 XXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFG 477
                     DSGTT+ Y    +V  +A  +NA +S   G +   C S   +T  +FDFG
Sbjct: 331 FTTTKIAALMDSGTTLMYTAPEIVNKIALYVNASFSPGYGLFMFRCPSDGDDTQFIFDFG 390

Query: 478 GFHISGPLQDFLIQTSQQT-CILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXX 536
           GF I  PL +++++T  +  C L +    +Q  I GD FL  AYVVYDL+N  ++L    
Sbjct: 391 GFQIKSPLSNYILRTDDENICGLGLI-SSNQGTIFGDEFLASAYVVYDLENLELSL---- 445

Query: 537 XXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANR 573
                      IE I  S IPRA RA  Y  TW ++ 
Sbjct: 446 AQANWNPGSPEIEKIV-SEIPRAQRASQYWNTWVSDE 481

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 52/86 (60%), Gaps = 2/86 (2%)

Query: 55  LKYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGT 114
           + YV + F K  G S++ A    +P  +L KR    G    + ++ N   FYSV L IGT
Sbjct: 33  MGYVAIDFAKAKGISYQDARVGARPA-KLQKRALSQGETL-NSELVNNNVFYSVGLDIGT 90

Query: 115 PPQHVTVLVDTGSADLWVTGSMNPFC 140
           PPQ VTVL DTGS+DLWV+ + NP+C
Sbjct: 91  PPQQVTVLFDTGSSDLWVSSNDNPYC 116

>CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  248 bits (633), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 143/421 (33%), Positives = 230/421 (54%), Gaps = 24/421 (5%)

Query: 233 NDIPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT 292
           N +P+S RTL+C++YG FNSS SSTFK N + F +SY D +FA+G W  DV++ ++LN++
Sbjct: 110 NQVPKSSRTLNCKKYGVFNSSESSTFKRNDSEFLLSYADMSFATGNWGSDVVSFNELNIS 169

Query: 293 GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQM---YQYMNFPMVLKQSGAIHT 349
            ++FA+ +  NS+ GVLG+GLP +ESTY G    +++ +   +QY NFP+ LKQ+G I  
Sbjct: 170 NVNFALGSFANSSNGVLGVGLPDVESTYDGPYAGSRKNISDSHQYANFPITLKQNGVIDK 229

Query: 350 TTYSLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGL 409
             YSL+L+      GSVLFGA+DH++Y G LYT+P+ N +  + +++P Q ++T+ G+GL
Sbjct: 230 IAYSLYLNSSKSKFGSVLFGAVDHNRYNGPLYTLPLANSLFQN-FTDPFQLEITMNGLGL 288

Query: 410 QNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVP-CRSVSS 468
           Q  + N            DSGTT++     + +L+A Q+N   + +     +P C S   
Sbjct: 289 QGNDANITLYDKKSAALLDSGTTLTVVSKHIGDLIAAQVNGTIAGKDQCIRLPKCPSKKE 348

Query: 469 NTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQE---SQHVILGDIFLTHAYVVYDL 525
           N  L+F+F G  ++  +   ++   +  C L  A  E   +  +I GD FL   Y+VY+L
Sbjct: 349 NKKLIFNFSGAEVAVDINQ-MMNKHKGKCYLQFAVHEDTSNDAIIFGDNFLRSVYLVYNL 407

Query: 526 DNYVIALXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQS-GGNIFAG 584
           ++  I++               I+    ST+P AIRAP Y  T++ +    +  G+IFA 
Sbjct: 408 EDKEISIAPANFNSSLPENIEPIK----STVPSAIRAPQYYNTYSEHATATAVTGDIFAP 463

Query: 585 NGTVIYNQGSGSMTTLSGTAGAQQFXXXXXXXXXXXXRRENEA---NAKVAKSYVGSTFA 641
             T+       SM  ++ T G+                  N+A   N+ +   ++ S FA
Sbjct: 464 EATM-------SMAPINKTNGSSNRTLNSSRFDLQKRVYSNQASLKNSSLIAFFLASLFA 516

Query: 642 L 642
           L
Sbjct: 517 L 517

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/85 (43%), Positives = 52/85 (61%), Gaps = 15/85 (17%)

Query: 57  YVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPP 116
           Y+KL FEK           + K  + L+KRD+E    Y +V + N    Y V+LA+GTPP
Sbjct: 16  YLKLDFEK-----------SPKASSDLVKRDDE----YVNVPLKNDGDLYLVQLAVGTPP 60

Query: 117 QHVTVLVDTGSADLWVTGSMNPFCQ 141
           Q++TV +DTGS+DLW   + NPFC+
Sbjct: 61  QNITVQLDTGSSDLWFPSADNPFCK 85

>Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144C
           (MKC7) - aspartyl protease related to Yap3p [contig 105]
           FULL
          Length = 651

 Score =  250 bits (639), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 142/338 (42%), Positives = 201/338 (59%), Gaps = 15/338 (4%)

Query: 241 TLDCQEYGTFNSSRSSTFK-NNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVA 299
           T+DC E+GTFN ++SSTF+     +F I YGD TFA+G WA+D L+L   +++ L FAVA
Sbjct: 142 TVDCAEFGTFNPNKSSTFRPQGNDTFMIMYGDGTFANGLWAKDTLSLDGHDISNLQFAVA 201

Query: 300 NMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDL 359
           NM++S VGVLG+GL  LES    ++     +  QY NFP+VLKQ+  I    YSL+++ L
Sbjct: 202 NMSDSDVGVLGVGLTGLES----SADPFDDEPSQYPNFPVVLKQNNVISKMAYSLYINSL 257

Query: 360 DESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGER--NXX 417
           D   GSVLFGA+DHSKYTG LYT+P++N +        ++FDVT+ G+G+++ +      
Sbjct: 258 DAEAGSVLFGAVDHSKYTGGLYTIPLVNALAQYFVDEILEFDVTVQGLGIESKKNCFQKT 317

Query: 418 XXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFG 477
                     DSGTT+ Y    + + +A  + A  S     YT  C +   +T LVFDFG
Sbjct: 318 LTTAQFPALMDSGTTLIYIDPDLADAIADSLGATMSDDYELYTFECPAKDDDTQLVFDFG 377

Query: 478 GFHISGPLQDFLIQT-SQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXX 536
           GF I+ PL +++++T  ++ C L + P  S   ILGD FL  AYVV+DL+N  +++    
Sbjct: 378 GFQITNPLSNYVLETDDEKVCGLGVVPSYSN--ILGDEFLASAYVVFDLENLELSI---- 431

Query: 537 XXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRP 574
                      IE I  ST+P A +AP YS TWT N P
Sbjct: 432 GQANLNPGPEDIEPII-STVPGAQKAPGYSSTWTFNFP 468

 Score = 79.7 bits (195), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 61/100 (61%), Gaps = 8/100 (8%)

Query: 56  KYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKIT---NQQSFYSVELAI 112
            YV   F K  G SF  A   ++P  +L +RD    +G  D  ++   N++ FYSV+L I
Sbjct: 27  DYVSFNFGKSLGSSFHGARGGSRP-GKLHRRD----SGSSDSALSVLKNEEVFYSVKLNI 81

Query: 113 GTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLNSRNVVIK 152
           GTPPQ +TVL DTGS+DLWV+ + NPFC++   +R   +K
Sbjct: 82  GTPPQDITVLFDTGSSDLWVSSNSNPFCEADGVNRRADLK 121

>CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 482

 Score =  244 bits (623), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 137/362 (37%), Positives = 205/362 (56%), Gaps = 14/362 (3%)

Query: 233 NDIPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT 292
           N IP+S R +DC+ +G FN+S+SST+KNN T+F++SY D+TFASG W  D L+ + + V 
Sbjct: 110 NQIPKSLRDIDCKAFGFFNTSKSSTYKNNGTNFTLSYADTTFASGPWGVDTLSFNGVKVD 169

Query: 293 GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQ--RQMYQYMNFPMVLKQSGAIHTT 350
            ++F +A  +NST  V GI LPA E+T   A+  ++     Y+Y NFPM+LK+ G +   
Sbjct: 170 NVTFGLAAFSNSTTPVFGISLPARETTNQLAANGSRIGPNSYEYSNFPMLLKEQGIVKKI 229

Query: 351 TYSLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQ 410
            YS++L+D    +GS+LFGA+D SKY G LYT+P++N +     S P QF++TL GIGLQ
Sbjct: 230 AYSVYLNDTRSKYGSILFGAVDQSKYIGTLYTLPLVNSLYKQ-VSKPFQFEITLNGIGLQ 288

Query: 411 NGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTV-PCRSVSSN 469
             ++N            D+G T S  P  V  LVA ++N       GF  +  C +    
Sbjct: 289 TADKNYTLYDQKLATLLDTGVTTSVLPAKVAALVASKVNGTIDDDNGFIKLDKCPNKKEK 348

Query: 470 TNLVFDFGGFHISGPLQDFLIQTSQQTCILAM-APQESQHVILGDIFLTHAYVVYDLDNY 528
             +VF+FGG  IS  ++D L +  +  C L M A  + +   LGDIFL H YVVY+L++ 
Sbjct: 349 RTVVFNFGGAEISIDIRD-LTRKIKGKCYLQMQARDDIEFAALGDIFLRHVYVVYNLEDE 407

Query: 529 VIALXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSG--GNIFAGNG 586
            I++               +     ST+P A++AP Y  T++   P  +   G++F    
Sbjct: 408 EISIANANFNYSTPDIQEIV-----STVPGAVKAPQYYNTYSV-YPTATAVTGDVFTPEA 461

Query: 587 TV 588
           T+
Sbjct: 462 TM 463

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 49/74 (66%), Gaps = 7/74 (9%)

Query: 70  FESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPPQHVTVLVDTGSAD 129
           FE     N  LN   KRD++   G + +++ N    Y+V+L++GTPPQ++TV +DTGS+D
Sbjct: 21  FEKVPEQNLALN---KRDDK---GLQ-LELENGGLLYAVQLSVGTPPQNITVQLDTGSSD 73

Query: 130 LWVTGSMNPFCQSS 143
           LW T   NP+C+++
Sbjct: 74  LWFTSEANPYCKNN 87

>CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  243 bits (619), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 140/359 (38%), Positives = 202/359 (56%), Gaps = 12/359 (3%)

Query: 233 NDIPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT 292
           N +P++ R ++C +YG FN+S SST+  N T+FS+SYGD TFASG W  D ++L+ + V 
Sbjct: 112 NQVPKALRNINCNKYGFFNASGSSTYSRNDTNFSLSYGDETFASGPWGTDTISLNGVKVE 171

Query: 293 GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQM-YQYMNFPMVLKQSGAIHTTT 351
            ++F +A+ +NST  V GIGLP  ESTY+  S  T      QY NFP+ LKQ G I    
Sbjct: 172 NVTFGLASFSNSTNPVFGIGLPGDESTYAMFSEDTNGTTNTQYSNFPLQLKQQGKIDKVA 231

Query: 352 YSLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQN 411
           YS++L+      GS+LFGA+DHSKY+G LYT+P++N   +    NP + +VTL G+GLQ 
Sbjct: 232 YSIYLNSTKSKQGSILFGAVDHSKYSGPLYTLPIVNRFGHL-VENPYELEVTLSGLGLQR 290

Query: 412 GERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTV-PCRSVSSNT 470
              N            D+GTT +Y P+SV + +A Q N     +     +  C S  SN 
Sbjct: 291 ATSNITLFDQLLPALLDTGTTYTYMPSSVAQYLANQTNGVIDKKTSLIKLAKCPSKKSND 350

Query: 471 NLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVI 530
            +VF+F G  I   + DF ++  +  C L    QES   +LGD F+ H Y V+DLD+  I
Sbjct: 351 TIVFNFSGAQIKIKMVDF-VEKHKGKCYLPCVSQESSFFLLGDSFMRHVYTVFDLDDKEI 409

Query: 531 ALXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSG--GNIFAGNGT 587
           ++               IE I+ ST+P A++AP Y  ++  + P +    G+IFA   T
Sbjct: 410 SI----AQANFNSTKEDIEEIS-STVPSAVKAPQYYSSY-VDFPTEISVTGDIFAPQAT 462

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 49/88 (55%), Gaps = 14/88 (15%)

Query: 54  TLKYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIG 113
           T  Y+KL FEK             K  ++L KR + D        + N    Y+V++A+G
Sbjct: 13  TQAYLKLDFEK-----------TPKISDELTKRADNDSF---IAPLLNGGELYTVQIAVG 58

Query: 114 TPPQHVTVLVDTGSADLWVTGSMNPFCQ 141
           TPPQ++TV +DTGS+DLW   + NP+C+
Sbjct: 59  TPPQNLTVQLDTGSSDLWFVSASNPYCK 86

>KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score =  243 bits (621), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 130/346 (37%), Positives = 199/346 (57%), Gaps = 18/346 (5%)

Query: 243 DCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSD--LNVTGLSFAVAN 300
           +C+EYGTF+  +SSTF++  ++  I+Y D T   G W  D L L++  + +      VA+
Sbjct: 92  ECKEYGTFDYGQSSTFQDRNSALKINYQDGTKVDGRWGVDTLELNNGAIQLQNTMIGVAD 151

Query: 301 MTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLD 360
            ++S  GV+G+G P LE+T +  +     + Y Y NFPM LKQ G    T +++ LD+  
Sbjct: 152 SSDSVAGVIGLGFPGLETTNNVQANG---ESYTYANFPMQLKQQGVTDATVFAIALDN-- 206

Query: 361 ESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQ-NGERNXXXX 419
              G +LFGA+D  KY G LYT+P++N   + G + PI+ +VTL GIG+  +G       
Sbjct: 207 SYGGDILFGAVDEGKYIGGLYTLPVVN---SRGTATPIRMEVTLQGIGVDSDGGDQETFS 263

Query: 420 XXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGF 479
                   DSG+T+ Y P  +   +  ++ A+Y      YT+ C +   N NL+FDFGGF
Sbjct: 264 STPMLALVDSGSTMVYLPELIATAIYNKVGARYDGSSEMYTIDCGTNVENDNLIFDFGGF 323

Query: 480 HISGPLQDFLI---QTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXX 536
           HIS P+ +++I   ++S   C+  +  Q    V+LGD FL+ AYVV+DLD+Y I++    
Sbjct: 324 HISTPVSNYIITDQRSSNGQCLFGILSQSGNTVVLGDTFLSSAYVVFDLDHYEISM---- 379

Query: 537 XXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
                      ++ +T+ TIP A +AP+YS+TW+ N PV SGGNIF
Sbjct: 380 AQGNSNNGDGNVKDVTSGTIPNARKAPMYSQTWSTNAPVTSGGNIF 425

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 5/66 (7%)

Query: 82  QLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQ 141
           QL++R  EDG   + V +  Q  FYS++LAIGTP Q VTVL+DTGS+DLWVTG+ NP+CQ
Sbjct: 32  QLVRR--EDG---DSVHLGKQTGFYSIDLAIGTPSQKVTVLLDTGSSDLWVTGANNPYCQ 86

Query: 142 SSLNSR 147
           +SL+S 
Sbjct: 87  TSLSSE 92

>CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7
          Length = 505

 Score =  236 bits (602), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 136/360 (37%), Positives = 195/360 (54%), Gaps = 12/360 (3%)

Query: 235 IPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGL 294
           +P+S R LDC E+G FNSS S+TF +N T F ISY DS++A G WA D L L+ LN++GL
Sbjct: 106 VPKSLRNLDCAEFGLFNSSASTTFNSNKTEFFISYLDSSYAEGVWATDNLYLNGLNISGL 165

Query: 295 SFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSL 354
           +F +A  +NS+  VLG+GL  LE++Y           +QY NFP +LKQ GAI   TYSL
Sbjct: 166 NFGLAYFSNSSNSVLGVGLTPLEASYDTDIKQDDSPRFQYPNFPQILKQKGAISKVTYSL 225

Query: 355 FLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGER 414
           +L+D    +G +LFG +DHSKY GQLYT+P++N             +VTL G+G+++   
Sbjct: 226 YLNDTKSKYGQILFGGVDHSKYVGQLYTIPLVNSKYQKSPGVIADLEVTLNGLGIRDNTT 285

Query: 415 NXXXXXXXXXXXX--DSGTTISYFPTSVVELVARQINAQYSARLGFYTVP-CRSVSSNTN 471
           N              DSGT+ SY P ++ +++A Q+N     +     +P C S      
Sbjct: 286 NTNTTLYTQKLPALFDSGTSYSYVPYTMAQVIASQVNGTIDNKTEAIRLPKCPSKKDTRE 345

Query: 472 LVFDFGGFHISGPLQDFLIQTSQQTCILAM---APQESQHVILGDIFLTHAYVVYDLDNY 528
           +VF+F G  I+ PL+ F  Q     C L +    P     ++LGD FL   Y V+DL+  
Sbjct: 346 VVFNFNGVEIAIPLKQFY-QKKSGKCYLDLMVAPPNNGPGLLLGDTFLRQVYTVFDLEAQ 404

Query: 529 VIALXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTA-NRPVQSGGNIFAGNGT 587
            +++               I+    ST+P AI+AP Y  T++A +   Q  GNIF    T
Sbjct: 405 ELSIARANFNSSLPADVEEIK----STVPSAIKAPQYYNTFSAYDNATQVVGNIFDATAT 460

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 51/88 (57%), Gaps = 21/88 (23%)

Query: 57  YVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQS--FYSVELAIGT 114
           YV L FEK  GD              L+KRD       +DVK+ N Q    Y+++L++GT
Sbjct: 14  YVALDFEKSHGD-------------DLVKRD------VQDVKLINSQKAMLYNIQLSVGT 54

Query: 115 PPQHVTVLVDTGSADLWVTGSMNPFCQS 142
           PPQ++T  +DTGS+DLW   S NP+C++
Sbjct: 55  PPQNITAQLDTGSSDLWFPDSTNPYCKA 82

>SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {ON}
           some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 542

 Score =  226 bits (577), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 127/297 (42%), Positives = 175/297 (58%), Gaps = 8/297 (2%)

Query: 238 SERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFA 297
           ++  +DC  YGTF    S TF  + + F I+Y D+TFA+G WA+DV++  D  +  + FA
Sbjct: 108 TKSVVDCSRYGTFEKDNSLTFSQSDSRFQINYADNTFANGYWAKDVVSFGDNFIADMQFA 167

Query: 298 VANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLD 357
           VAN TNSTVGVLGIG   LES   G  GA       Y NFP+ LK +G I  T YSL+L+
Sbjct: 168 VANETNSTVGVLGIGFERLESV-KGYEGAPNT---YYQNFPLALKNNGVIDKTAYSLYLN 223

Query: 358 DLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQ-NGERNX 416
            LD S GS+LFG ID +KYTG LYT P++NI   S  + P +F VT+ GIG+Q +G    
Sbjct: 224 SLDSSSGSILFGGIDSNKYTGDLYTFPLVNI-HPSVVNKPAKFHVTVQGIGVQSSGSEQS 282

Query: 417 XXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDF 476
                      DSGTT+   P    + +A  +NA Y+   G YT+ C   + +T  +FDF
Sbjct: 283 ILMSTKYPALLDSGTTLLVAPQEFADSMANYVNATYNDLEGIYTMTCPPENDDTEFLFDF 342

Query: 477 GGFHISGPLQDFLIQ-TSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIAL 532
           G   I  PL++F++     + C   + P     +ILGD+FL+ AYVVYDL++Y ++L
Sbjct: 343 GDLKIKVPLKNFILAPEDNEYCGFGVLPT-VDTMILGDMFLSAAYVVYDLESYEVSL 398

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (72%), Gaps = 4/62 (6%)

Query: 81  NQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFC 140
           N L KR+    A    + + N+Q FY+ +L +GTPPQ++TVL+DTGS+DLWVTGS NP+C
Sbjct: 39  NSLWKRNQNSLA----LNLKNEQIFYAADLNVGTPPQNLTVLLDTGSSDLWVTGSDNPYC 94

Query: 141 QS 142
            S
Sbjct: 95  LS 96

>CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 508

 Score =  209 bits (532), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 125/352 (35%), Positives = 191/352 (54%), Gaps = 13/352 (3%)

Query: 235 IPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGL 294
           IP +ERT DC ++ TFNSS S+TFK+N T F I+YGD ++  GTW  D + L+   +  +
Sbjct: 113 IPYAERTFDCSDFKTFNSSSSNTFKSNDTDFFITYGDGSYVEGTWGTDQVALAGQTLENV 172

Query: 295 SFAVANMTNSTVGVLGIGLPALESTY----SGASGATQRQMYQYMNFPMVLKQSGAIHTT 350
           +FAVA +TN++ G+LGIGLP LES+     +  +  +  +   YMNFP  LK +  I+  
Sbjct: 173 TFAVAELTNNSYGLLGIGLPELESSITIDTAQLTNTSSVKKNPYMNFPESLKLNKLINKV 232

Query: 351 TYSLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQ 410
            YS++L+  ++  GS+LFGA+DH++Y G L TVP++   R+ G   P +  VTL G+  +
Sbjct: 233 VYSIYLNRTNDKFGSILFGAVDHNRYDGNLTTVPLVFSNRDFGTPRPNELMVTLNGMSFE 292

Query: 411 NGERNXXXXXXXXX---XXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVP-CRSV 466
             + N               D+G+T ++ P  V   +A   N  Y        +P C S 
Sbjct: 293 ATDGNVTQILNATSKFPALLDTGSTDTHLPVDVYNALAESTNGTYDQTQNKIRIPKCLSK 352

Query: 467 SSNTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLD 526
              T L F  GG +I  P ++ +++  +  C + +AP  S   ILGD  + +AY+V+DL+
Sbjct: 353 KDKTILNFSLGGVNIGVPYKE-MVKKIKGKCYINVAPTGSDFAILGDDVIRYAYMVFDLE 411

Query: 527 NYVIALXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSG 578
           +  I+L               IE++  STIP A RA  YSET++    V S 
Sbjct: 412 DREISL---AQASFNDTLPEDIEVVV-STIPGATRASAYSETYSPTFAVPSA 459

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 56/87 (64%), Gaps = 16/87 (18%)

Query: 57  YVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPP 116
           Y++LPF K T              N L KR ++D   Y +V++ N+Q FY VE++IG+  
Sbjct: 15  YLRLPFTKITD-------------NSLAKRADDD---YLNVQLDNEQIFYGVEVSIGSDK 58

Query: 117 QHVTVLVDTGSADLWVTGSMNPFCQSS 143
           Q++T+LVDTGS+D WV G+ NP+C+S+
Sbjct: 59  QNMTLLVDTGSSDFWVLGAQNPYCKSN 85

>NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa]
           {ON} Anc_7.182
          Length = 540

 Score =  209 bits (532), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 128/330 (38%), Positives = 175/330 (53%), Gaps = 13/330 (3%)

Query: 241 TLDCQEYGTFNSSRSSTFKNNYTS-FSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVA 299
           T+DC  + TFN S SS+FK   TS F   Y D TFA G+WA + L ++ ++V+ L F + 
Sbjct: 116 TIDCSSFMTFNKSLSSSFKTKGTSRFYAYYSDKTFADGSWATEKLTMNGVDVSSLQFGLG 175

Query: 300 NMTNSTV-GVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDD 358
           N   + V GVLGIG P  ES      G        Y NFP VLK  G I    YS+FL+ 
Sbjct: 176 NCVTTPVSGVLGIGFPRRES----VKGYDNAPNEFYPNFPQVLKNQGIIDVVAYSMFLNK 231

Query: 359 LDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGE--RNX 416
           L+   GS+LFGAID SKYTG L T PM+NI  +     P    V L G+G Q+    +  
Sbjct: 232 LESDTGSILFGAIDTSKYTGDLVTFPMLNIYPDVT-DKPATLMVILQGLGAQDNANCKAE 290

Query: 417 XXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPC--RSVSSNTNLVF 474
                      DSGTT+   P  + +++A  +NA +S   G Y + C  +   +NT+ +F
Sbjct: 291 TFVTSKIPVLLDSGTTLMGAPKEIADMMADFMNATFSEDEGIYIMECPTKETLANTDYIF 350

Query: 475 DFGGFHISGPLQDFLI--QTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIAL 532
           DFGG  I  PL +F++  Q+    C  A+ P +S  ++LGDIFL+ AYVV+DLDNY I+L
Sbjct: 351 DFGGVQIKVPLSNFILSAQSEGGPCGFAVLPDDSNTMVLGDIFLSSAYVVFDLDNYQISL 410

Query: 533 XXXXXXXXXXXXXXXIELITNSTIPRAIRA 562
                          I + ++  IP A  A
Sbjct: 411 AAANLDNNVSLEDSIINIPSDGNIPNAKMA 440

 Score = 67.0 bits (162), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 5/73 (6%)

Query: 71  ESATRNNKPLNQLLKRDNEDGAGYEDVKITN-QQSFYSVELAIGTPPQHVTVLVDTGSAD 129
           E   R++K  NQ  KR++  G+G+ ++++ + +Q++Y+  L IGTPPQ++TVL D+GS+D
Sbjct: 30  EPNLRSSK--NQYAKRNS--GSGHLEIELQHIEQTYYATTLEIGTPPQNLTVLFDSGSSD 85

Query: 130 LWVTGSMNPFCQS 142
           LWV  + NP+C+S
Sbjct: 86  LWVMDASNPYCES 98

>TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8.318
           YLR120C
          Length = 1000

 Score =  216 bits (549), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 124/346 (35%), Positives = 181/346 (52%), Gaps = 9/346 (2%)

Query: 238 SERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFA 297
           S+ + +C+ +G+F+ S+SSTF  N T F+I+Y       G W QD L +  +N TGLSF 
Sbjct: 111 SDGSFNCERFGSFSISKSSTFTKNSTEFAITYVSGNNCIGVWGQDNLIIGGVNATGLSFG 170

Query: 298 VANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLD 357
           V + T S+ G+LGIGLP  E+T  G     Q   Y+Y NFPMVLK  G I    YS++LD
Sbjct: 171 VVHTTTSSAGILGIGLPDTETTAVG-----QYGHYKYDNFPMVLKNKGIISHQGYSIYLD 225

Query: 358 DLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGL-QNGERNX 416
               ++G  L G +D SKYTG LY +P++N   N+ +S+P  F VTL G+GL  N     
Sbjct: 226 SSSSTYGEFLLGGVDTSKYTGTLYKLPLVN-WYNTYFSSPGDFHVTLQGLGLITNSGSAV 284

Query: 417 XXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDF 476
                      D+G+T++  P ++   +   +   YS+  G Y   C + +S   LVF+F
Sbjct: 285 TLTETKMAVILDTGSTVTGIPATLYNALLSSLGGYYSSTHGAYVFTCPTETS--KLVFNF 342

Query: 477 GGFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXX 536
           GG +   P+  F+       C L ++ +   + ILGD FL + Y  +DL+N  I L    
Sbjct: 343 GGINYKLPMSSFINTLGDNVCSLKVSSRSDSNFILGDDFLRNVYAAFDLENKEIGLAMAD 402

Query: 537 XXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
                        +   S IP A++AP YS TW     V +GG++F
Sbjct: 403 FDSSSNNKREDTVIAMESGIPDAVQAPEYSATWVTYEAVVTGGSMF 448

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 51/86 (59%), Gaps = 7/86 (8%)

Query: 56  KYVKLPFEKYTGDSFESATRN-NKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGT 114
           K   +PF KY  DS E    N +    +L+KRD ED      + +TN+ +FYS E+ +GT
Sbjct: 28  KAAVIPFRKYYADSLEELDYNTSTSETKLVKRDGED------IVLTNRNTFYSAEIEVGT 81

Query: 115 PPQHVTVLVDTGSADLWVTGSMNPFC 140
           P Q + V+VDTGS+DLWV G  N  C
Sbjct: 82  PAQTMNVIVDTGSSDLWVIGHDNLTC 107

>ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 506

 Score =  207 bits (528), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 127/345 (36%), Positives = 186/345 (53%), Gaps = 20/345 (5%)

Query: 244 CQEY-GTFNSSRSSTFKNNYT--SFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVAN 300
           CQ   G F+ + SS+F  N T   F I YGD+++ASG WA D L + D++V  ++ AVA+
Sbjct: 176 CQSSSGNFDPNSSSSFNKNDTVDGFFIEYGDNSYASGYWATDDLTVGDISVKDMTIAVAD 235

Query: 301 MTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLD 360
            TNS+V V GI    LES+     G   +  ++Y NFP +LK  G +    YSL+L+   
Sbjct: 236 DTNSSVAVFGISYRGLESS---VFGDNLQDPHEYENFPYLLKDQGIVKRNAYSLYLNSAG 292

Query: 361 ESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQ-FDVTLFGIGLQNGERNXXXX 419
            S G++LFG +DH+KY+G LYT+P++    +   S+P + F VT+ GIG++  E      
Sbjct: 293 ASDGNILFGGVDHNKYSGDLYTLPVLKGQED---SDPWERFVVTVQGIGIKGSETQNTLT 349

Query: 420 XXXXXXXXDSGTTISYFPTSVVELVARQINAQY--SARLGFYTVPCRSVSSNTNLVFDFG 477
                   DSGTT  Y P  V ++VA      +     +  Y + C   S +  +VF+FG
Sbjct: 350 TTPFIGLLDSGTTAVYLPEPVADMVANAYGGSFDDDPEVQSYVISCP--SDDEKIVFNFG 407

Query: 478 GFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXXX 537
           GF+I   L +++       CIL ++P      ILGD FL  +YVVYD+DN  I+L     
Sbjct: 408 GFNIETSLSNYITDNGNGQCILNISPTSDYMGILGDSFLRDSYVVYDMDNNEISL----- 462

Query: 538 XXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
                     +E IT   +P A +AP YS T++  +  Q+GGNIF
Sbjct: 463 AQANFDSTEDVEAIT-GPVPGATKAPGYSSTYSGPQTFQTGGNIF 506

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 47/84 (55%), Gaps = 7/84 (8%)

Query: 59  KLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPPQH 118
           K+PF K  G SF+ +        Q+   +   G   +++ I+NQ  +YS  + +GTP Q 
Sbjct: 31  KIPFSKRYGKSFDES-------RQISFSEKGTGGDDQEIDISNQNVYYSASIYLGTPGQE 83

Query: 119 VTVLVDTGSADLWVTGSMNPFCQS 142
           +T+L+DTGS+DLW+       CQS
Sbjct: 84  LTLLLDTGSSDLWIPQKGGYHCQS 107

>YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}
           YPS6Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance
          Length = 537

 Score =  207 bits (528), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 132/340 (38%), Positives = 189/340 (55%), Gaps = 15/340 (4%)

Query: 244 CQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANMT- 302
           C  +GTF++S SSTF+NN T F+ +YGD T+ +GT+  DV++  ++ +   +F V+N T 
Sbjct: 139 CSYWGTFDASNSSTFENNATFFNNTYGDGTYYAGTYGTDVVSFENITLNDFTFGVSNDTI 198

Query: 303 NSTVGVLGIGLPALESTYSGASG-ATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLDE 361
            +  G+LGI LP  E T       A  R  + Y NFPM LK  G I+   YSLFL+  D 
Sbjct: 199 GNPSGILGISLPIAEFTDGIEYALALNRTPFIYDNFPMELKNQGKINKIAYSLFLNGPDA 258

Query: 362 SHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGER-NXXXXX 420
             GS+LFGA+D SKYTGQLYT+PM+      G SNP    +T   + + + E  N     
Sbjct: 259 HFGSILFGAVDKSKYTGQLYTLPMLQAFNTLG-SNPGMI-ITAQSVAILDSESGNKTVSD 316

Query: 421 XXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFH 480
                  DSGTT SY PT + E + +  + +YS+    Y   C  V ++T L  DFGGF+
Sbjct: 317 IQFPVMLDSGTTFSYLPTEIAEAIGKSFDGEYSSDDQGYIFDCSKV-NDTLLSVDFGGFN 375

Query: 481 ISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXXXXXX 540
           IS  + +F + +++  C+L +   ES + +LGD FL  AYVVYDL+NY I++        
Sbjct: 376 ISANISNF-VTSAKDRCVLNVKQSESTY-MLGDAFLVDAYVVYDLENYEISI----AQAS 429

Query: 541 XXXXXXXIELITNSTIPRAIRAPLYSETWT--ANRPVQSG 578
                  IE+I++ T+P A  AP Y  TW      P+ +G
Sbjct: 430 FNNQEEDIEVISD-TVPGATPAPGYFSTWVYKPGSPIGTG 468

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 46/86 (53%), Gaps = 9/86 (10%)

Query: 57  YVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPP 116
           YVK P +K   D     T++   ++ + KR NE      +  + N    Y V++ IGTPP
Sbjct: 27  YVKFPVQK-LADIINICTQD---VSTVFKR-NE----VLNTTVINGIGVYVVKMEIGTPP 77

Query: 117 QHVTVLVDTGSADLWVTGSMNPFCQS 142
           Q + + +DTGS+D+ V  +   +C+S
Sbjct: 78  QTLYLQLDTGSSDMIVNNADIAYCKS 103

>ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 528

 Score =  206 bits (523), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 119/331 (35%), Positives = 170/331 (51%), Gaps = 9/331 (2%)

Query: 243 DCQEYGTFNSSRSSTFKNNYTS-FSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANM 301
           +C     F +  S TF  N T  + I Y D ++ASG W  D L L DL V  +SFAVAN 
Sbjct: 191 NCNATAFFEADNSKTFHRNRTDPYYIQYEDLSYASGYWGTDDLQLGDLQVHNVSFAVAND 250

Query: 302 TNSTVGVLGIGLPALESTYSGASGATQR--QMYQYMNFPMVLKQSGAIHTTTYSLFLDDL 359
           TNST  V GIG P  ES+++   G   R    ++Y NFP  LK  G I    YSL+L+  
Sbjct: 251 TNSTTPVFGIGFPGGESSFASV-GPEYRAAHPHEYANFPQTLKNQGIIQRVAYSLYLNSP 309

Query: 360 DESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQ-FDVTLFGIGLQNGERNXXX 418
           + ++G+VLFG +DHS+Y GQLYT+P++ +   +   +P     +TL G+ +         
Sbjct: 310 NSTYGNVLFGGVDHSQYQGQLYTLPILQLGNLTSDGDPYNTLAITLQGVSVTRRGSKHKV 369

Query: 419 XXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGG 478
                    DSGTT  Y P  + + +A + +         Y + C     N  + FDFGG
Sbjct: 370 KTKPIPVVLDSGTTAMYLPYKLAKSIASRYHGILGPEDQGYIIDCPKSGDNDYITFDFGG 429

Query: 479 FHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXXXX 538
             I   +++++ + S+  C+L + P      + GD+FLT AYVVYDL+   I+L      
Sbjct: 430 VTIKTDIRNYIFEQSENKCLLGIIPNSDILAVFGDVFLTDAYVVYDLEGKEISL----AQ 485

Query: 539 XXXXXXXXXIELITNSTIPRAIRAPLYSETW 569
                    IE IT+S +P A RAP YS+TW
Sbjct: 486 ASFNSSSEQIEAITSSGVPGAKRAPGYSKTW 516

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 3/96 (3%)

Query: 58  VKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPPQ 117
            K+ F K  G SF  AT + K +N L +  N      E     N  ++YSV +++GTP Q
Sbjct: 32  AKIGFNKVYGKSFSEATADRKYVN-LFRNKNISDDNDEVALQNNANTYYSVNISLGTPGQ 90

Query: 118 HVTVLVDTGSADLWVTGSMNPFCQSSLNSRNVVIKR 153
           ++T+ +DTGS+DLWV       C    N  N+  KR
Sbjct: 91  NMTIQLDTGSSDLWVIKPGGLQCTD--NDTNLFKKR 124

>Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)
          Length = 342

 Score =  199 bits (506), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 125/321 (38%), Positives = 177/321 (55%), Gaps = 13/321 (4%)

Query: 261 NYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANMTNSTVGVLGIGLPALESTY 320
           N T F  +YGD T+  GT+  DV++L ++ +   SF VAN T +  G+LGI LPA E+T+
Sbjct: 1   NDTQFDETYGDGTYYRGTYGTDVVSLGNITLESFSFGVANNTENQGGILGISLPAGENTH 60

Query: 321 SGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLDESHGSVLFGAIDHSKYTGQL 380
           S   GA     ++Y NFPM LK  G I    YSLFL++     GS+LFGA+D SKY+GQL
Sbjct: 61  S-LGGAYNTTPFEYENFPMALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQL 119

Query: 381 YTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGER-NXXXXXXXXXXXXDSGTTISYFPTS 439
           YT+PM+         +P  F VT   + + NG+  N            DSGTT S  PT 
Sbjct: 120 YTLPMLQAYDTLDSVSPGMF-VTAQSVAVLNGDSGNKTVSKVRFPVLFDSGTTYSSLPTE 178

Query: 440 VVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQDFLIQTSQQTCIL 499
           V   + +  + +YS+    YT  C  V  +T L  DFGGF+IS  + +F+ +T    C+L
Sbjct: 179 VAHAIGKSFDGKYSSGDQGYTFDCSKV-KDTLLSIDFGGFNISANISNFVTRTKDH-CLL 236

Query: 500 AMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXXXXXXXXXXXXXIELITNSTIPRA 559
            +   +S  V LGD FL  AYVV+DL+++ +++               IE+I++  +P A
Sbjct: 237 NIEAADSGFV-LGDAFLVDAYVVFDLESHEVSI----AQASFDDKKEEIEVISDR-VPGA 290

Query: 560 IRAPLYSETW--TANRPVQSG 578
           IRAP YS TW  T   P+ +G
Sbjct: 291 IRAPGYSSTWVYTPGSPIGTG 311

>CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
          Length = 539

 Score =  204 bits (519), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 117/362 (32%), Positives = 201/362 (55%), Gaps = 12/362 (3%)

Query: 233 NDIPRSERTLDCQEYG-TFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNV 291
           + + +  RT DC  +G   +S  SS   N+ + F + Y D T+ASG W  D   L+  NV
Sbjct: 111 DQVAKKLRTFDCDAFGLFNSSMSSSFKSNDSSEFFVKYEDGTYASGMWGTDTFKLNHHNV 170

Query: 292 TGLSFAVANMTNSTVGVLGIGLPALESTYSGASGA-TQRQMYQYMNFPMVLKQSGAIHTT 350
           + ++FA+AN+ N+++GVLG+G PA E+T   + G+   ++ YQY NFP+ LK++  I   
Sbjct: 171 SNITFALANIANASMGVLGVGFPAEETTDDPSPGSLIDKEHYQYDNFPIALKRTRTIKKV 230

Query: 351 TYSLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQ 410
           +YS+FL+D +   G +LFG +DHSKY G L+TVPM+N +     +   + ++TL G+G +
Sbjct: 231 SYSIFLNDTNSKKGVILFGGVDHSKYQGTLWTVPMVNNLLTLNQTTTSRPEITLNGLGFR 290

Query: 411 NGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTV-PCRSVSSN 469
           + ++N            D+GTT++Y P  VV+++A+++N    ++ G   +  C +   N
Sbjct: 291 DDKKNVTLWGEKIPVLLDTGTTLAYAPKQVVDVIAKRVNGTIDSKTGGIKLKKCPNAKDN 350

Query: 470 TNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQH---VILGDIFLTHAYVVYDLD 526
           + L+F+F G  I   L + +++  +  C L +   E      ++LGDIF+ H Y V++++
Sbjct: 351 SELIFNFAGAEIPVSLLN-MVEKRKGKCYLEIRYHEELSKTGMLLGDIFMRHVYSVFNME 409

Query: 527 NYVIALXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETW-TANRPVQSGGNIFAGN 585
           +  ++                IE I  S +P A++AP Y  T+ ++N P     +IFA  
Sbjct: 410 DMEVSF---AVANGNDSAPLQIEAII-SDVPSAVKAPQYYNTFASSNLPSTVTNDIFAST 465

Query: 586 GT 587
            T
Sbjct: 466 AT 467

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 47/87 (54%), Gaps = 13/87 (14%)

Query: 57  YVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDG-AGYEDVKITNQQSF-YSVELAIGT 114
           Y++L FE+ T                L KR   +G A   DV I       Y+V+L +GT
Sbjct: 13  YLQLDFERQTAQDV-----------ALAKRHTSNGVANAMDVPIEQIGDLMYTVQLHVGT 61

Query: 115 PPQHVTVLVDTGSADLWVTGSMNPFCQ 141
           PPQ+VTV +DTGS+DLW   + NP+C+
Sbjct: 62  PPQNVTVQLDTGSSDLWFPVASNPYCK 88

>Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)
          Length = 464

 Score =  201 bits (512), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 120/332 (36%), Positives = 182/332 (54%), Gaps = 12/332 (3%)

Query: 244 CQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANMTN 303
           C  +GTF+ + SSTFK N T F+ISY D+ + +GT+  DV++L ++ ++  +F V+N T 
Sbjct: 137 CSYWGTFSPNVSSTFKYNETIFNISYADNMYYAGTYGTDVVSLGNITLSNFTFGVSNDTK 196

Query: 304 STVGVLGIGLPALESTYSGASG-ATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLDES 362
            + G+LG+ LP++E T       ++    + Y NFPM LK  G I    YSLFL++    
Sbjct: 197 MSYGILGVSLPSVEETDDIEDALSSNTTPFVYENFPMALKSQGKIEKIAYSLFLNEPSAR 256

Query: 363 HGSVLFGAIDHSKYTGQLYTVPMINIMR--NSGYSNPIQFDVTLFGIGLQNGERNXXXXX 420
            GS+LFGA+D SKY+GQLYT+PM+      ++ YS    F        + +   N     
Sbjct: 257 FGSILFGAVDKSKYSGQLYTLPMLQAYNTLDALYSG--MFVTAQSAAIIDSKSGNKTVSE 314

Query: 421 XXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFH 480
                  DSGT+ S  PT + + + R  + +YS+    Y   C  V +NT L  DFGGF+
Sbjct: 315 VQFPVLFDSGTSTSVLPTEIADAIGRSFDGKYSSDDEGYIFDCSKV-NNTQLSIDFGGFN 373

Query: 481 ISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXXXXXX 540
           IS  + +F+   ++  C+L + P ++  V LGD FL   YVVYDL+N+ +++        
Sbjct: 374 ISANISNFVTPLTKDHCVLQILPSDTVSV-LGDAFLVDTYVVYDLENHEVSV----AQAS 428

Query: 541 XXXXXXXIELITNSTIPRAIRAPLYSETWTAN 572
                  IE+I++S +P A  AP YS TW  N
Sbjct: 429 FNNEEEDIEIISDS-VPGATPAPGYSSTWRYN 459

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 45/95 (47%), Gaps = 14/95 (14%)

Query: 57  YVKLPFEKYTG--DSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGT 114
           YVKLP +K     +S    ++ ++  N  L            + + +    Y VE+ IGT
Sbjct: 27  YVKLPVQKLANIPNSASGISKRSEAFNSTL------------INMFSSAHIYVVEMEIGT 74

Query: 115 PPQHVTVLVDTGSADLWVTGSMNPFCQSSLNSRNV 149
           PPQ     +DTGS+D+    + + +C+S  +  N+
Sbjct: 75  PPQAAYFQLDTGSSDMCANEADSSYCESFTDESNI 109

>Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C
           (REAL)
          Length = 540

 Score =  200 bits (508), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 123/347 (35%), Positives = 191/347 (55%), Gaps = 13/347 (3%)

Query: 236 PRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLS 295
           P +     C  +GTF+ + SSTFK N T F+++YGD+++ +GT+  DV++L ++ ++  +
Sbjct: 133 PSAAYNAPCSYWGTFSPNSSSTFKYNETIFNLTYGDNSYYAGTYGTDVVSLGNITLSNFT 192

Query: 296 FAVANMTNSTVGVLGIGLPALESTYSGASG-ATQRQMYQYMNFPMVLKQSGAIHTTTYSL 354
           F V+N T +  G+LG+ LP+ E T       ++    + Y NFPM LK  G I    YSL
Sbjct: 193 FGVSNDTTNNGGILGVSLPSAEVTDDTEDALSSNTTPFIYNNFPMALKSQGKIKKIAYSL 252

Query: 355 FLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGER 414
           FL++     GS+LFGA+D S+Y+GQLYT+PM+        ++   F VT   + + + + 
Sbjct: 253 FLNEPSARFGSILFGAVDKSEYSGQLYTLPMLQAYNTLDATDAGMF-VTAQSVAILDSKS 311

Query: 415 -NXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLV 473
            N            DSGT+ S  PT + + + R  + +YS+    Y   C  V +NT L 
Sbjct: 312 GNKTVSEVQFPVLFDSGTSTSVLPTKIADAIGRSFDGKYSSDDQGYIFDCAKV-NNTLLS 370

Query: 474 FDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALX 533
           FDFGGF+IS  + +F +  ++  CIL + P ++  V LGD FL   YVVYDL+N+ +++ 
Sbjct: 371 FDFGGFNISANISNF-VTPAKDHCILQILPSDTIFV-LGDAFLVDTYVVYDLENHEVSV- 427

Query: 534 XXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETW--TANRPVQSG 578
                         I +I++S +P A  AP YS TW  T   P+ SG
Sbjct: 428 ---AQASFDNKEEDIGIISDS-VPGATPAPGYSSTWRYTPGSPIGSG 470

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 28/44 (63%)

Query: 106 YSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLNSRNV 149
           Y V++ IGTPPQ   + +DTGS+D+ +  +   +C+S  +  N+
Sbjct: 70  YVVKMEIGTPPQTAYLQLDTGSSDMCINEADAAYCESLADENNI 113

>KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa]
           {ON} 
          Length = 531

 Score =  192 bits (487), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 127/339 (37%), Positives = 185/339 (54%), Gaps = 16/339 (4%)

Query: 247 YGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANMTNSTV 306
           YG F+   S++ K N T FS  Y D T A G W  D + L D  V+ ++FAV N T+S  
Sbjct: 109 YGVFSPKDSTSLKFNGTEFSTQYADGTTAYGEWCYDTVALGDTTVSNVTFAVVNDTDSNF 168

Query: 307 GVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLDESHGSV 366
           GVLG+GL  LE+TY+ A  +     YQY NFP+ L + G I    YSL+L+  D S G+V
Sbjct: 169 GVLGLGLTGLEATYTNALSSP----YQYDNFPVKLVRQGLIQANAYSLYLNKADASSGNV 224

Query: 367 LFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXXXXXXXXXXX 426
           LFGA+DH+KYTG L+T+P +N + + GY++ I+F VTL G+ L   +             
Sbjct: 225 LFGAVDHAKYTGTLHTIPFVNTLESLGYNSVIEFHVTLDGMDLSTNDGQTTLTTSKFPVL 284

Query: 427 XDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQ 486
            DSG T SY P ++++ +A QI A YS     Y + C S   +T + ++FGGF+I  PL 
Sbjct: 285 VDSGNTFSYLPDNLLQQIASQIGATYSNEYVGYVLTCPSEDDDTVISYNFGGFNIDTPLS 344

Query: 487 DFLIQ--TSQQTCILAMAPQESQHVILGDIFLTHAYV--VYDLDNYVIALXXXXXXXXXX 542
             + +      TCIL +AP  S+   LGD FL + Y    + +++  +A           
Sbjct: 345 GSVTELGDDSNTCILMIAPSGSEFGQLGDTFLENVYASSTWTIESLSLA--------QAQ 396

Query: 543 XXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNI 581
                   I +S+IP AI+A  YS+ W+A+    + GN+
Sbjct: 397 YTDEEEIEIISSSIPGAIKAAGYSDIWSASAKNSTSGNV 435

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 52/78 (66%), Gaps = 6/78 (7%)

Query: 57  YVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPP 116
           +V + F +  G S ++A  + + ++ + + +N     YE V++ N+  FYS++LAIG+  
Sbjct: 31  FVSMNFNRLYGASPDTAV-SKRSMSHIKRSEN-----YEQVRLKNEACFYSMDLAIGSNH 84

Query: 117 QHVTVLVDTGSADLWVTG 134
           Q+VTVLVDTGS+DLWV G
Sbjct: 85  QNVTVLVDTGSSDLWVPG 102

>Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR039C
           (REAL)
          Length = 387

 Score =  187 bits (475), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 118/336 (35%), Positives = 177/336 (52%), Gaps = 34/336 (10%)

Query: 258 FKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANMTNSTVGVLGIGLPALE 317
           FK N T F+I+Y D+++ +GT+  D+++L D+ ++  +F V+N T    G+LGI LP+ E
Sbjct: 1   FKYNETIFNITYDDNSYYAGTFGTDIVSLGDITLSNFTFGVSNDTTINGGILGISLPSAE 60

Query: 318 STYSGASG-ATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLDESHGSVLFGAIDHSKY 376
            T SG    ++    + Y NFPM LK  G I    YSLFL++ +   GS+LFGA+D SKY
Sbjct: 61  ITDSGQGALSSNTTPFAYDNFPMALKNQGKIEKIAYSLFLNEPNARFGSILFGAVDKSKY 120

Query: 377 TGQLYTVPMINIMRNSGYSNPIQFDVTLFGIG------------LQNGERNXXXXXXXXX 424
           TGQLYT+PM+                TL  +G            L +   N         
Sbjct: 121 TGQLYTLPMLQAYN------------TLDALGGGMLVTAQSVAILDSISGNKTVSEVQFP 168

Query: 425 XXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGP 484
              DSGT+ S  PT + + + R  + +YS+    Y   C  V +NT L  DFGGF+IS  
Sbjct: 169 VLFDSGTSTSVLPTEIADAIGRSFDGKYSSDDEGYIFDCSKV-NNTQLSIDFGGFNISAN 227

Query: 485 LQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXXXXXXXXXX 544
           + +F+   ++  C+L + P ++  V LGD FL   YVVYDL+++ +++            
Sbjct: 228 ISNFVTPLTKDHCVLQILPSDTVSV-LGDAFLVDTYVVYDLESHEVSV----AQASFNNE 282

Query: 545 XXXIELITNSTIPRAIRAPLYSETW--TANRPVQSG 578
              IE+I++S +P A  AP YS TW  T   P+ +G
Sbjct: 283 EEDIEIISDS-VPGATPAPGYSSTWVYTPGGPIGTG 317

>KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]
           {ON} some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease
          Length = 511

 Score =  187 bits (475), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 108/297 (36%), Positives = 160/297 (53%), Gaps = 15/297 (5%)

Query: 242 LDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANM 301
           LDC + G F+   S +      +FS  Y D +++ G W  D ++++D  V  L FAVAN+
Sbjct: 116 LDCDKIGVFDPGSSYSLSATGYNFSTQYFDGSYSDGFWVVDDISIADQQVPDLQFAVANI 175

Query: 302 TNSTVGVLGIGLPALEST--YSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDL 359
           +++  GVLG+GLP LE+   Y GA  A       Y NFP  LK +  I+   YSL+ D  
Sbjct: 176 SSAPSGVLGVGLPRLEAVRGYDGAPNA------NYDNFPQTLKSNRLINRVLYSLYFDSG 229

Query: 360 DESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGL--QNGERNXX 417
           D   G+VLFG ID  KY G LYT+P++NI        P  FD+TL G+G+  ++  ++  
Sbjct: 230 DLESGTVLFGGIDEKKYDGVLYTLPLVNIYEQ--IDEPAAFDITLQGLGIRSESNCKDTV 287

Query: 418 XXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFG 477
                     DSG+TI   P   +E +A+++ A +S   G Y + C + + +    FDFG
Sbjct: 288 IAHKKAPALLDSGSTIMGAPQEALESIAQELGAAFSESDGLYVLDCPASNDDRTFYFDFG 347

Query: 478 GFHISGPLQD--FLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIAL 532
              +  P+ D  +L ++ Q  C LA+     +  ILGD+ L  AYVVYDLDN  I++
Sbjct: 348 ELKLKVPIHDLLYLPESGQNYCGLAII-ASGEEWILGDLVLKSAYVVYDLDNLEISI 403

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 29/43 (67%)

Query: 98  KITNQQSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFC 140
           K+  Q  FY+VEL +GTP Q +  + DTGS+DLWV    NPFC
Sbjct: 52  KLNPQDYFYTVELGVGTPSQKINCIFDTGSSDLWVPAKSNPFC 94

>Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W
           (REAL)
          Length = 593

 Score =  186 bits (471), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 120/349 (34%), Positives = 175/349 (50%), Gaps = 15/349 (4%)

Query: 241 TLDCQEYGTFNSSRSSTFKN-NYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVA 299
           ++DCQ   T++   SST++N +   F I Y D TFA GTW  + +++  + +  + F +A
Sbjct: 101 SVDCQSMVTYSEGNSSTYQNLDNGRFYIIYADGTFADGTWGTETVSIDGIVIPNIQFGLA 160

Query: 300 NMTNSTV-GVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDD 358
               + V GVLGIG P  ES   G  GA  +    Y NFP +LK    I    YSLFL+ 
Sbjct: 161 KYATTPVSGVLGIGFPRRESV-KGYEGAPNKY---YPNFPQILKSEQIIDVVAYSLFLNS 216

Query: 359 LDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXXX 418
            +   GS++FGAID SK++G L+T PM+N   N     P    +T+ G+G QN       
Sbjct: 217 PESGTGSIIFGAIDESKFSGDLFTFPMVNEYPNI-VDTPATLAMTIQGLGAQNKNSCEYE 275

Query: 419 XXXXXX--XXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDF 476
                      DSGT++   P  + + +A  +NA YSA  G Y + C + +      FDF
Sbjct: 276 TFMTTKYPVLLDSGTSLLNAPKVIADKMASFVNATYSAEEGIYILDCPAFADEIEYTFDF 335

Query: 477 GGFHISGPLQDFLIQTSQQT--CILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXX 534
           G   IS PL   ++    +   C  A+ P  +  ++LGD+FL+ AYVV+DLDNY I+L  
Sbjct: 336 GDLKISVPLTSLILSPEAEGGYCGFAVQPT-NDSMVLGDVFLSSAYVVFDLDNYKISL-A 393

Query: 535 XXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIFA 583
                        + +  + +IP    A   +E WTAN P     NIF+
Sbjct: 394 QANWDVSEITTKLVNVRADGSIPGGKTAT--AEPWTANEPFTVTSNIFS 440

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 90  DGAGYEDVKITNQQS-FYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFC 140
           DG G  +  +  ++  +Y+  L IGTP Q +TVL DTGSAD W+  S NPFC
Sbjct: 28  DGTGRLEFSLQRKEDMYYATTLDIGTPSQQLTVLFDTGSADFWIMDSSNPFC 79

>ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]
           {ON} weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 521

 Score =  184 bits (466), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 124/351 (35%), Positives = 183/351 (52%), Gaps = 17/351 (4%)

Query: 240 RTLDCQEYGTFNSSRSSTFKN-NYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAV 298
            T+DCQ     + + SS F++ N   F I+Y D +F  G WA D ++ +  +++GL F V
Sbjct: 102 ETIDCQGLTALDVNSSSQFRDLNVGRFYINYTDGSFDDGYWATDEVSAAGAHISGLQFGV 161

Query: 299 ANMTNSTV-GVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLD 357
           A   +  + G+LG+G P  ES   G  GA  +    Y NFP +LK+ G I    YS++L+
Sbjct: 162 AQYASEEIPGILGLGFPRRESV-RGYPGAPNKF---YDNFPQMLKKDGIIDVVAYSMYLN 217

Query: 358 DLDESHG-SVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGE--R 414
           D + S G SVLFG +D SKY+G LYT PM N   N   S P    VTL G G Q     R
Sbjct: 218 DPNGSGGGSVLFGGVDPSKYSGDLYTFPMANQYPNI-VSKPATLAVTLQGFGAQKKSEGR 276

Query: 415 NXXXXXXXXXXXXDSGTTISYFPTSVVELVARQI--NAQYSARLGFYTVPCRSVSSNTNL 472
                        DSGT++   P  VV  +A  I  NA++S   G Y + C     +T  
Sbjct: 277 QETFDTNNYAVLLDSGTSLMGAPEEVVSKMAHFINKNARFSEDDGIYVMDCPPKDDDTEF 336

Query: 473 VFDFGGFHISGPLQDFLIQTSQQT-CILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIA 531
           VFDFG   I+ P+   ++  S ++ C L + P++     LGD+FL++AY+V+DLDNY ++
Sbjct: 337 VFDFGDLQIAVPVSTLILPPSGESYCGLGVLPKDGTWT-LGDVFLSYAYLVFDLDNYKVS 395

Query: 532 LXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
           +               I++ T+ TIP A  A   ++ W+++ P    G+IF
Sbjct: 396 M-AKAKFSGDGDQSPQIKIQTDGTIPGAKSAS--AKPWSSSEPSTVSGSIF 443

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 23/42 (54%), Positives = 29/42 (69%)

Query: 105 FYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLNS 146
           FYS  L IG+P Q + ++VD+GSAD WV  S NPFC S+  S
Sbjct: 46  FYSTTLEIGSPAQKLDLVVDSGSADTWVMASTNPFCSSNAKS 87

>YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspartyl
           protease secreted into the periplasmic space of mating
           type a cells, helps cells find mating partners, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest
          Length = 587

 Score =  182 bits (463), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 118/352 (33%), Positives = 177/352 (50%), Gaps = 15/352 (4%)

Query: 241 TLDCQEYGTFNSSRSSTFKN-NYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVA 299
           ++DC+   T+N  RSST++      F I+Y D TFA G+W  + ++++ +++  + F VA
Sbjct: 101 SIDCRSMSTYNEHRSSTYQYLENGRFYITYADGTFADGSWGTETVSINGIDIPNIQFGVA 160

Query: 300 NMTNSTV-GVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDD 358
               + V GVLGIG P  ES   G  GA       Y NFP +LK    I    YSLFL+ 
Sbjct: 161 KYATTPVSGVLGIGFPRRESV-KGYEGAPNEY---YPNFPQILKSEKIIDVVAYSLFLNS 216

Query: 359 LDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGE--RNX 416
            D   GS++FGAID SK++G L+T PM+N    +    P    +T+ G+G QN     + 
Sbjct: 217 PDSGTGSIVFGAIDESKFSGDLFTFPMVN-EYPTIVDAPATLAMTIQGLGAQNKSSCEHE 275

Query: 417 XXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDF 476
                      DSGT++   P  + + +A  +NA YS   G Y + C     +    FDF
Sbjct: 276 TFTTTKYPVLLDSGTSLLNAPKVIADKMASFVNASYSEEEGIYILDCPVSVGDVEYNFDF 335

Query: 477 GGFHISGPLQDFLI--QTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXX 534
           G   IS PL   ++  +T    C  A+ P  +  ++LGD+FL+ AYVV+DLDNY I+L  
Sbjct: 336 GDLQISVPLSSLILSPETEGSYCGFAVQPT-NDSMVLGDVFLSSAYVVFDLDNYKISL-A 393

Query: 535 XXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIFAGNG 586
                        + + T+ +I  A  A   +E W+ N P     +I++  G
Sbjct: 394 QANWNASEVSKKLVNIQTDGSISGAKIAT--AEPWSTNEPFTVTSDIYSSTG 443

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 1/52 (1%)

Query: 90  DGAGYEDVKITNQQS-FYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFC 140
           DG G+ +  + +++  +Y+  L IGTP Q +TVL DTGSAD WV  S NPFC
Sbjct: 28  DGTGHLEFLLQHEEEMYYATTLDIGTPSQSLTVLFDTGSADFWVMDSSNPFC 79

>NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {ON}
           Anc_7.182
          Length = 547

 Score =  181 bits (459), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 121/383 (31%), Positives = 191/383 (49%), Gaps = 25/383 (6%)

Query: 233 NDIPRSERTLDCQEYGTFNSSRSSTFK---NNYTSFSISYGDSTFASGTWAQDVLNLSDL 289
           ND+     T+DC  +  +N   SST++   N+ + F + Y D +F  G W+++ + + + 
Sbjct: 105 NDLITQNLTIDCSYFNKYNPEISSTYQKLPNDNSRFYLQYTDGSFEDGIWSKETVQIDNY 164

Query: 290 NVTGLSFAVANMTNSTV-GVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIH 348
           N+T L  AVAN   + V G+LGI  P  ES   G  GA       Y NFP VLK    I 
Sbjct: 165 NITSLQLAVANYATTPVGGLLGISFPRRESV-KGYDGALNE---YYPNFPQVLKNENIID 220

Query: 349 TTTYSLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIG 408
              YS++L+DL++  GS+LFGAID SK+ G + T PM+N+  N     P    +T+ G+ 
Sbjct: 221 IVLYSMYLNDLNQD-GSLLFGAIDTSKFEGDMITYPMVNVYPNV-VDKPATLALTIQGVA 278

Query: 409 LQNGE---RNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSA--RLGFYTVPC 463
            QN     +N            DSGTT+   P  + + +A  +NA YS   R+     P 
Sbjct: 279 AQNTNDCTQNETFMTSKFPVLLDSGTTLMSAPKELADKMADFVNATYSEDDRIYILNCPS 338

Query: 464 RSVSSNTNLVFDFGGFHISGPLQDFLIQTSQQT--CILAMAPQ-ESQHVILGDIFLTHAY 520
           + V ++   +FDFGG  +  PL+ F++ +   +  C   + P+  +  ++LGDIFL+  Y
Sbjct: 339 QEVLNDIEYIFDFGGLQVKIPLEKFILPSDDGSGPCAFGVLPETTTDRMVLGDIFLSFVY 398

Query: 521 VVYDLDNYVIALXX-XXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGG 579
            V+DLD+Y I+L                I + +N  IP A  A +  + W+ + P+    
Sbjct: 399 AVFDLDHYQISLANINKNANSESNEDSIINIPSNGAIPGAKVATV--KPWSTHEPITVTT 456

Query: 580 NIF----AGNGTVIYNQGSGSMT 598
           NI     A + + I+ + S  +T
Sbjct: 457 NIVSSCKAPSHSTIHKESSSKLT 479

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 51/70 (72%), Gaps = 2/70 (2%)

Query: 72  SATRNNKPLNQLLKRDNEDGAGYEDVKITN-QQSFYSVELAIGTPPQHVTVLVDTGSADL 130
           S+  +++PL+  + + N D +G+  +K+ + QQ++Y+  L +GTPPQ++TVL+D+GS+D 
Sbjct: 22  SSNVSSRPLSNRINKRN-DISGHLHMKLEHIQQTYYATTLQVGTPPQNITVLLDSGSSDF 80

Query: 131 WVTGSMNPFC 140
           W+  S NPFC
Sbjct: 81  WLMDSKNPFC 90

>Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W
           (REAL)
          Length = 516

 Score =  180 bits (456), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 115/349 (32%), Positives = 178/349 (51%), Gaps = 15/349 (4%)

Query: 241 TLDCQEYGTFNSSRSSTFKN-NYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVA 299
           ++DC    T+N + SST+++ +   F I Y D TF+ G+W ++ ++++ +++  + F +A
Sbjct: 101 SVDCSSMSTYNENSSSTYQDLDNGRFYIIYADETFSDGSWGKETVSVNGIDIPDIQFGLA 160

Query: 300 NMTNSTV-GVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDD 358
               + V GVLGIG P  ES   G  GA  +    Y NFP +LK    I    YSLFL+ 
Sbjct: 161 KYATTPVSGVLGIGFPRRESV-KGYEGAPDKY---YPNFPQLLKSEQIIDVVAYSLFLNS 216

Query: 359 LDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQN--GERNX 416
            D   GS++FGAID SK+ G L T PM+N    +    P    +T+ G+G QN  G    
Sbjct: 217 PDSGMGSIVFGAIDESKFYGDLLTFPMVN-EYPTIVDAPATLAMTIQGLGAQNKSGCERE 275

Query: 417 XXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDF 476
                      DSGT++   P ++ + +A  +NA YSA  G Y + C   + +    FDF
Sbjct: 276 TFMTTKYPVLLDSGTSLLNAPKTIADKMASFVNASYSADEGIYILNCPDSADDIEYTFDF 335

Query: 477 GGFHISGPLQDFLIQTSQQT--CILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXX 534
           G   I+ PL   ++    +   C  A+ P  +  ++LGD+FL+ AYVV+DLDNY I+L  
Sbjct: 336 GDLQINVPLTSLILSPEVEGGYCGFAVQPT-NDSMVLGDVFLSSAYVVFDLDNYKISL-A 393

Query: 535 XXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIFA 583
                        I + T+ +IP    A   +E W+ N P     +I++
Sbjct: 394 QANWNASEDSKQVINIPTDGSIPGGKSA--TAEPWSTNEPFTVTSDIYS 440

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (64%), Gaps = 1/57 (1%)

Query: 90  DGAGYEDVKI-TNQQSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLN 145
           DG+G+ ++ +   +Q +Y+  L IGTP Q +TVL DTGSAD WV  S NPFC    N
Sbjct: 28  DGSGHLELSLQREEQMYYATTLDIGTPSQQLTVLFDTGSADFWVMDSSNPFCSPKSN 84

>TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.182
           YIL015W
          Length = 552

 Score =  178 bits (451), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 121/357 (33%), Positives = 177/357 (49%), Gaps = 15/357 (4%)

Query: 242 LDCQEYGTFNSSRSSTFKN-NYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVAN 300
           +DC+  GTF+ + SS+F+  +   F I Y D +FA G WA++ L L+ ++++ L F VA+
Sbjct: 122 IDCKALGTFDYNGSSSFERLDIGRFYIKYSDESFADGFWAKEKLRLNGIDISTLQFGVAD 181

Query: 301 MTNSTVG-VLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDL 359
                VG VLGIG P  ES      G        Y NFP VLK  G I    YS+FL+++
Sbjct: 182 YATVPVGGVLGIGFPRRES----VKGYDDAPNEFYPNFPQVLKNEGVIGVAAYSMFLNEV 237

Query: 360 DESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGE--RNXX 417
               GS+LFGA+D +KYTG LYT PM+N   N     P    +TL  +G ++    +   
Sbjct: 238 SSDAGSILFGAVDPTKYTGSLYTFPMVNEYPNV-VDKPATLAMTLQALGAKSDSSCKYKT 296

Query: 418 XXXXXXXXXXDSGTTISYFPTSVVELVARQI-NAQYSARLGFYTVPCRSVSSNTNLVFDF 476
                     DSGTT+   P  + E +A       Y+   G +   C S   +T  +FDF
Sbjct: 297 FTTTKQAVLLDSGTTLMTAPPEIAEEMAFFCWGPTYNESEGIFYFDCPSDDDDTEFIFDF 356

Query: 477 GGFHISGPLQDFLIQTS-QQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXX 535
           G   I+ PL   +I +S    C   + P  S  + LG IFL+ AYVVYDLDNY I++   
Sbjct: 357 GDLKITLPLASLVISSSGDGHCGFGLTPA-SYSMTLGAIFLSSAYVVYDLDNYQISI-AQ 414

Query: 536 XXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIFAGNGTVIYNQ 592
                       + +  + TI  A +A   +  WT + PV+   ++F  + + I +Q
Sbjct: 415 AKWDGNPSQKSRVRIPKDGTIYGATKAT--ATPWTTDEPVKVDYDMFEDHSSCIASQ 469

>Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar to
           Ashbya gossypii AGR240W
          Length = 518

 Score =  177 bits (448), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 107/295 (36%), Positives = 160/295 (54%), Gaps = 14/295 (4%)

Query: 244 CQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANMTN 303
           C    T+N  RSSTF      F I Y + TF+ G WA+D L + + +V+GL F V+N++N
Sbjct: 110 CSSSRTYNFQRSSTFTPTGYKFFIDYVN-TFSRGIWAKDRLVIGNADVSGLQFGVSNISN 168

Query: 304 STV-GVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLDES 362
           +T+ G+LG+G   LES   G SGA  R    Y N PM+LK+SG I    YS+FL+ L+ +
Sbjct: 169 TTINGILGVGYERLESV-KGYSGAPNRT---YPNLPMLLKESGKIDKVAYSVFLNHLNSN 224

Query: 363 HGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQN--GERNXXXXX 420
             +V FG +D  KYTG LY  P++NI ++     P +F +TL  + +       N     
Sbjct: 225 VSTVTFGGVDSEKYTGDLYKFPLVNIYKS--IPRPSKFHITLQALEVHGNYSSLNKTVSN 282

Query: 421 XXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFH 480
                  D+GT     P +V E +A  I+A +  +   Y   C +   +T LVFDFG   
Sbjct: 283 TPLPALFDTGTNGMVVPPNVAENIASTIHATFDEKFSLYLFACPAEEDDTKLVFDFGDIQ 342

Query: 481 ISGPLQDFLIQTSQ---QTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIAL 532
           I  PL +F++  ++   + C +A+ P++     LG  FL   YVVY+L++Y +AL
Sbjct: 343 IEAPLANFIVPAAELGTEQCGVAIIPEDGTFT-LGIPFLRSTYVVYNLEDYEVAL 396

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%)

Query: 90  DGAGYEDVKITNQQSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQSS 143
           DG     + + N    Y  E+ +GTPPQ + VL DTGSADLW   S N +C +S
Sbjct: 36  DGEKCFSMDLINNNDHYLAEIEVGTPPQKLKVLFDTGSADLWFQSSDNEYCAAS 89

>SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 557

 Score =  176 bits (446), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 108/347 (31%), Positives = 173/347 (49%), Gaps = 24/347 (6%)

Query: 244 CQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANMTN 303
           C     F  + S++  +N T F   + D TFASGTW QD + +  + +   +F VA  TN
Sbjct: 166 CYLADVFEVNYSTSIVSNNTDFFTQFYDYTFASGTWYQDTIEVGSIIIEKFNFGVAQETN 225

Query: 304 STVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLDESH 363
           +T+G LG+GL   E T  G         Y Y NFP  LK SG I    YS++   +D   
Sbjct: 226 ATIGSLGLGLEGNEITNEG------DYTYTYENFPTKLKNSGMIKRVIYSIYAGKIDTED 279

Query: 364 GSVLFGAIDHSKYTGQ-LYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXXXXXXX 422
           GS+LFGA++HS+Y G  LYT+P++N+  N+  S+P++F VTL  + +   + N       
Sbjct: 280 GSLLFGAVEHSRYVGDTLYTLPLVNV--NNASSDPVEFHVTLQNLVVSVNKTNTTIMSDR 337

Query: 423 XXXXXDSGTTISYFPTSVVELVARQINAQYSAR-LGFYTVPCRSVSSNTNLVFDFGGFHI 481
                ++G  ++Y PT +     ++     S +  G Y   C   SS  +  +DFGGF I
Sbjct: 338 YAALLNTGAIVTYLPTHLFSDFIKKTGLSESQKYYGMYVTDC---SSEISFSYDFGGFKI 394

Query: 482 SGPLQDFLIQTSQQ-----TCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXX 536
              L D+L +  +       C + +   + ++++LG  F + AYVV+DL+   +++    
Sbjct: 395 ESSLNDYLFEIDESEIPGAKCAVTINSHDEKYLVLGSGFFSSAYVVFDLERLEVSIAQAA 454

Query: 537 XXXXXXXXXXX-----IELITNSTIPRAIRAPLYSETWTANRPVQSG 578
                           +E++ +S IP A +A  YS TWT +R  ++G
Sbjct: 455 HVYDNFTYSNIEDNPDVEIVIDS-IPSATKAASYSNTWTFDRAPENG 500

>KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.182
           YIL015W
          Length = 563

 Score =  175 bits (443), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 114/353 (32%), Positives = 177/353 (50%), Gaps = 23/353 (6%)

Query: 235 IPRSERTLDCQEYGTFNSSRSSTFKN-NYTSFSISYGDSTFASGTWAQDVLNLSDLNVTG 293
           IP+    +DC +  T+N++RS++F+  N   F I YGD TFA G W  +      + +  
Sbjct: 112 IPK----VDCSQIKTYNANRSTSFQELNNGRFYIIYGDKTFADGIWGTETFEFGGVKIPN 167

Query: 294 LSFAVANMTNSTVG-VLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTY 352
           + F +A+   + +G VLGIG    ES      G T      Y NFP VLK  G I T  Y
Sbjct: 168 VQFGLADYATTPIGGVLGIGFQRRES----VKGYTNAPEVFYPNFPQVLKNEGIIDTVAY 223

Query: 353 SLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNG 412
           SL L     SH  ++FGAID + Y G + T PMIN+  N+  S P    +T+ G+G QN 
Sbjct: 224 SLSLGQ--SSH--IMFGAIDRNSYIGDMVTFPMINMFPNA-VSKPATLSITIQGLGAQNK 278

Query: 413 E--RNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNT 470
           +  +             DSG+T+   P  + + +A  I AQ+S   G YT+ C + ++N 
Sbjct: 279 QECKFQTFSTTKYPALLDSGSTLISAPVEIADKMAAFIGAQWSESDGIYTLECPNDTTNI 338

Query: 471 NLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQH-VILGDIFLTHAYVVYDLDNYV 529
           + +FDFG    + PL + ++ +   + +     Q S + ++LGD+FL    VV+DLD+Y 
Sbjct: 339 DYIFDFGDMKFTLPLSNLILPSQGGSNVCGFGLQRSDNEIVLGDVFLCSTLVVFDLDHYQ 398

Query: 530 IALXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582
           I+L               + + ++  IP AI A   +E WT   P+ +  ++F
Sbjct: 399 ISL---AKSNQKSSAEDIVNIPSDGKIPGAIIAK--AEAWTTYEPITATTDMF 446

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 40/65 (61%), Gaps = 7/65 (10%)

Query: 82  QLLKRDN-EDGAGYEDVKITNQQSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFC 140
           QL KR++ +    +ED      +SFY+  L IG PPQ +TV+ D+GSAD WV    NPFC
Sbjct: 38  QLAKRNHLKFDLQFED------ESFYATTLKIGDPPQEITVIFDSGSADTWVMSRYNPFC 91

Query: 141 QSSLN 145
            SS N
Sbjct: 92  LSSSN 96

>CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa]
           {ON} similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015w BAR1
          Length = 541

 Score =  172 bits (435), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 117/340 (34%), Positives = 172/340 (50%), Gaps = 27/340 (7%)

Query: 242 LDCQEYGTFNSSRSSTF---KNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAV 298
           +DC     ++  +S TF   KN   +F I Y D+T+ SG W  D++ L + ++  L F +
Sbjct: 100 IDCSGLVFYDMDKSQTFDYLKN--VTFKIGYADTTYTSGIWIVDIITLPEGHLKDLQFGM 157

Query: 299 ANMTNSTV-GVLGIGLPALEST--YSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLF 355
           A  TN+T  GVLGIG PA+ES   Y  A G        Y NFP+ LK +G  +   YS+ 
Sbjct: 158 AFATNATFSGVLGIGFPAMESVNGYEFAPGKF------YPNFPLALKNAGFTNIAAYSIE 211

Query: 356 LDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERN 415
            +D +   GS+LFG+ID S++ G LYT PMIN         P    +TL GIG+      
Sbjct: 212 YND-ESKKGSILFGSIDTSRFIGPLYTFPMINEFPGIA-DEPSTLSLTLDGIGIDGSCEQ 269

Query: 416 XXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRS--VSSNTNLV 473
                       D+G+T+   P  + + +A  +NA +S   G + + C S    + T+L 
Sbjct: 270 WVISNTKLPALLDTGSTLIELPHPITQSIASYLNATWSDDHGLFVLACPSDDFLTTTDLA 329

Query: 474 FDFGGFHISGPLQDFLIQTSQQT---CILAMAPQESQHVILGDIFLTHAYVVYDLDNYVI 530
           F FG  H+  PL+ F++   +++   C L +   + + VILGD FLTH Y V+DLDNY+I
Sbjct: 330 FTFGELHMKIPLRSFILLPDEESNGLCGLGITSSKGR-VILGDSFLTHVYTVFDLDNYMI 388

Query: 531 ALXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWT 570
           +L               IE+  N  I  A+ +   SE WT
Sbjct: 389 SL---APMAKSSLPGKVIEIPANGLIENAVISK--SEKWT 423

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 25/36 (69%)

Query: 105 FYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFC 140
           +Y   L  GTPPQ + +++DTGS+DLWVT   NP C
Sbjct: 52  YYESVLEFGTPPQSIPLVLDTGSSDLWVTLIGNPLC 87

>Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)
          Length = 304

 Score =  140 bits (354), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 129/243 (53%), Gaps = 12/243 (4%)

Query: 339 MVLKQSGAIHTTTYSLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPI 398
           M LK  G I    YSLFL++     GS+LFGA+D SKY+GQLYT+PM+         +P 
Sbjct: 1   MALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQLYTLPMLQAYDTLDSVSPG 60

Query: 399 QFDVTLFGIGLQNGER-NXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLG 457
            F VT   + + NG+  N            DSGTT S  PT V   + +  + +YS+   
Sbjct: 61  MF-VTAQSVAVLNGDSGNKTVSKVRFPVLFDSGTTYSSLPTEVAHAIGKSFDGKYSSGDQ 119

Query: 458 FYTVPCRSVSSNTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLT 517
            YT  C  V  +T L  DFGGF+IS  + +F+ +T    C+L +   +S  V LGD FL 
Sbjct: 120 GYTFDCSKV-KDTLLSIDFGGFNISANISNFVTRTKDH-CLLNIEAADSGFV-LGDAFLV 176

Query: 518 HAYVVYDLDNYVIALXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETW--TANRPV 575
            AYVV+DL+++ +++               IE+I++  +P AIRAP YS TW  T   P+
Sbjct: 177 DAYVVFDLESHEVSI----AQASFDDKKEEIEVISDR-VPGAIRAPGYSSTWVYTPGSPI 231

Query: 576 QSG 578
            +G
Sbjct: 232 GTG 234

>AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL015W (BAR1)
          Length = 452

 Score =  143 bits (360), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 97/300 (32%), Positives = 149/300 (49%), Gaps = 18/300 (6%)

Query: 241 TLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVAN 300
           ++DC+   TF +  S+T +     F I Y D TF  G+WA D L +   +V+G+ F V  
Sbjct: 98  SIDCRGIKTFCNESSTTLRILPNPFYIDYAD-TFVDGSWATDRLVIGGHDVSGMKFGVGR 156

Query: 301 MTNSTV-GVLGIGLPALEST--YSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLD 357
            +N+ + GVLG+G   LES   Y+GA  AT      Y N P  LK  G++    YS+ L 
Sbjct: 157 TSNTELSGVLGVGHANLESVRGYAGAPNAT------YPNLPRQLKLDGSVQKLAYSVSLQ 210

Query: 358 DLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXX 417
              E  G +LFGAID SKY G+L+T P++NI  +   ++P  F + L GI +Q G  +  
Sbjct: 211 KTSERDGEILFGAIDTSKYVGKLHTFPILNI--DPHLNSPSNFYIALQGIDIQGGRSSTG 268

Query: 418 XXXXXXX--XXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFD 475
                       D+GT      +S+ E +   +NA Y      + + C +        F+
Sbjct: 269 RPLINSSFHALLDTGTG-GMVVSSLAEDIGAALNATYDTEQCVFVIQCPTEDDTRQFNFN 327

Query: 476 FGGFHISGPLQDFLIQTS---QQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIAL 532
           FG   I+ P+ +F++  S      C LA+ P  S+   LG  FL   Y V++L++  I++
Sbjct: 328 FGELQIAVPISNFVVPASGLETGQCALAIMPGTSETFALGIPFLKEVYTVFNLEDNEISM 387

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 36/60 (60%)

Query: 91  GAGYEDVKITNQQSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLNSRNVV 150
           G G+  + + +    Y +E+ +GTPPQ +  ++DTGSADLW+    NPFC  + + +  V
Sbjct: 31  GDGFLAMPLHHNDDHYDIEIEVGTPPQKLHAVLDTGSADLWLQAENNPFCVGAKDEKQEV 90

>Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C
           (REAL)
          Length = 227

 Score =  128 bits (322), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 114/205 (55%), Gaps = 6/205 (2%)

Query: 332 YQYMNFPMVLKQSGAIHTTTYSLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMI---NI 388
           Y Y NFPM LK+ G I    YSLFL++ +   GS+LFGA+D SKY+GQLYT+PM+   N 
Sbjct: 21  YVYDNFPMALKRQGKIEKIAYSLFLNEPNARFGSILFGAVDKSKYSGQLYTLPMLKAYNT 80

Query: 389 MRNSGYSNPIQFDVTLFGIGLQNGER-NXXXXXXXXXXXXDSGTTISYFPTSVVELVARQ 447
           + +S         V +  + + + +  N            DSGT+ S  PT + + + R 
Sbjct: 81  LDSSAGMEITAQSVAILSVAIIDSKSGNKTVSEVQFPVLFDSGTSTSALPTEIADAIGRS 140

Query: 448 INAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQ 507
            + +YS+    Y   C  V +NT L  DFGGF+IS  + + +   ++  C+L +   +S 
Sbjct: 141 FDGKYSSDNQGYIFDCSKV-NNTLLSIDFGGFNISANISNSVTPITKDHCLLNIEADDSG 199

Query: 508 HVILGDIFLTHAYVVYDLDNYVIAL 532
           +V LGD FL   YVV+DL+++ +++
Sbjct: 200 YV-LGDAFLIDTYVVFDLESHEVSV 223

>SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 578

 Score =  122 bits (306), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 91/337 (27%), Positives = 155/337 (45%), Gaps = 21/337 (6%)

Query: 244 CQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANMTN 303
           C+    F    SS+F  N   F + Y D ++A+GTW+QD  +    +   ++ A+ + TN
Sbjct: 142 CKLVNVFYPEDSSSFVLNDLDFHVQYDDYSYANGTWSQDTFSFGYPSFYNVNIALVSETN 201

Query: 304 STVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLDESH 363
            TVG LG+GL A ++T  G         + Y +    LK  G I    YS++  +L+ + 
Sbjct: 202 LTVGSLGLGLRANQATNQG------DDPFVYNSLLYRLKTQGWIEKIAYSVYTSELNGTG 255

Query: 364 GSVLFGAIDHSKYTGQ-LYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXXXXXXX 422
           G + FG + H  Y G  LYT+P++N+  +     P +F +TL  +       N       
Sbjct: 256 GGIFFGGLYHDLYKGNVLYTLPLVNV--DPELDEPARFHITLQNLTTSINGTNFSVLSEK 313

Query: 423 XXXXXDSGTTISYFPTSVVELVARQINAQYSAR-LGFYTVPCRSVSSNTNLVFDFGGFHI 481
                 +G+  +Y P  + +    +++ +  A+    Y +PC    +N   ++DFGGF I
Sbjct: 314 YPALLSTGSMFTYLPEELFDSFVDEMDLEKGAKHKDLYVIPC---DTNATFIYDFGGFEI 370

Query: 482 SGPLQDFLIQ-----TSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALXXXX 536
             PL  +  +     T+   C + + P    ++ LG+ F    YV+++L++  I++    
Sbjct: 371 ETPLSGYTFKVESNRTADDMCAVMVKPHNKSYLTLGNGFFAATYVLFNLEDLEISM--AP 428

Query: 537 XXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANR 573
                       E I  S+IP A RA  YS TW  N+
Sbjct: 429 ASGIEYLDAFDYEYI-ESSIPSASRAASYSNTWILNQ 464

 Score = 39.3 bits (90), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 26/40 (65%)

Query: 110 LAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLNSRNV 149
           + +GTP Q +  L+DT S+D+W+  S + FC+S   + N+
Sbjct: 82  MYVGTPSQAIRFLLDTDSSDIWLLNSNSTFCESENGTVNI 121

>TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa]
           {ON} Anc_7.182 YIL015W
          Length = 395

 Score =  118 bits (296), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 90/315 (28%), Positives = 152/315 (48%), Gaps = 31/315 (9%)

Query: 242 LDCQEYGTFNSSRSSTFKNNYTS--FSISYGDSTFASGTWAQDVLNLSD----------- 288
           +DC  +  FN S S TF N Y +  F I Y D+++  G W  D ++++            
Sbjct: 70  IDCTGFTFFNKSNSKTFSNIYKNSIFQIGYQDASYTFGKWGVDSISINSSYSDSNEDTGL 129

Query: 289 -LNVTGLSFAVANMTNSTV-GVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGA 346
             N+    FA+A  +N  V  VLG+G P  E+  +G   AT +    Y N P ++KQ G 
Sbjct: 130 YANIPNAQFAIATNSNVPVQAVLGLGFPRREAV-NGYKLATNKF---YPNLPQLIKQHGY 185

Query: 347 IHTTTYSLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTL-- 404
               T +++L   +E++ S++FGA D ++Y G L+  PM+N   N     P  F +TL  
Sbjct: 186 SDNVTIAMYLGS-NETYNSIMFGAYDKTRYIGDLHNFPMVNQYPNVT-DKPATFAITLDS 243

Query: 405 FGIGLQNGERNXX--XXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVP 462
             I + N + +              DSGT++   P   V  +A  +NA +      Y +P
Sbjct: 244 MYISMDNNQSDNIYISNDEKYSVVLDSGTSLLSAPDHYVSKIAGLLNATFDNTTHMYLLP 303

Query: 463 CRS---VSSNTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQHV--ILGDIFLT 517
             +   +  +  + F F  F++   + +F++     + + A+ P ++ +   +LGDIFL 
Sbjct: 304 SETDLTLYKDMIINFKFMDFNVPINMLEFILPY-DDSYVFAILPTKNVNTGFVLGDIFLP 362

Query: 518 HAYVVYDLDNYVIAL 532
           H Y +++LDNY I+L
Sbjct: 363 HVYTIFNLDNYTISL 377

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 26/39 (66%)

Query: 102 QQSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFC 140
             S+Y   + IG PPQ++ VLVDTGS+DLWV    NP C
Sbjct: 27  DDSYYETNILIGNPPQNIGVLVDTGSSDLWVNSPNNPNC 65

>Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON}
           (50979..51989) [1011 nt, 337 aa]
          Length = 336

 Score =  108 bits (270), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 66/228 (28%), Positives = 115/228 (50%), Gaps = 7/228 (3%)

Query: 240 RTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVA 299
            +++C ++GT+   +SST         I YGD +FA G W  D L +   ++  + F ++
Sbjct: 110 HSINCTKFGTYTRDKSSTSNKLDHRLFIQYGDGSFADGEWITDTLTIGPYDLQSVQFGIS 169

Query: 300 NMTNSTV-GVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDD 358
           N  ++ + GVLG+G    ES   G  G+  +  Y   N P  LK     +T  +SLFL++
Sbjct: 170 NNASTIISGVLGLGFLRTESI-DGYDGSPNKLYY---NLPAYLKDQEITNTNAFSLFLNN 225

Query: 359 LDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGI-GLQNGERNXX 417
            +++ G+VLFG ID+SK++G L T P++NI      + P  F +TL  + G  NG ++  
Sbjct: 226 SNDASGTVLFGGIDYSKFSGDLVTFPLVNIYPKL-INEPCTFTITLQQLYGKINGGKSIG 284

Query: 418 XXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRS 465
                     DSG+++   P  + + +A  +N+        + + C +
Sbjct: 285 LIKEKVPALLDSGSSLISMPIEITDEIALMVNSTLDTMTSLHNINCSA 332

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (66%)

Query: 105 FYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLNSRNV 149
           FYS  L+ G P Q+VTVLVDTGS+DLWV+   N +C     + N+
Sbjct: 64  FYSTLLSFGNPVQNVTVLVDTGSSDLWVSSPNNIYCYEDGKNTNI 108

>ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 418

 Score =  100 bits (249), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 93/317 (29%), Positives = 141/317 (44%), Gaps = 52/317 (16%)

Query: 235 IPRSE-RTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT- 292
           +P +E  +L C  +  ++   SS++K N T F+I YG  +   G  +QD LNL DL++T 
Sbjct: 131 VPSTECSSLACFLHSKYDHDSSSSYKPNGTEFAIRYGSGSL-EGYISQDTLNLGDLSITK 189

Query: 293 ----------GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLK 342
                     GL FA         G+LG+G   +        G           F    K
Sbjct: 190 QDFAEATSEPGLQFAFGKFD----GILGLGYDTIS-----VDGVVPP-------FYNAWK 233

Query: 343 QSGAIHTTTYSLFLDDLDESH--GSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQF 400
           Q G +    ++ +L    ES   G   FG +D SKY G++  +P+    R   Y     +
Sbjct: 234 Q-GLLDEPKFAFYLGRDGESQDGGVATFGGVDDSKYEGEITWLPI----RRKAY-----W 283

Query: 401 DVTLFGIGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYT 460
           +V   GIGL  GE              D+GT++   P+ + E++  +I A+ S   G YT
Sbjct: 284 EVKFDGIGL--GEE--YAELENHGAAIDTGTSLIALPSGLAEIINAEIGAKKS-WTGQYT 338

Query: 461 VPCRSVSSNTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQH-----VILGDIF 515
           V C + SS  N+ F  GG +      D++++ S Q CI A+ P +         I+GD F
Sbjct: 339 VECEARSSLPNMTFTLGGHNFELTAYDYILEVSGQ-CISAIFPMDFPEPVGPLAIIGDSF 397

Query: 516 LTHAYVVYDLDNYVIAL 532
           L   Y +YDL N  + L
Sbjct: 398 LRKYYSIYDLGNNAVGL 414

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 23/27 (85%)

Query: 106 YSVELAIGTPPQHVTVLVDTGSADLWV 132
           Y  E+++GTPPQ+  V++DTGS++LWV
Sbjct: 105 YYTEVSLGTPPQNFKVILDTGSSNLWV 131

>TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {ON}
           Anc_8.677 YPL154C
          Length = 413

 Score = 99.4 bits (246), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 85/318 (26%), Positives = 142/318 (44%), Gaps = 53/318 (16%)

Query: 235 IPRSE-RTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT- 292
           +P  E  +L C  +  +N   SST+K N ++F+I YG  +   G  +QDV+ + DL +T 
Sbjct: 125 VPSKECGSLACYLHSKYNHDESSTYKANGSAFAIQYGSGSL-EGYISQDVMEIGDLKITK 183

Query: 293 ----------GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLK 342
                     G+SFA         G+LG+    +      A       +Y  +N      
Sbjct: 184 QDFAEATSEPGISFAFGKFD----GILGLAYDTI------AVNRVVPPVYNAIN------ 227

Query: 343 QSGAIHTTTYSLFLDDLDESH---GSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQ 399
             G +    ++ +L D  +S    G  +FG ID +K+ G +  +P    +R   Y     
Sbjct: 228 -QGLLDEPKFAFYLGDASKSKDNGGEAVFGGIDETKFEGDITWLP----VRRKAY----- 277

Query: 400 FDVTLFGIGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFY 459
           ++V L G+GL  GE              D+GT++   P+ + E++  +I A+     G Y
Sbjct: 278 WEVKLEGLGL--GEE--YTELENHGAAIDTGTSLITLPSGLAEIINSEIGAK-KGWTGQY 332

Query: 460 TVPCRSVSSNTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQE-----SQHVILGDI 514
           T+ C   +S  ++ F F G++ +    D+ ++ S  +CI A+ P +         I+GD 
Sbjct: 333 TIECDKRASLPDMTFTFDGYNFTISPYDYTLEVS-GSCISAITPMDFPEPVGPMAIIGDA 391

Query: 515 FLTHAYVVYDLDNYVIAL 532
           FL   Y VYDL N  + L
Sbjct: 392 FLRKYYSVYDLGNDAVGL 409

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 5/58 (8%)

Query: 93  GYEDVKITN-QQSFYSVELAIGTPPQHVTVLVDTGSADLWV----TGSMNPFCQSSLN 145
           G  +V ++N   + Y  ++ IGTPPQ   V++DTGS++LWV     GS+  +  S  N
Sbjct: 85  GGHEVPLSNYMNAQYFADIKIGTPPQSFKVVLDTGSSNLWVPSKECGSLACYLHSKYN 142

>Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C
           (PEP4) - vacuolar proteinase A [contig 68] FULL
          Length = 412

 Score = 97.8 bits (242), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 89/318 (27%), Positives = 141/318 (44%), Gaps = 53/318 (16%)

Query: 235 IPRSE-RTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT- 292
           +P  E  +L C  +  ++   SS++K N TSF+I YG  +   G  +QD L++ DL +  
Sbjct: 124 VPSDECGSLACFLHSKYSHDASSSYKANGTSFAIQYGSGSL-EGYISQDTLSIGDLTIPK 182

Query: 293 ----------GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLK 342
                     GL+FA         G+LG+G   +      +       +Y+ +N      
Sbjct: 183 QDFAEATSEPGLAFAFGKFD----GILGLGYDTI------SVDKVVPPVYKAIN------ 226

Query: 343 QSGAIHTTTYSLFL---DDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQ 399
             G +    ++ +L   DD +ES G V FG ID SKY G +  +P    +R   Y   ++
Sbjct: 227 -DGLLDEPRFAFYLNNADDSEESTGEVTFGGIDSSKYKGDITWLP----VRRKAYWE-VK 280

Query: 400 FDVTLFGIGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFY 459
           FD    GIGL     +            D+GT++   P+ + E++  +I A+     G Y
Sbjct: 281 FD----GIGL----GDEYAELQGTGAAIDTGTSLIALPSGLAEVLNSEIGAK-KGWTGQY 331

Query: 460 TVPCRSVSSNTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQH-----VILGDI 514
           TV C S     +L F F G + +    D+ ++ S  +CI A  P +         I+GD 
Sbjct: 332 TVDCESRDQLPDLTFTFNGKNFTITAYDYTLEVS-GSCISAFTPMDFPEPVGPLAIIGDA 390

Query: 515 FLTHAYVVYDLDNYVIAL 532
           FL   Y +YDL N  + L
Sbjct: 391 FLRKFYSIYDLGNNAVGL 408

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 41/69 (59%), Gaps = 8/69 (11%)

Query: 82  QLLKRDNE---DGAGYEDVKITNQ-QSFYSVELAIGTPPQHVTVLVDTGSADLWV----T 133
           Q+L  D+E   D  G  DV ++N   + Y  E+++GTPPQ   V++DTGS++LWV     
Sbjct: 70  QVLTADSEGEFDILGGHDVPLSNYLNAQYFTEISLGTPPQSFKVILDTGSSNLWVPSDEC 129

Query: 134 GSMNPFCQS 142
           GS+  F  S
Sbjct: 130 GSLACFLHS 138

>KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 417

 Score = 97.1 bits (240), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 90/318 (28%), Positives = 141/318 (44%), Gaps = 53/318 (16%)

Query: 235 IPRSE-RTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT- 292
           +P  E  +L C  +  ++   SS++K N T+F+I YG  +   G  +QD L++ DL +  
Sbjct: 129 VPSDECGSLACFLHSKYSHDASSSYKANGTNFAIQYGSGSL-EGYISQDTLSIGDLTIPK 187

Query: 293 ----------GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLK 342
                     GL+FA         G+LG+G   +      A       +Y+ +N      
Sbjct: 188 QDFAEATSEPGLAFAFGKFD----GILGLGYDTI------AVDKVVPPVYKAIN------ 231

Query: 343 QSGAIHTTTYSLFL---DDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQ 399
             G +    ++ +L   DD +ES G V FG ID SKY G +  +P    +R   Y   ++
Sbjct: 232 -DGLLDEPRFAFYLNNADDSEESTGEVTFGGIDSSKYKGNITWLP----VRRKAYWE-VK 285

Query: 400 FDVTLFGIGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFY 459
           FD    GIGL     +            D+GT++   P+ + E++  +I A+     G Y
Sbjct: 286 FD----GIGL----GDEYAELEGTGAAIDTGTSLIALPSGLAEVLNAEIGAK-KGWSGQY 336

Query: 460 TVPCRSVSSNTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQH-----VILGDI 514
           TV C S     +L F F G + +    D+ ++ S  +CI A  P +         I+GD 
Sbjct: 337 TVDCESRDQLPDLTFTFNGKNFTISAYDYTLEVS-GSCISAFTPMDFPEPVGPLAIIGDA 395

Query: 515 FLTHAYVVYDLDNYVIAL 532
           FL   Y VYDL N  + L
Sbjct: 396 FLRKFYSVYDLGNNAVGL 413

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 5/64 (7%)

Query: 84  LKRDNEDGAGYEDVKITNQ-QSFYSVELAIGTPPQHVTVLVDTGSADLWV----TGSMNP 138
           +++D     G  DV ++N   + Y  E+ +GTPPQ   V++DTGS++LWV     GS+  
Sbjct: 80  VEQDVLSAMGGHDVPLSNYLNAQYFTEITLGTPPQSFKVILDTGSSNLWVPSDECGSLAC 139

Query: 139 FCQS 142
           F  S
Sbjct: 140 FLHS 143

>KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8.677
           YPL154C
          Length = 415

 Score = 94.0 bits (232), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 85/319 (26%), Positives = 147/319 (46%), Gaps = 55/319 (17%)

Query: 235 IPRSE-RTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT- 292
           +P SE  +L C  +  ++ S SS++K N T FSI YG  +   G  +QD L++ DL +  
Sbjct: 127 VPSSECGSLACFLHEKYDHSASSSYKANGTDFSIQYGSGSL-EGYISQDTLSIGDLTIPK 185

Query: 293 ----------GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLK 342
                     GL+FA         G+LG+    +         +  + +  + N    L+
Sbjct: 186 QDFAEATSEPGLAFAFGKFD----GILGLAYDTI---------SVDKVVPPFYN---ALE 229

Query: 343 QSGAIHTTTYSLFLDDLD---ESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQ 399
           Q   +    ++ +L D +   E  G  +FG +D SKYTG +  +P    +R   Y     
Sbjct: 230 QD-LLDEAKFAFYLGDTNKDAEDGGEAIFGGVDKSKYTGDVTWLP----VRRKAY----- 279

Query: 400 FDVTLFGIGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFY 459
           ++V L G+GL     +            D+GT++   P+ + E++  +I A+     G Y
Sbjct: 280 WEVKLEGLGL----GDEYAELESHGAAIDTGTSLITLPSGLAEIINSEIGAK-KGWTGQY 334

Query: 460 TVPCRSVSSNTNLVFDFGGFHIS-GPLQDFLIQTSQQTCILAMAPQESQH-----VILGD 513
           T+ C +     +L F+F G++ + GP  D+ ++ S  +CI A+ P +         I+GD
Sbjct: 335 TLECNTRDQLPDLTFNFNGYNFTIGPY-DYTLEVS-GSCISAITPMDFPEPVGPLAIVGD 392

Query: 514 IFLTHAYVVYDLDNYVIAL 532
            FL   Y +YDL++  + L
Sbjct: 393 AFLRKYYSIYDLEHNAVGL 411

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 38/76 (50%), Gaps = 19/76 (25%)

Query: 61  PFEKYTG-DSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPPQHV 119
           PF K +  DSFE A  +  PL+  L                N Q  Y  ++ +GTPPQ  
Sbjct: 73  PFFKGSAQDSFEVAKGHEVPLSNYL----------------NAQ--YYTDITLGTPPQQF 114

Query: 120 TVLVDTGSADLWVTGS 135
            V++DTGS++LWV  S
Sbjct: 115 KVILDTGSSNLWVPSS 130

>SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|P07267 Saccharomyces
           cerevisiae YPL154C PEP4 Vacuolar aspartyl protease
           (proteinase A) required for the posttranslational
           precursor maturation of vacuolar proteinases synthesized
           as a zymogen self-activates
          Length = 404

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 84/308 (27%), Positives = 136/308 (44%), Gaps = 34/308 (11%)

Query: 235 IPRSE-RTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTG 293
           +P +E  +L C  +  ++   SS++K N +SF+I YG  +   G  +QD L++ DL +  
Sbjct: 117 VPSAECGSLACFLHAKYDHDSSSSYKANGSSFAIQYGSGSL-EGYISQDTLSIGDLTIPK 175

Query: 294 LSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLK--QSGAIHTTT 351
             FA A          G         + G  G     +      P V     +G +    
Sbjct: 176 QDFAEATSEPGLAFAFG--------KFDGILGLAYDSISVDKVVPPVYNAIHNGLLDEPK 227

Query: 352 YSLFLDDLDES--HGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGL 409
           +S +L + D+S   G   FG ID SKY G +  +P+    R   Y   ++FD    GIGL
Sbjct: 228 FSFYLGNADKSTDGGEATFGGIDSSKYEGNITWLPV----RRKAYWE-VKFD----GIGL 278

Query: 410 QNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSN 469
                +            D+GT++   P+ + E++  +I A+     G Y+V C +  S 
Sbjct: 279 ----GDEYAILDGHGAAIDTGTSLIALPSGLAEILNAEIGAK-KGWSGQYSVECDTRDSL 333

Query: 470 TNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQH-----VILGDIFLTHAYVVYD 524
            +L  +FGG++ +    D+ ++ S  +CI A  P +         I+GD FL   Y VYD
Sbjct: 334 PDLTLNFGGYNFTITPYDYTLEVSG-SCISAFTPMDFPEPVGPLAIIGDAFLRKHYSVYD 392

Query: 525 LDNYVIAL 532
           L N  + L
Sbjct: 393 LGNDAVGL 400

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 67  GDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQ-QSFYSVELAIGTPPQHVTVLVDT 125
           G  + SA +   P  +  K          DV +TN   + Y  E+++GTPPQ+  V++DT
Sbjct: 51  GQKYLSAYQKAYPEAEFAKEHQFYAEAGHDVPLTNYLNAQYYTEISLGTPPQNFKVILDT 110

Query: 126 GSADLWV----TGSMNPFCQSSLN 145
           GS++LWV     GS+  F  +  +
Sbjct: 111 GSSNLWVPSAECGSLACFLHAKYD 134

>Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C
           (REAL)
          Length = 405

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 83/321 (25%), Positives = 143/321 (44%), Gaps = 59/321 (18%)

Query: 235 IPRSE-RTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT- 292
           +P +E  +L C  +  ++   SS++K N T F+I YG  +   G  +QD L++ DL +  
Sbjct: 117 VPSNECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSL-EGYISQDTLSIGDLTIPK 175

Query: 293 ----------GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLK 342
                     GL+FA         G+LG+G   +         +  + +  + N      
Sbjct: 176 QDFAEATSEPGLTFAFGKFD----GILGLGYDTI---------SVDKVVPPFYN----AI 218

Query: 343 QSGAIHTTTYSLFLDDLD---ESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQ 399
           Q   +    ++ +L D     E+ G   FG ID SK+ G +  +P+    R   Y     
Sbjct: 219 QQDLLDEKKFAFYLGDTSKDSENGGEATFGGIDESKFKGDITWLPV----RRKAY----- 269

Query: 400 FDVTLFGIGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGF- 458
           ++V   GIGL     +            D+GT++   P+ + E+    INA+  A+ G+ 
Sbjct: 270 WEVKFEGIGL----GDEYAELESHGAAIDTGTSLITLPSGLAEM----INAELGAKKGWT 321

Query: 459 --YTVPCRSVSSNTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQH-----VIL 511
             YT+ C +  S  +L+F+F G++ +    D+ ++ S  +CI A+ P +         I+
Sbjct: 322 GQYTLDCNTRDSLPDLIFNFNGYNYTIGPYDYTLEVS-GSCISAITPMDFPEPVGPLAII 380

Query: 512 GDIFLTHAYVVYDLDNYVIAL 532
           GD FL   Y +YDL N  + L
Sbjct: 381 GDAFLRKYYSIYDLGNNAVGL 401

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 5/60 (8%)

Query: 93  GYEDVKITNQ-QSFYSVELAIGTPPQHVTVLVDTGSADLWV----TGSMNPFCQSSLNSR 147
           G  DV +TN   + Y  ++ +GTPPQ+  V++DTGS++LWV     GS+  F  S  +  
Sbjct: 77  GGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHE 136

>NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}
          Length = 408

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 78/311 (25%), Positives = 140/311 (45%), Gaps = 52/311 (16%)

Query: 241 TLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT-------- 292
           +L C  +  ++  +SS++K N T F+I YG  +   G  +QD LN+ DLN+         
Sbjct: 127 SLACYLHSKYDHDKSSSYKPNGTDFAIRYGTGSL-EGYISQDTLNIGDLNIPKQDFAEAT 185

Query: 293 ---GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHT 349
              GL+FA         G+LG+   ++         +  + +  + N    ++Q   +  
Sbjct: 186 SEPGLTFAFGKFD----GILGLAYDSI---------SVNKVVPPFYN---AIEQE-LLDE 228

Query: 350 TTYSLFLDDLD---ESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFG 406
             ++ +L D +   E  G +  G ID +K+ G +  +P+    R   Y     ++V   G
Sbjct: 229 KKFAFYLGDANKKSEDGGEITIGGIDKTKFKGDIDWLPV----RRKAY-----WEVKFEG 279

Query: 407 IGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSV 466
           IGL +                D+GT++   P+ + E++  +I A+     G YTV C + 
Sbjct: 280 IGLGD----QFAELENHGAAIDTGTSLIALPSGLAEIINTEIGAK-KGWTGQYTVECDAR 334

Query: 467 SSNTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQE-----SQHVILGDIFLTHAYV 521
            +  +L F+F G + +    D+ ++ S  +CI A+ P +         I+GD FL   Y 
Sbjct: 335 PNLPDLTFNFNGKNFTIGPYDYTLEVSG-SCISAIMPMDFPEPVGPMAIIGDAFLRKYYS 393

Query: 522 VYDLDNYVIAL 532
           +YDL+N  + L
Sbjct: 394 IYDLENNAVGL 404

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 21/27 (77%)

Query: 106 YSVELAIGTPPQHVTVLVDTGSADLWV 132
           Y  ++ +GTPPQ   V++DTGS++LWV
Sbjct: 94  YFADITLGTPPQSFKVILDTGSSNLWV 120

>Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON}
           (10059..11267) [1209 nt, 403 aa]
          Length = 402

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 82/306 (26%), Positives = 132/306 (43%), Gaps = 43/306 (14%)

Query: 241 TLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVAN 300
           +L C  +  ++ S SST+K N T+FSI YG  +   G  +QDVL + DL + G  FA A 
Sbjct: 122 SLACYLHAKYDHSDSSTYKKNGTTFSIQYGSGSM-EGYISQDVLQIGDLVIPGQDFAEAT 180

Query: 301 MTNSTV-------GVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYS 353
                        G+LG+    +      A        Y  +N  +V           +S
Sbjct: 181 SEPGLAFAFGKFDGILGLAYDTI------AVNRVVPPFYNAINKKLV-------DEPIFS 227

Query: 354 LFLDD--LDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQN 411
            +L D    E  G V FG  D S +TG +  +P    +R   Y   ++FD    G     
Sbjct: 228 FYLGDDTKSEDGGQVTFGGYDSSLFTGDITWLP----VRRKAYWE-VKFDAIALG----- 277

Query: 412 GERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTN 471
              N            D+GT++   P+ + E++  QI A+ S   G + V C++  +  +
Sbjct: 278 ---NEVADLVNHGAAIDTGTSLITLPSGLAEVINSQIGAKKSWS-GQWIVDCKTRDTLPD 333

Query: 472 LVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQE-----SQHVILGDIFLTHAYVVYDLD 526
           + F F G++ +    D+ ++ S  +CI A+ P +         I+GD FL   Y +YD+ 
Sbjct: 334 MTFTFDGYNFTITPYDYTLEVS-GSCISAITPMDFPAPVGPLAIVGDAFLRRYYSIYDVG 392

Query: 527 NYVIAL 532
           N  + L
Sbjct: 393 NNAVGL 398

 Score = 34.7 bits (78), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 20/27 (74%)

Query: 106 YSVELAIGTPPQHVTVLVDTGSADLWV 132
           Y  ++ +GTP Q   V++DTGS++LWV
Sbjct: 89  YYTDITLGTPAQSFKVILDTGSSNLWV 115

>Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {ON}
           YPL154C (REAL)
          Length = 405

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 83/321 (25%), Positives = 143/321 (44%), Gaps = 59/321 (18%)

Query: 235 IPRSE-RTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT- 292
           +P +E  +L C  +  ++   SS++K N T F+I YG  +   G  +QD L++ DL +  
Sbjct: 117 VPSNECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSL-EGYISQDTLSIGDLTIPK 175

Query: 293 ----------GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLK 342
                     GL+FA         G+LG+G   +         +  + +  + N      
Sbjct: 176 QDFAEATSEPGLTFAFGKFD----GILGLGYDTI---------SVDKVVPPFYN----AI 218

Query: 343 QSGAIHTTTYSLFLDDLD---ESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQ 399
           Q   +    ++ +L D     E+ G   FG ID SK+ G +  +P+    R   Y     
Sbjct: 219 QQDLLDEKKFAFYLGDTSKDSENGGEATFGGIDESKFKGDITWLPV----RRKAY----- 269

Query: 400 FDVTLFGIGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGF- 458
           ++V   GIGL     +            D+GT++   P+ + E+    INA+  A+ G+ 
Sbjct: 270 WEVKFEGIGL----GDEYAELEGHGAAIDTGTSLITLPSGLAEM----INAELGAKKGWT 321

Query: 459 --YTVPCRSVSSNTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQH-----VIL 511
             YT+ C +  S  +L+F+F G++ +    D+ ++ S  +CI A+ P +         I+
Sbjct: 322 GQYTLDCNTRDSLPDLIFNFNGYNFTIGPYDYTLEVS-GSCISAITPMDFPEPVGPLAIV 380

Query: 512 GDIFLTHAYVVYDLDNYVIAL 532
           GD FL   Y +YDL N  + L
Sbjct: 381 GDAFLRKYYSIYDLGNDAVGL 401

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 5/60 (8%)

Query: 93  GYEDVKITNQ-QSFYSVELAIGTPPQHVTVLVDTGSADLWV----TGSMNPFCQSSLNSR 147
           G  DV +TN   + Y  ++ +GTPPQ+  V++DTGS++LWV     GS+  F  S  +  
Sbjct: 77  GGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHE 136

>YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON}
           PEP4Vacuolar aspartyl protease (proteinase A), required
           for the posttranslational precursor maturation of
           vacuolar proteinases; important for protein turnover
           after oxidative damage; synthesized as a zymogen,
           self-activates
          Length = 405

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 80/318 (25%), Positives = 141/318 (44%), Gaps = 53/318 (16%)

Query: 235 IPRSE-RTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT- 292
           +P +E  +L C  +  ++   SS++K N T F+I YG  +   G  +QD L++ DL +  
Sbjct: 117 VPSNECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSL-EGYISQDTLSIGDLTIPK 175

Query: 293 ----------GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLK 342
                     GL+FA         G+LG+G   +         +  + +  + N      
Sbjct: 176 QDFAEATSEPGLTFAFGKFD----GILGLGYDTI---------SVDKVVPPFYN----AI 218

Query: 343 QSGAIHTTTYSLFLDDLD---ESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQ 399
           Q   +    ++ +L D     E+ G   FG ID SK+ G +  +P+    R   Y     
Sbjct: 219 QQDLLDEKRFAFYLGDTSKDTENGGEATFGGIDESKFKGDITWLPV----RRKAY----- 269

Query: 400 FDVTLFGIGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFY 459
           ++V   GIGL +                D+GT++   P+ + E++  +I A+     G Y
Sbjct: 270 WEVKFEGIGLGD----EYAELESHGAAIDTGTSLITLPSGLAEMINAEIGAK-KGWTGQY 324

Query: 460 TVPCRSVSSNTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQH-----VILGDI 514
           T+ C +  +  +L+F+F G++ +    D+ ++ S  +CI A+ P +         I+GD 
Sbjct: 325 TLDCNTRDNLPDLIFNFNGYNFTIGPYDYTLEVS-GSCISAITPMDFPEPVGPLAIVGDA 383

Query: 515 FLTHAYVVYDLDNYVIAL 532
           FL   Y +YDL N  + L
Sbjct: 384 FLRKYYSIYDLGNNAVGL 401

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 5/60 (8%)

Query: 93  GYEDVKITNQ-QSFYSVELAIGTPPQHVTVLVDTGSADLWV----TGSMNPFCQSSLNSR 147
           G  DV +TN   + Y  ++ +GTPPQ+  V++DTGS++LWV     GS+  F  S  +  
Sbjct: 77  GGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHE 136

>NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {ON}
           Anc_8.677
          Length = 406

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 81/318 (25%), Positives = 140/318 (44%), Gaps = 53/318 (16%)

Query: 235 IPRSE-RTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT- 292
           +P SE  +L C  +  ++   SS++K N T F+I YG  +   G  +QD LN+ DL +  
Sbjct: 118 VPSSECNSLACFLHSKYDHDASSSYKANGTKFAIQYGSGSL-EGYISQDTLNIGDLTIPK 176

Query: 293 ----------GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLK 342
                     GL+FA         G+LG+    +         +  + +  + N      
Sbjct: 177 QDFAEATSEPGLTFAFGKFD----GILGLAYDTI---------SVDKVVPPFYN----AI 219

Query: 343 QSGAIHTTTYSLFLDDL--DESHG-SVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQ 399
           + G +    ++ +L D   DE +G  +  G ID SK+ G +  +P+    R   Y     
Sbjct: 220 EQGLLDEKKFAFYLGDTKKDEKNGGEITIGGIDESKFKGDIEWLPV----RRKAY----- 270

Query: 400 FDVTLFGIGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFY 459
           ++V   GI L +                D+GT++   P+ + E++  +I A+     G Y
Sbjct: 271 WEVKFEGIALGD----QYAALENHGAAIDTGTSLITLPSGLAEIINTEIGAK-KGWTGQY 325

Query: 460 TVPCRSVSSNTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQE-----SQHVILGDI 514
           T+ C +     +L F+F G + +    D+ ++ S  +CI A+ P +         I+GD 
Sbjct: 326 TLDCDTRDGLPDLTFNFNGKNFTISPFDYTLEVSG-SCISAIMPMDFPEPMGPMAIVGDA 384

Query: 515 FLTHAYVVYDLDNYVIAL 532
           FL   Y +YDLDN+ + L
Sbjct: 385 FLRKYYSIYDLDNHAVGL 402

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 24/30 (80%)

Query: 106 YSVELAIGTPPQHVTVLVDTGSADLWVTGS 135
           Y  ++++GTPPQ+  V++DTGS++LWV  S
Sbjct: 92  YFADISVGTPPQNFKVILDTGSSNLWVPSS 121

>ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 408

 Score = 89.0 bits (219), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 81/319 (25%), Positives = 140/319 (43%), Gaps = 54/319 (16%)

Query: 235 IPRSE-RTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTG 293
           +P  E R + C+ +  ++  RSST+K N T   ++YG  +   G  ++D   +SDL + G
Sbjct: 119 VPGKECRAMACRLHKRYDHDRSSTYKENGTLTGVTYGSGSIM-GYVSEDTFRISDLEIPG 177

Query: 294 LSFAVANMTNSTV-------GVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGA 346
             F        +V       G+LG+  P+L     G +   Q+ M + +           
Sbjct: 178 QQFTETTDEPGSVFVFAAFDGILGLAYPSLGY---GVTPPFQQLMEKKL----------- 223

Query: 347 IHTTTYSLFLDDLD--ESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTL 404
           +    + ++LDD+   E +G ++ G  D +K+ G++  +P+    R   Y   + FD   
Sbjct: 224 VKEPVFGMYLDDMKTGEGNGQLVLGGYDETKFKGEIAWLPV----RRQAYWE-VVFDSVT 278

Query: 405 FG---IGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTV 461
            G   I L+N                DSGT++  FP+ +      +++     R G   V
Sbjct: 279 VGDDNIPLEN-----------YGAAIDSGTSLITFPSELFNQFISKLSGVTKDRQGNVYV 327

Query: 462 PCRSVSSNTNLVFDFGG--FHISGPLQDFLIQTSQQT--CILAMAPQE----SQHVILGD 513
            C +  +   L F FGG  F ISG  +D++I    Q+  C+ A+   +     +  I+GD
Sbjct: 328 DCANKQTAPPLTFGFGGHKFSISG--EDYIISVPGQSARCMPAIVQLDIDSAGKVAIIGD 385

Query: 514 IFLTHAYVVYDLDNYVIAL 532
           +FL   Y +YD  N  + L
Sbjct: 386 VFLRRYYSIYDFGNNAVGL 404

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 88  NEDGAGYEDVKITNQQSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLNSR 147
           N DG   E   + N  + Y+ ++ IGTPPQ   V+VDTGS+ LWV G         L+ R
Sbjct: 77  NNDGHVSELANLAN--NIYAADVTIGTPPQDFRVVVDTGSSTLWVPGKECRAMACRLHKR 134

>KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 409

 Score = 87.0 bits (214), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 80/308 (25%), Positives = 135/308 (43%), Gaps = 34/308 (11%)

Query: 235 IPRSE-RTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTG 293
           +P +E  +L C  +  ++   SST+K N + F+I YG  +   G  ++D+L + DL +  
Sbjct: 122 VPSAECGSLACFLHTKYDHEASSTYKANGSEFAIQYGSGSL-EGYVSRDLLTIGDLVIPD 180

Query: 294 LSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLK--QSGAIHTTT 351
             FA A          G         + G  G     +      P V    ++  +    
Sbjct: 181 QDFAEATSEPGLAFAFG--------KFDGILGLAYDSISVNRIVPPVYNAIKNKLLDDPV 232

Query: 352 YSLFLDDLDESH--GSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGL 409
           ++ +L D D+S   G   FG ID  KYTG++  +P    +R   Y     ++V   GIGL
Sbjct: 233 FAFYLGDSDKSEDGGEASFGGIDEEKYTGEITWLP----VRRKAY-----WEVKFEGIGL 283

Query: 410 QNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSN 469
             GE              D+GT++   P+ + E++  +I A+     G Y+V C S  S 
Sbjct: 284 --GEE--YATLEGHGAAIDTGTSLIALPSGLAEILNAEIGAK-KGWSGQYSVDCESRDSL 338

Query: 470 TNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQH-----VILGDIFLTHAYVVYD 524
            +L  +F G++ +    D+ ++ S  +CI A  P +         I+GD FL   Y +YD
Sbjct: 339 PDLTLNFNGYNFTITAYDYTLEVS-GSCISAFTPMDFPEPVGPLAIIGDAFLRKYYSIYD 397

Query: 525 LDNYVIAL 532
           + +  + L
Sbjct: 398 IGHDAVGL 405

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 50/100 (50%), Gaps = 13/100 (13%)

Query: 60  LPFEKYT---GDSFESATRNNKPLNQLLKRDNED----GAGYEDVKITNQ-QSFYSVELA 111
           +PF ++    G+ + ++ +   P  +   +DN D      G   V +TN   + Y  E+ 
Sbjct: 43  VPFAEHVAQLGEKYLNSFQRAYP-QESFSKDNVDVFVAPEGSHSVPLTNYLNAQYFTEIT 101

Query: 112 IGTPPQHVTVLVDTGSADLWV----TGSMNPFCQSSLNSR 147
           +G+PPQ   V++DTGS++LWV     GS+  F  +  +  
Sbjct: 102 LGSPPQSFKVILDTGSSNLWVPSAECGSLACFLHTKYDHE 141

>Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W
           (REAL)
          Length = 333

 Score = 85.1 bits (209), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 91/186 (48%), Gaps = 8/186 (4%)

Query: 402 VTLFGIGLQNGE--RNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFY 459
           +T+ G+G QN    ++            DSGT++   P S+ + +A  +NA YSA  G Y
Sbjct: 1   MTIQGLGAQNKSSCQHETFMTTKYPVLLDSGTSLLNAPKSIADKMASFVNASYSADEGIY 60

Query: 460 TVPCRSVSSNTNLVFDFGGFHISGPLQDFLI--QTSQQTCILAMAPQESQHVILGDIFLT 517
            + C   + +    FDFG   I+ PL   ++  +T    C  A+ P  +  ++LGD+FL+
Sbjct: 61  ILDCPESTYDVEYTFDFGDLQINVPLTSLILSPETEGGYCGFAVQPT-NDSMVLGDVFLS 119

Query: 518 HAYVVYDLDNYVIALXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTANRPVQS 577
            AYVV+DLDNY I+L               + + T+ +IP    A   ++ W+ N P   
Sbjct: 120 SAYVVFDLDNYKISL-AQANWNASNDSKQLVNIPTDGSIPSGKSA--TAQPWSTNVPFTV 176

Query: 578 GGNIFA 583
             +I+A
Sbjct: 177 TSDIYA 182

>Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii ACR144W ACR143W
          Length = 415

 Score = 86.3 bits (212), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 77/297 (25%), Positives = 123/297 (41%), Gaps = 30/297 (10%)

Query: 244 CQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANMTN 303
           C  +  F+  RSS++  N + FS+SYG  +   G  + D L + DL +    FA A +  
Sbjct: 137 CLNHARFDHDRSSSYAKNDSRFSVSYGKGSM-EGFVSYDTLKIGDLTIKNQGFAEATVEP 195

Query: 304 STVGVLGIGLPALESTYSG-ASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDL--- 359
            +  V G     L   Y G A        Y+ ++        G +    ++ +L D    
Sbjct: 196 GSAFVYGQFDGILGLAYDGLAVNHIVPPFYEAVH-------QGLLDEPVFAFYLSDEKKG 248

Query: 360 DESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXXXX 419
           D   G V+FG  D +K+TG++  +P+I         N I      F   LQN        
Sbjct: 249 DSLAGEVVFGGYDETKFTGEISWLPVIRKAYWEVELNSITLGSQKF--QLQN-------- 298

Query: 420 XXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGF 479
                   D+GT+   FP+ + +    +  A      G    PC S S   +L F+  G 
Sbjct: 299 ---YGGALDTGTSFITFPSELYQEFVSKTGATVDPDDGHIIAPC-SGSGFPDLTFELAGR 354

Query: 480 HISGPLQDFLIQTSQQTCILAMAPQE----SQHVILGDIFLTHAYVVYDLDNYVIAL 532
             +    D+++Q    TC +A+ P +     + VI+GD+FL   Y +YDL    + L
Sbjct: 355 SFTISSSDYVVQWDDTTCAVAITPLDLGGAGKMVIIGDVFLRRWYSIYDLSKNAVGL 411

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (67%), Gaps = 1/40 (2%)

Query: 106 YSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLN 145
           Y  E+ +GTPPQ   V++DTGS++LWV  + N   ++ LN
Sbjct: 101 YYSEIGLGTPPQSFKVVMDTGSSNLWVP-NKNCVSEACLN 139

>Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)
          Length = 123

 Score = 79.7 bits (195), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 60/95 (63%), Gaps = 1/95 (1%)

Query: 244 CQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANMTN 303
           C  +GTF++  SSTFK N T F  +YGD T+  GT+  DV++L ++ +   SF VAN T 
Sbjct: 30  CAYWGTFSARNSSTFKCNDTQFDETYGDGTYYRGTYGTDVVSLGNITLESFSFGVANNTE 89

Query: 304 STVGVLGIGLPALESTYSGASGATQRQMYQYMNFP 338
           +  G+LGI LPA E+T+S   GA     ++Y NFP
Sbjct: 90  NQGGILGISLPAGENTHS-LGGAYNTTPFEYENFP 123

>TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.677
           YPL154C
          Length = 419

 Score = 85.9 bits (211), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 80/319 (25%), Positives = 140/319 (43%), Gaps = 54/319 (16%)

Query: 235 IPRSERT-LDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT- 292
           +P  + T L C  +  ++   S+T++ N T F+I YG  +   G  ++D L + D  V  
Sbjct: 130 VPSKDCTSLACYLHSKYDHDESTTYEKNGTKFTIQYGSGSM-DGYISRDTLIIGDDLVIP 188

Query: 293 -----------GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVL 341
                      GL+FA         G+LG+    +         A  + +  + N    +
Sbjct: 189 EQDFAEATSEPGLAFAFGKFD----GILGLAYDTI---------AVNKVVPPFYN---AI 232

Query: 342 KQSGAIHTTTYSLFLDDLDE---SHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPI 398
           KQ G +    ++ +L D ++   S G   FG  D SK+TG +  +P+    R   Y   +
Sbjct: 233 KQ-GILDENKFAFYLGDTNKDNKSGGEATFGGYDKSKFTGDITWLPV----RRKAYWE-V 286

Query: 399 QFDVTLFGIGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGF 458
           +FD    G        +            D+GT++   P+ + E++  QI A+ S   G 
Sbjct: 287 KFDSIALG--------DEVASLDGYGAAIDTGTSLITLPSGLAEVINTQIGAKKSWS-GQ 337

Query: 459 YTVPCRSVSSNTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQH-----VILGD 513
           YT+ C +  +  ++ F+F G++ +    D+ ++ S  +CI A+ P +         I+GD
Sbjct: 338 YTIDCDTRDALPDMTFNFNGYNFTVSPYDYTLEMSG-SCISAITPMDFPEPVGPLAIIGD 396

Query: 514 IFLTHAYVVYDLDNYVIAL 532
            FL   Y +YDLDN  + L
Sbjct: 397 AFLRKYYSIYDLDNNAVGL 415

 Score = 37.7 bits (86), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 46/80 (57%), Gaps = 6/80 (7%)

Query: 55  LKYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNE-DGAGYEDVKITNQ-QSFYSVELAI 112
           +KY++  FEK+     E   + N P  Q +   N  +  G  +V ++N   + Y  ++++
Sbjct: 55  MKYLR-NFEKFNP---EVQFQANHPFGQNVFSTNPLNEGGSHNVPLSNYLNAQYYTDISL 110

Query: 113 GTPPQHVTVLVDTGSADLWV 132
           GTP Q+  V++DTGS++LWV
Sbjct: 111 GTPKQNFKVILDTGSSNLWV 130

>Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {ON}
           YPL154C (REAL)
          Length = 406

 Score = 85.5 bits (210), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 79/318 (24%), Positives = 138/318 (43%), Gaps = 53/318 (16%)

Query: 235 IPRSE-RTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT- 292
           +P +E  +L C  +  ++   SS++K N T F+I YG  +   G  +QD L++ DL +  
Sbjct: 118 VPSTECGSLACFLHSKYDHEASSSYKPNGTEFAIQYGTGSL-EGYISQDTLSIGDLTIPK 176

Query: 293 ----------GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLK 342
                     GL+FA         G+LG+G   +         +  + +  + N      
Sbjct: 177 QDFAEATSEPGLTFAFGKFD----GILGLGYDTI---------SVDKVVPPFYN----AI 219

Query: 343 QSGAIHTTTYSLFLDDLD---ESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQ 399
           Q   +    ++ +L D     E+ G   FG ID SK+ G +  +P+    R   Y     
Sbjct: 220 QQDLLDEKKFAFYLGDTSKDSENGGEATFGGIDKSKFKGDVTWLPV----RRKAY----- 270

Query: 400 FDVTLFGIGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFY 459
           ++V   GIGL +                D+GT++   P+ + E++  +I A+     G Y
Sbjct: 271 WEVKFEGIGLGH----EFAELEGHGAAIDTGTSLITLPSGLAEMINAEIGAK-KGWSGQY 325

Query: 460 TVPCRSVSSNTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQH-----VILGDI 514
            + C +     +L F+F G++ +    D+ ++ S  +CI A+ P +         I+GD 
Sbjct: 326 ALDCNTRDGLPDLTFNFNGYNFTIGPYDYTLEVSG-SCISAITPMDFPEPVGPLAIIGDA 384

Query: 515 FLTHAYVVYDLDNYVIAL 532
           FL   Y +YDL N  + L
Sbjct: 385 FLRKYYSIYDLGNDAVGL 402

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 5/60 (8%)

Query: 93  GYEDVKITNQ-QSFYSVELAIGTPPQHVTVLVDTGSADLWV----TGSMNPFCQSSLNSR 147
           G  DV +TN   + Y  ++++G PPQ+  V++DTGS++LWV     GS+  F  S  +  
Sbjct: 78  GGHDVPLTNYLNAQYYTDISLGNPPQNFKVILDTGSSNLWVPSTECGSLACFLHSKYDHE 137

>Suva_9.186 Chr9
           (310161..310220,310267..310332,310362..310451,
           310470..310622,310626..310658,310662..310688,
           310692..310742,310746..310787,310807..310833,
           310840..311922) [1632 bp, 543 aa] {OFF} YIL015W (PSEUDO)
          Length = 543

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 91/192 (47%), Gaps = 8/192 (4%)

Query: 397 PIQFDVTLFGIGLQNGE--RNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSA 454
           P    +T+ G+G QN    ++            DSGT++   P S+ + +A  +NA YSA
Sbjct: 206 PATLAMTIQGLGAQNKSSCQHETFMTTKYPVLLDSGTSLLNAPKSIADKMASFVNASYSA 265

Query: 455 RLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQDFLI--QTSQQTCILAMAPQESQHVILG 512
             G Y + C   + +    FDFG   I+ PL   ++  +T    C  A+ P     ++LG
Sbjct: 266 DEGIYILDCPESTYDVEYTFDFGDLQINVPLTSLILSPETEGGYCGFAVQPTNDS-MVLG 324

Query: 513 DIFLTHAYVVYDLDNYVIALXXXXXXXXXXXXXXXIELITNSTIPRAIRAPLYSETWTAN 572
           D+FL+ AYVV+DLDNY I+L               + + T+ +IP    A   ++ W+ N
Sbjct: 325 DVFLSSAYVVFDLDNYKISL-AQANWNASNDSKQLVNIPTDGSIPSGKSAT--AQPWSTN 381

Query: 573 RPVQSGGNIFAG 584
            P     +I+A 
Sbjct: 382 VPFTVTSDIYAS 393

>KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 558

 Score = 83.6 bits (205), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 84/303 (27%), Positives = 128/303 (42%), Gaps = 34/303 (11%)

Query: 289 LNVTGLSFAVANMTNSTV-GVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAI 347
           L +   SF +AN T S V G LG+  P         S       Y ++     LK +G I
Sbjct: 148 LTINSTSFILANETGSLVHGALGLSGPISVPASDSVSSLNFDDSYYFLTH---LKNAGVI 204

Query: 348 HTTTYSLFLDDLDE----------SHGSVLFGAIDHSKYTGQLYTVPMINIM-RNSGYSN 396
            T++YSL++++             + G++L G++D   Y G L +   I     +SGY +
Sbjct: 205 ETSSYSLWVNNASNHSVDGQINRANAGTLLLGSVDPKYYDGDLISFGSIPFKDESSGYLS 264

Query: 397 PIQFDVTLFGIGLQNGER---NXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYS 453
                V +  + + N E+   N             S    SY P S++  V+ Q NA Y 
Sbjct: 265 TGYPIVPMSRVSIANSEQEAVNLTDSSFLQPVFIHSRYLYSYLPLSLIIQVSIQTNAVYV 324

Query: 454 ARLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQDFLIQT-------------SQQTCILA 500
             L  + V C      +NL+F+FG  +IS P  DFL  T              ++ C L 
Sbjct: 325 ESLDRWLVACDIGDMGSNLIFEFGNLNISVPTVDFLGATYNMYSNSSLRFTNGKEACYLK 384

Query: 501 MAPQ-ESQHVILGDIFLTHAYVVYDLDNYVIALXXXXXXXXXXXXXXX--IELITNSTIP 557
           M P   +   +LG  F+ +AY+V+D+DN  IAL                  + I +STIP
Sbjct: 385 MYPNYATSFSVLGQSFIKNAYIVHDVDNSNIALAQAASDEAVEKAANNSPAKKIESSTIP 444

Query: 558 RAI 560
            A+
Sbjct: 445 YAL 447

>TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON}
           Anc_8.677 YPL154C
          Length = 408

 Score = 79.3 bits (194), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 82/310 (26%), Positives = 134/310 (43%), Gaps = 47/310 (15%)

Query: 241 TLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNV--------- 291
           +L C  +  ++ S SS++K N T F+I YG  +   G  +QD L++ DL +         
Sbjct: 124 SLACFLHSKYDHSASSSYKPNGTDFAIQYGSGSL-EGYISQDTLSVGDLVIPKQDFAEAT 182

Query: 292 --TGLSFAVANMTNSTVGVLGIGLP--ALESTYSGASGATQRQMYQYMNFPMVLKQSGAI 347
              GL+FA         G+LG+     +++        A  + +     F   L  S   
Sbjct: 183 SEPGLAFAFGKFD----GILGLAYNTISVDKVVPPFYNAIDQDLLDEPRFAFYLGDSSDS 238

Query: 348 HTTTYSLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGI 407
             ++          S G   FG ID SK+ G++  +P    +R   Y     ++V   GI
Sbjct: 239 EDSS---------VSGGVATFGGIDKSKFKGEISWLP----VRRKAY-----WEVKFEGI 280

Query: 408 GLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVS 467
           GL     +            D+GT++   P+ + E++  +I A+     G YTV C + S
Sbjct: 281 GL----GDEFAILDGHGAAIDTGTSLITLPSGLAEIINSEIGAK-KGWSGQYTVDCETRS 335

Query: 468 SNTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQH-----VILGDIFLTHAYVV 522
           S  +L F+F G + +    D+ ++ S  +CI A+ P +         I+GD FL   Y V
Sbjct: 336 SLPDLTFNFSGKNYTIGPYDYTLEVS-GSCISAITPMDFPEPVGPLAIVGDTFLRRFYSV 394

Query: 523 YDLDNYVIAL 532
           YDL N  + L
Sbjct: 395 YDLGNNAVGL 404

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 5/56 (8%)

Query: 95  EDVKITNQ-QSFYSVELAIGTPPQHVTVLVDTGSADLWV----TGSMNPFCQSSLN 145
            DV +TN   + Y  ++++GTP Q+  V++DTGS++LWV     GS+  F  S  +
Sbjct: 79  HDVPLTNYLNAQYYTDISLGTPAQNFKVILDTGSSNLWVPSVDCGSLACFLHSKYD 134

>Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {ON}
           complement(35798..36997) [1200 nt, 400 aa]
          Length = 399

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 129/301 (42%), Gaps = 33/301 (10%)

Query: 241 TLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVAN 300
           +L C  +  ++ S SST+++N + F I YG  +   G  +QD L + DL +    FA A 
Sbjct: 119 SLACYLHSKYDHSLSSTYRSNGSDFVIQYGSGSL-KGYISQDTLTIGDLIIPQQDFAEAT 177

Query: 301 MTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLK--QSGAIHTTTYSLFLDD 358
                    G         + G  G     +      P +      G +    ++ +L D
Sbjct: 178 AEPGLAFAFG--------KFDGILGLAYDSISVNKAVPPLYNAIHRGLLDKPMFAFYLGD 229

Query: 359 LDESH--GSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNX 416
              S   G   FG  D S++ G++  +P+    R   Y   +QFD      G++ G++  
Sbjct: 230 EKSSKNGGEATFGGYDPSRFEGEIKWLPV----RRKAYWE-VQFD------GIKLGDK-- 276

Query: 417 XXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDF 476
                      D+GT++   P+ + + +  +I A+ S   G YT+ C+   S   L  +F
Sbjct: 277 FMKLEGHGAAIDTGTSLITLPSQIADFLNNEIGAKKSWN-GQYTIDCKKRESLPKLTLNF 335

Query: 477 GGFHISGPLQDFLIQTSQQTCILAMAPQE-SQHV----ILGDIFLTHAYVVYDLDNYVIA 531
              + +    D+ ++ S  +CI A+ P +  Q V    I+GD FL   Y +YDL+N  + 
Sbjct: 336 YNHNFTIDPFDYTLEISG-SCISAITPMDFPQPVGPLSIIGDAFLRRFYSIYDLENNAVG 394

Query: 532 L 532
           L
Sbjct: 395 L 395

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 22/27 (81%)

Query: 106 YSVELAIGTPPQHVTVLVDTGSADLWV 132
           Y  +++IGTPPQ   V++DTGS++LWV
Sbjct: 86  YYTDVSIGTPPQKFKVILDTGSSNLWV 112

>KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {ON}
           Anc_8.677 YPL154C
          Length = 416

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 74/305 (24%), Positives = 126/305 (41%), Gaps = 51/305 (16%)

Query: 241 TLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT-------- 292
           +L C  +  ++   SST+  N T F+I YG      G  + D + + DL +         
Sbjct: 132 SLACFLHNKYDHRVSSTYVRNGTRFAIRYGSGAL-EGYMSNDTVTVGDLQIPKQDFAEAT 190

Query: 293 ---GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHT 349
              GL+FA         G+ G+    +         +  R +  + N        G +  
Sbjct: 191 SEPGLAFAFGKFD----GIFGLAFDTI---------SVNRAVPPFYN----AVNRGLLDA 233

Query: 350 TTYSLFLDD--LDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGI 407
             ++ +L D  L +  G V FG  D +++TG +  +P+    R   Y   + F+   FG 
Sbjct: 234 PQFAFYLGDKRLRKEGGEVTFGGYDETRFTGNITWLPV----RREAYWE-VDFNGISFG- 287

Query: 408 GLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVS 467
                  +            D+GT++   P+ + E++  QI A+ +   G Y + C   S
Sbjct: 288 -------SQYAPLTATGAAIDTGTSLITLPSGLAEILNAQIGARKNWS-GQYVLDCSRRS 339

Query: 468 SNTNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAPQESQH-----VILGDIFLTHAYVV 522
           +  ++ F+ GG + S    D+ ++ S  TCI A+ P +         I+GD FL   Y V
Sbjct: 340 TLPDITFNLGGSNFSIGPYDYTLEASG-TCISAIVPMDFPEPVGPLAIIGDAFLRRWYSV 398

Query: 523 YDLDN 527
           YDL N
Sbjct: 399 YDLGN 403

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 15/88 (17%)

Query: 59  KLPFEKYT---GDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSF---------- 105
           KL F+++    G  + +A     P + +L RD+     + D     QQ+           
Sbjct: 39  KLSFDQHMAHLGSKYVTAFEKAHP-DTVLSRDHPFFKNFIDKHFDAQQNHEVPLNNYLNA 97

Query: 106 -YSVELAIGTPPQHVTVLVDTGSADLWV 132
            Y  +++IG+P Q   V++DTGS++LWV
Sbjct: 98  QYFADISIGSPGQTFRVIMDTGSSNLWV 125

>TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.401
           YDR349C
          Length = 624

 Score = 70.5 bits (171), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 94/359 (26%), Positives = 142/359 (39%), Gaps = 73/359 (20%)

Query: 240 RTLDCQEYGTFN--SSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDL-------- 289
            T  C    +FN  +S SS    +   FS+ + DS   +GT+ +D L  S+L        
Sbjct: 86  ETSSCVVTSSFNNQTSNSSVLLQDGQIFSLDFIDSISLNGTFYKDDLTCSNLVQPLKLNE 145

Query: 290 ------------------NVTGLSFAVA-NMTNSTVGVLGIGLPALESTYSGASGATQRQ 330
                              +  LSF  A +    T+G LG+      ST S  SGA+   
Sbjct: 146 SLKSPDGLYTTNTTDDSITLVALSFINAIDYQGLTIGSLGLA----SSTTSDLSGASLDF 201

Query: 331 MYQYMNFPMVLKQSGAIHTTTYSLFL--DDLDESH------------GSVLFGAIDHSKY 376
           +    +F   L  S  I T +YSL+L  D L  ++            G+++ GA+D   Y
Sbjct: 202 VDDSFSFLTYLSNSEVIDTPSYSLWLGGDTLPYTNMTSINSTTIDYCGNLVLGAVDQRYY 261

Query: 377 TGQLYTVPMI-----NIMRNSGYSNPIQFDVTLFGIGLQNG---ERNXXXXXXXXXXXXD 428
            G+L    M+     N+     Y  PI   + +  I ++N    + N            D
Sbjct: 262 EGRLVQFDMLPALLNNVTEAVTYGLPI---IPMGPIYIENSSGTQLNLTTTNFLEPVLLD 318

Query: 429 SGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQDF 488
           S  T +  P + V  +A Q+NA Y    G + V C     N NL F+F G  I   L DF
Sbjct: 319 SRYTNARLPLNTVIQIATQLNAAYVEEFGSWIVECSLAEMNVNLNFNFQGLTIPVSLNDF 378

Query: 489 L--------------IQTSQQTCILAMAPQ-ESQHVILGDIFLTHAYVVYDLDNYVIAL 532
           L               ++S+  C LA+ P  +    ILG  FL + Y+  D +   +A+
Sbjct: 379 LSRVINSTTGEPIKFSESSEDACALAVYPNTDIGFNILGGPFLKNIYLAIDNEGRSVAI 437

>TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.401
           YDR349C
          Length = 573

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 123/295 (41%), Gaps = 43/295 (14%)

Query: 276 SGTWAQD-----VLNLSDLNVTGLSFAVANMTN-STVGVLGIGLPALESTYSGASGATQR 329
           SGT++ D     ++    ++++ +SF   N  +  T G LG+G        S  S A   
Sbjct: 132 SGTYSIDSSSTAIIGSDYMSISNISFFETNYASFYTAGSLGLG-----GRISDGSAAIDS 186

Query: 330 QMYQYMNFPM-VLKQSGAIHTTTYSLFL--DDLDESH-----------GSVLFGAIDHSK 375
           + +    F +  L   G I T +YSL+   D +               G ++ GA+D S 
Sbjct: 187 EKFDSSFFFLDRLMNLGIIKTPSYSLWFGADTVPYDRRKLASGTMADCGKLILGAVDPSL 246

Query: 376 YTGQLYTVPMINIMRNSGYSNPIQFDVTLFG---IGLQNGER-NXXXXXXXXXXXXDSGT 431
           YTG L +  MI  +     +    + +   G   I   NG+  N            DS  
Sbjct: 247 YTGILRSFKMIPFIDPVSQAQSNNYPILPLGTIYINSANGKSLNMTSEEFVEPVLLDSRY 306

Query: 432 TISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQDFLI- 490
           + +Y P   +  +A QI A +   L  + V C     + +L F FG   I  PL+DFL+ 
Sbjct: 307 STTYLPIDAIVQIAVQIGATFVESLDKWLVACSVAKLDVSLDFTFGNIEIRVPLEDFLVT 366

Query: 491 ------------QTSQQTCILAMAPQE-SQHVILGDIFLTHAYVVYDLDNYVIAL 532
                        T ++ C LAM  ++ + + +LG  FL + Y+  D+++  IA+
Sbjct: 367 TYDPKSNTSLHFSTGEEACFLAMVSKDKTGYNVLGGPFLKNLYMAVDIEDSSIAI 421

>TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.401
           YDR349C
          Length = 609

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 90/226 (39%), Gaps = 36/226 (15%)

Query: 341 LKQSGAIHTTTYSLFLDD----LDESH----------GSVLFGAIDHSKYTGQLYTVPMI 386
           L  SG I T +YS++  +    +D  H          G ++FG +D S   G   +  MI
Sbjct: 229 LLNSGVIQTASYSMWFANGSSYIDTKHFPYEEKKSDYGLIVFGGVDSSLIDGTFQSFTMI 288

Query: 387 ------NIMRNSGYSNPIQFDVTLFGIGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSV 440
                 + +  SGY  PI     ++ I       N            DS  T S  P S 
Sbjct: 289 PYEDTSDGLTTSGY--PILPMGPIYIIANSGRTLNLTTLDFLEPVLLDSRITNSRLPASF 346

Query: 441 VELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQDFLIQT-------- 492
           +  VA Q+ A Y   L  + VPC     N N  F FG   I  PL+DFL+ +        
Sbjct: 347 IIQVAIQLEAMYLESLDRWVVPCSLADYNVNFDFSFGSVRIRVPLEDFLVPSGLTGDNKT 406

Query: 493 -----SQQTCILAMAPQ-ESQHVILGDIFLTHAYVVYDLDNYVIAL 532
                ++  C LAM P  +    ILG  FL +A +  D  +  IA+
Sbjct: 407 IHFSQNEDACYLAMYPNTDIGFNILGTPFLKNAVIAVDHSSSQIAI 452

>AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
           (PEP4)
          Length = 268

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 129/294 (43%), Gaps = 46/294 (15%)

Query: 253 SRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANMTNSTVGVLGIG 312
           + SST+K++     ++ G  +   G  + DVL + D  +    FA A    S+V      
Sbjct: 3   ANSSTYKSSGEEVELASGTGSM-QGYLSTDVLGMGDAVLGEQGFAEAT---SSV------ 52

Query: 313 LPALESTYSGASGATQRQMYQYMNFPMV--LKQSGAIHTTTYSLFLDDLDESH---GSVL 367
           LP + S Y G  G   R++ +    P +  + + G +    + +FL   + +H   G ++
Sbjct: 53  LPFIAS-YQGVFGLGHRELAKGGQVPPIYNMMERGQLKDPMFGIFLPK-NLAHINEGEII 110

Query: 368 FGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNXXXXXXXXXXXX 427
           FG  D +K+ G L  +P+       G+   ++F+    G     GE              
Sbjct: 111 FGGYDSTKFAGSLEWLPITK----KGFWE-VEFNSISTGESTVQGE--------GLGAIL 157

Query: 428 DSGTTISYFPTSVVELVARQINAQYSARLGFYT---VPCRSVSSNTNLVFDFGG--FHIS 482
           D+G++++  PT + +    + N    A LG  T   V C +  +   +VF+ GG  F I+
Sbjct: 158 DTGSSLTLLPTEIFD----KFNGALEAALGSKTGGRVSCSARETAPEIVFELGGKKFAIT 213

Query: 483 GPLQDFLIQTSQQTCILAMAPQ----ESQHVILGDIFLTHAYVVYDLDNYVIAL 532
           G   +  I  +   C++ + PQ    +S  VILG  FL   Y VYDL +  + L
Sbjct: 214 G---NEYIMPAGSECMVTIRPQASGAQSNVVILGTPFLRKFYSVYDLGSDRVGL 264

>NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa]
           {ON} Anc_5.401 YDR349C
          Length = 609

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 93/222 (41%), Gaps = 30/222 (13%)

Query: 341 LKQSGAIHTTTYSLFL------------DDLDESHGSVLFGAIDHSKYTGQLYTVPMINI 388
           L Q+  I + +YSL+L            + +  S G ++ GA+D + +TG      M+  
Sbjct: 210 LYQTNLIDSHSYSLWLAMNQTYNGTRVQNSVTSSFGKLILGAVDPTLFTGSFLQFEMLPA 269

Query: 389 MRNSGYSNPIQFDVTLFG---IGLQNGER-NXXXXXXXXXXXXDSGTTISYFPTSVVELV 444
           + +   +  I + +   G   +  ++GE  N            DS  T +Y P +++  V
Sbjct: 270 LESDSATETIGYPIIPMGPIYVVSKSGEMANVTSKDFLEPVFLDSTYTSTYLPLNMIIQV 329

Query: 445 ARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQDFL-------------IQ 491
           A QI A Y   L  + VPC   + +  L F F    I  PL D L               
Sbjct: 330 AIQIGAMYVESLERWLVPCNIANQHATLDFTFQDVSIRVPLTDLLGTTYDSSTNTSMHFS 389

Query: 492 TSQQTCILAM-APQESQHVILGDIFLTHAYVVYDLDNYVIAL 532
           T  + C L + + Q + + ILG  FL H Y+  DLD   IA+
Sbjct: 390 TGDEACYLKIFSNQMTGYNILGRPFLKHVYMAVDLDGNNIAI 431

>CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa]
           {ON} similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154c PEP4 aspartyl protease Saccharopepsin precursor
          Length = 415

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 77/317 (24%), Positives = 130/317 (41%), Gaps = 57/317 (17%)

Query: 241 TLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNV--------- 291
           +L C  +  ++ S+SST+  +    SISYG  +   G  ++D L + DL +         
Sbjct: 124 SLACFLHNKYDHSQSSTYIKDGRPLSISYGSGSI-EGYISEDNLQIGDLTIQNQKFGETT 182

Query: 292 --TGLSFAVANMTNSTVGVLGIGLP--ALESTYSGASGATQRQMYQYMNFPMVLKQSGAI 347
              GL+FA         G+LG+     A +        A Q+ +     F   LK     
Sbjct: 183 SEPGLAFAFGKFD----GILGLAYDTIAQDDITPPFYSAIQQHLLDESKFSFYLKSVNDP 238

Query: 348 HTTTYSLFLDDLDESHGSVL-FGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFG 406
                S        S G V   G +D SK+ G L  +P+ ++ R + +  P+        
Sbjct: 239 AAEGGS-------ASDGGVFTLGGVDSSKFKGDL--IPL-HVRRQAYWEVPLN------- 281

Query: 407 IGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSV 466
             ++ G+++            D+GT++   P+ + E++  QI A+     G YT+ C + 
Sbjct: 282 -AIKLGDQSTGKLENTGAAI-DTGTSLITLPSDMAEIINAQIGAK-KGWTGQYTLECSTR 338

Query: 467 SSNTNLVFDFGGFHISGPLQDFLIQTSQQT------CILAMAPQE-----SQHVILGDIF 515
           +   +L F   G        DF++   + T      CI  + P +      +  ILGD F
Sbjct: 339 AKLPDLTFTLDG-------HDFVLSPFEYTLEVSGSCISVITPMDFPEPIGRMAILGDAF 391

Query: 516 LTHAYVVYDLDNYVIAL 532
           L   Y V+DLD  V++L
Sbjct: 392 LRRYYSVFDLDANVVSL 408

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 4/44 (9%)

Query: 106 YSVELAIGTPPQHVTVLVDTGSADLWV----TGSMNPFCQSSLN 145
           Y  ++++GTPPQ   V++DTGS++LWV     GS+  F  +  +
Sbjct: 91  YFADISLGTPPQKFKVILDTGSSNLWVPSVDCGSLACFLHNKYD 134

>Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii ACR150W
          Length = 576

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 88/347 (25%), Positives = 136/347 (39%), Gaps = 67/347 (19%)

Query: 244 CQEYGTFNSSRSSTFKNNYTS----FSISYGDSTFASGTWAQDVLNLSDLNVTG------ 293
           C     + S  S++FKN   S    +++S+ D T   G+   D+ N + +  +G      
Sbjct: 86  CTHGNLYYSGESTSFKNQSGSLNAAYNMSFIDYTEFYGSAGIDIANFTSVESSGTEGDPT 145

Query: 294 ----------------LSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNF 337
                            SF  A  +N   G LG+G   L    SG +  +      +   
Sbjct: 146 NTQVQWFGKHTLSIPEFSFFRAEHSNIVDGSLGLGARIL----SGTAEDSSGFDSSFFFL 201

Query: 338 PMVLKQSGAIHTTTYSLFLDD----LDESH------GSVLFGAIDHSKYTGQLYTVPMIN 387
            M LK +  I +T+YS++L +    L+ S       G++L GA+D + + G  Y   M+ 
Sbjct: 202 DM-LKNANFIKSTSYSIWLGNDNSTLNASRLASSDVGTLLLGAVDPNYFIGNFYRFKMLP 260

Query: 388 IMRNSGY-----SNPIQFDVTLFGIGLQNGE---RNXXXXXXXXXXXXDSGTTISYFPTS 439
             R+S       S PI   V L  + + N +    N            D   TISY P  
Sbjct: 261 -FRDSKTETTFNSLPI---VPLTKVDIVNAKGTAVNVTQPGFMEPVLLDPRYTISYLPIE 316

Query: 440 VVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQDFL---------- 489
           ++  +A Q NA Y   L  + V C   + +  + F FG   I  PL  F+          
Sbjct: 317 LILQIAMQTNAVYVKSLDLWLVDCDVANFDAKIRFQFGDLKIDVPLSHFVSSGYVGSPIA 376

Query: 490 ---IQTSQQTCILAMAPQESQHV-ILGDIFLTHAYVVYDLDNYVIAL 532
              +  S  TC L + P  S    ILG  FL   Y+  DL+   +A+
Sbjct: 377 STQLGASNMTCQLNVYPNYSSGFSILGGTFLRSVYLSVDLEGNSVAM 423

>Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {ON}
           YDR349C (REAL)
          Length = 586

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 97/237 (40%), Gaps = 40/237 (16%)

Query: 330 QMYQYMNFPMVLKQSGAIHTTTYSLFL----------DDLDESHGSVLFGAIDHSKYTGQ 379
           Q  +Y  F  +LK +  I + +YSL+L           D   + G +L G +D S +TG 
Sbjct: 199 QYTEYSYFLSLLKDANFIESPSYSLWLAGDTSTYKTYRDPILNCGKLLLGGVDPSLFTGT 258

Query: 380 LYTVPMINIMRNSGYSNPIQFDVTL---------FGIGLQNGER-NXXXXXXXXXXXXDS 429
           L    +I       Y++P+   +T+           I   +GE  N            DS
Sbjct: 259 LGQFDLI------PYADPVTNAITIGYPIVPLGPIYIVSNSGESLNMTSKDFLSPALLDS 312

Query: 430 GTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQDFL 489
            +++SY PTS +  +A QI A Y   L  + V C        L F      I  PL+D L
Sbjct: 313 TSSVSYLPTSTIIQIAVQIAATYVESLDRWLVQCSMADMGVTLAFRLRDLFIEIPLRDLL 372

Query: 490 IQT-------------SQQTCILAMAPQESQHV-ILGDIFLTHAYVVYDLDNYVIAL 532
             T              Q+ C L +    +  + ILG+ F+ + Y+  DL++  IA+
Sbjct: 373 SSTYDTSTNSSMLFSSGQEACFLTLYANTNTGLNILGEAFMKNIYMAMDLEDNTIAI 429

>YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}
           YPS7Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance; located in the cytoplasm and
           endoplasmic reticulum
          Length = 596

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 116/280 (41%), Gaps = 37/280 (13%)

Query: 284 LNLSDLNVTGLSFAVANMTN-STVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLK 342
            N   L+++ +SF     +N  T G+LG+         +  S     Q Y    F  +LK
Sbjct: 166 FNSGSLSISNVSFFDIQSSNFKTSGLLGLSGKVTNPGNAIDSSQYTEQSY----FLSLLK 221

Query: 343 QSGAIHTTTYSLFL----------DDLDESHGSVLFGAIDHSKYTGQLYT---VPMINIM 389
            +  I +++YSL+L           D   + G +L G +D S +TG L     +P ++ +
Sbjct: 222 DADIIESSSYSLWLAGDTSTYKTYRDPISNCGKLLLGGVDPSLFTGTLGKFDLIPYVDPV 281

Query: 390 RNS---GYSNPIQFDVTLFGIGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVAR 446
            N+   GY  PI     ++ +       N            DS +++SY PTS +  +A 
Sbjct: 282 SNAVSVGY--PIVPLGPIYIVSNSGQSLNMTSKDFLSPALLDSTSSVSYLPTSTIIQIAV 339

Query: 447 QINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQDFLIQT-------------S 493
           QI A Y   L  + V C       +L F      I  PL+D L  T              
Sbjct: 340 QIAATYVESLDRWLVQCSIADMGVSLGFRLRELTIEIPLRDLLSSTYDTSTNSSMFFSSG 399

Query: 494 QQTCILAMAPQESQHV-ILGDIFLTHAYVVYDLDNYVIAL 532
           Q+ C L +    +  V ILG+ F+ + Y+  DL++  IA+
Sbjct: 400 QEACFLTLYANTNTGVNILGEAFIKNIYMAMDLEDNTIAI 439

>Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C
           (REAL)
          Length = 252

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 57/104 (54%), Gaps = 8/104 (7%)

Query: 235 IPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGL 294
           +P       C  +GTFN + SSTFK N T F ++YG       T+  DV++L ++ ++  
Sbjct: 156 LPSVHHITSCSYWGTFNPNISSTFKYNETIFDLTYG-------TYGTDVVSLGNITLSNY 208

Query: 295 SFAVANMTNSTVGVLGIGLPALESTYSGASG-ATQRQMYQYMNF 337
           +F V+N T  + G+LGI LP+ E T  G    ++ +  + Y NF
Sbjct: 209 TFGVSNDTTMSYGILGISLPSEEITDRGQDALSSNKTPFAYDNF 252

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 28/44 (63%)

Query: 106 YSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLNSRNV 149
           Y VE+ IGTPPQ   + +DTGS+D+ V  + +  C+S  +  N+
Sbjct: 94  YVVEMQIGTPPQTAYLELDTGSSDMCVNEADSAHCKSLADDNNI 137

>Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON}
           YDR349C (REAL)
          Length = 598

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 88/205 (42%), Gaps = 25/205 (12%)

Query: 349 TTTYSLFLDDLDESHGSVLFGAIDHSKYTGQL-------YTVPMINIMRNSGYSNPIQFD 401
           T+TY  + + + +  G +L G +D S +TG L       Y  P+ N++ ++GY  PI   
Sbjct: 240 TSTYQSYKESIPDC-GKLLLGGVDPSLFTGTLGKFDLIPYVDPVSNVV-STGY--PIVPL 295

Query: 402 VTLFGIGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTV 461
             ++ I       N            DS +++SY PTS +  +A QI A Y   L  + V
Sbjct: 296 GPIYIISNSGQSMNMTSKDFLSPALLDSTSSVSYLPTSTIIQIAVQIAATYVESLDRWLV 355

Query: 462 PCRSVSSNTNLVFDFGGFHISGPLQDFLIQT-------------SQQTCILAMAPQESQH 508
            C        L F F    I  PL D L  T              Q+ C L +    +  
Sbjct: 356 ECSMADMGVTLGFMFRSLTIKIPLSDLLSSTYDTTTNSSMFFSSGQEACFLTLYANTNTG 415

Query: 509 V-ILGDIFLTHAYVVYDLDNYVIAL 532
           V ILG+ F+ + Y+  DL++  IA+
Sbjct: 416 VNILGEAFMKNIYMAVDLEDNSIAI 440

>ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 393

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/305 (21%), Positives = 125/305 (40%), Gaps = 50/305 (16%)

Query: 244 CQEYGTFNSSRSSTFKNNYTSFSISY--GDSTFASGTWAQDVLNLSDLNVTGLSFAVANM 301
           C+    + S  SSTFK    +  + Y  GD   A    + D L  +   +    F  A  
Sbjct: 119 CRTRNRYRSGASSTFKATDKTLRLQYVKGD---AKARVSYDTLYFAGAKIENQGFGEAEA 175

Query: 302 TNSTV------GVLGIGLPALESTYSGASGATQRQMYQYMNFPMV--LKQSGAIHTTTYS 353
                      G++GIG P++                 Y   P +  L  SG +    + 
Sbjct: 176 IGDDFSGARFDGIIGIGYPSI----------------GYGIKPPINTLIDSGGLKDPMFG 219

Query: 354 LFLDDLDESH---GSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQ 410
           +++ +    +   G ++ G  +  K+ G +  +P   ++R + +    + D++ F +G  
Sbjct: 220 IYISNAQNRNSPVGEIVLGGYNTQKFKGDIKWLP---VLRKAFW----ETDLSAFKVG-- 270

Query: 411 NGERNXXXXXXXXXXXXDSGTTISYFPT-SVVELVARQINAQYSARLGFYTVPCRSVSSN 469
               N            D+G++    P  +  + V++   A +    G   V C +V+S 
Sbjct: 271 ----NFALDVQGLTAVFDTGSSFIIMPEDTYTDFVSQFPGASHDD--GTDYVDCSTVNSG 324

Query: 470 TNLVFDFGGFHISGPLQDFLIQTSQQTCILAMA--PQESQHVILGDIFLTHAYVVYDLDN 527
            +L  DFGG  +    +D+++Q  + TCILA++   + +  VILGD FL   Y +Y+  +
Sbjct: 325 PDLTLDFGGVALKLSARDYVMQLGRNTCILAVSGNSRVTGEVILGDTFLRRYYTIYNFGD 384

Query: 528 YVIAL 532
             I +
Sbjct: 385 NTIGV 389

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 6/58 (10%)

Query: 81  NQLLKRDNED-----GAGYEDVKITNQQSF-YSVELAIGTPPQHVTVLVDTGSADLWV 132
           ++L +R  ED     G G     + N ++F YSV++ +GTP Q+  V +DTGS+ LW+
Sbjct: 52  HELSRRTVEDEELQVGGGKFSANVYNFENFQYSVDITLGTPAQNFRVALDTGSSLLWI 109

>ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 720

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/285 (23%), Positives = 111/285 (38%), Gaps = 43/285 (15%)

Query: 283 VLNLSDLNVTGLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLK 342
           + N   L ++  SF   N T S+ GVLG+G           +     Q          L+
Sbjct: 283 LYNSHSLTLSNSSFFEINDTTSSKGVLGLG----GKINDKGTDIDSSQFDSSFFLLESLR 338

Query: 343 QSGAIHTTTYSLFL---------------DDLDESHGSVLFGAIDHSKYTGQLYTVPMI- 386
            +G I + +YSL+L               D+++   G ++ G +D   Y+G L     + 
Sbjct: 339 DNGIIESLSYSLWLGGDTRPYYDVGRNVPDEIN--CGKLILGGVDPYYYSGPLKKFNNLI 396

Query: 387 -----NIMRNSGYSNPIQFDVTLFGIGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVV 441
                  M + GY  P+    T+  +       N            DS  + S+ P   +
Sbjct: 397 FLDSRTDMLSRGY--PVLPMRTINVVSATGNSINVTNENFLTPVLLDSRYSFSHLPAETI 454

Query: 442 ELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQDFLIQT--------- 492
             +A Q+NA Y   +  + V C+      N+ F+FG   I  P +DFL+ T         
Sbjct: 455 VQIAVQVNAIYMKEVDMFVVSCKIADMGVNIQFEFGDVSIDVPFKDFLMSTHNPETNSTM 514

Query: 493 ----SQQTCILAM-APQESQHVILGDIFLTHAYVVYDLDNYVIAL 532
                 + C + M + +E+   ILG  FL + Y+  D D+  IA+
Sbjct: 515 KFSGGDEACFMTMVSSEETGFNILGTSFLRNVYLAVDHDDQSIAI 559

>SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 632

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 116/279 (41%), Gaps = 45/279 (16%)

Query: 284 LNLSDLNVTGLSFAVANMTNS-TVGVLGIG----LPALESTYSGASGATQRQMYQYMNFP 338
           L+   L++T +SF   + + S T G LG+G     P  +    G  G+          F 
Sbjct: 157 LDSDTLSMTNVSFINVDYSGSITQGALGLGGRITAPGEDINSDGFDGS--------FFFL 208

Query: 339 MVLKQSGAIHTTTYSLFL-------DDLDESH-----GSVLFGAIDHSKYTGQLY---TV 383
             L  +  I +++YSL+L       DD DE +     G ++ GA+D S YTG      T+
Sbjct: 209 EQLVANNVIDSSSYSLWLGQDVGQEDDEDEYYTEENCGKLVLGAVDPSLYTGDFVRFDTI 268

Query: 384 PMINIMRNS-GYSNPIQFDVTLFGIGLQNGER-NXXXXXXXXXXXXDSGTTISYFPTSVV 441
           P  ++   +  +  PI   +T   +   +G+  N            D+    S+ P  ++
Sbjct: 269 PFHDVDTGATSFGYPI-VPLTKVSVKASSGQTLNVTSPDFAEPVLLDTRYLYSFLPLKLI 327

Query: 442 ELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQDFL------------ 489
             +A Q NA Y   L  + V C     N +++F+F G  I  P++DFL            
Sbjct: 328 IQIAIQTNAYYVESLDRWLVSCSVGDLNASMIFEFNGLSIDVPIKDFLSNSYDSVSNSTL 387

Query: 490 -IQTSQQTCILAMAPQ-ESQHVILGDIFLTHAYVVYDLD 526
                   C L M P   +   +LG  F+ +AY+  DL+
Sbjct: 388 HFSNGNSACYLKMYPNYATGFSVLGAAFVKNAYIAADLE 426

>KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 596

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 120/281 (42%), Gaps = 40/281 (14%)

Query: 285 NLSDLNVTGLSFAVANMTNSTV--GVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLK 342
           N S ++    SF  AN   + +  G LG+   A ++ Y   S         Y+    ++ 
Sbjct: 154 NTSRISDKSFSFLSANEVAAYIQQGALGLAGRAAQTGYDNDSSDFDSS---YVLLDRLVD 210

Query: 343 QSGAIHTTTYSLFL-----DDLDESH-----GSVLFGAIDHSKYTGQLY---TVPMINIM 389
           +S  I+T+++S+++     D L+        G V+FGA+D S YTG      T+P  N  
Sbjct: 211 ES-LIYTSSFSMWMGADTRDPLESPEPSNGCGKVIFGAVDTSLYTGDFVKFDTIPFHNAR 269

Query: 390 R---NSGYSNPIQFDVTLFGIGLQNGE-RNXXXXXXXXXXXXDSGTTISYFPTSVVELVA 445
               + GY  PI   +T   +  ++GE +N            DS    +Y P  ++  +A
Sbjct: 270 TGETSRGY--PI-IPLTKVNVQSKSGETKNMTSDSFLEPVLIDSRFRYNYLPLEIIVQIA 326

Query: 446 RQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQDFL-------------IQT 492
            Q NA Y   L  + + C       +++F+FG   I+ PL + +                
Sbjct: 327 MQANAYYVESLNRWLLACDVGRLGASIIFEFGNLSINVPLNNLMGPTFDSDTNGTLHFSN 386

Query: 493 SQQTCILAMAPQESQHV-ILGDIFLTHAYVVYDLDNYVIAL 532
            QQ C L + P  +    +LG  F+ + Y+  +L++  +AL
Sbjct: 387 KQQACELKLLPSTASGFNVLGGAFIKNVYMAAELESNQVAL 427

>Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {ON}
           YDR349C (REAL)
          Length = 596

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 122/297 (41%), Gaps = 45/297 (15%)

Query: 275 ASGTWAQDVL--------NLSDLNVTGLSFAVANMTN-STVGVLGIGLPALESTYSGASG 325
           +SGT   ++L        N   L+++ +SF     +N  T G+LG+         +  S 
Sbjct: 149 SSGTLVTELLKTRGNVQFNSGSLSISNVSFFSVESSNFKTSGLLGLSGKITNPGSAADSS 208

Query: 326 ATQRQMYQYMNFPMVLKQSGAIHTTTYSLFL----------DDLDESHGSVLFGAIDHSK 375
               Q Y    F  +LK    I + +YSL+L           D   + G +L G +D S 
Sbjct: 209 HYTEQSY----FLSLLKDVNLIESPSYSLWLAGDTSTYQTHRDPIYNCGKLLLGGVDPSL 264

Query: 376 YTGQLYT---VPMINIMRNS---GYSNPIQFDVTLFGIGLQNGERNXXXXXXXXXXXXDS 429
           +TG L     +P ++ + ++   GY  PI     ++ +       N            DS
Sbjct: 265 FTGTLGKFDLIPYVDPVSSAVSTGY--PIVPLGPIYIVSNSGQSLNMTSKDFLSPALLDS 322

Query: 430 GTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQDFL 489
            +++SY PT+ +  +A QI A Y   L  + V C   +   +L F      I  PL+D L
Sbjct: 323 TSSVSYLPTNTIIQIAVQIAATYVESLDRWLVQCSMANMGVSLGFTLRELVIEIPLRDLL 382

Query: 490 IQT-------------SQQTCILAMAPQESQHV-ILGDIFLTHAYVVYDLDNYVIAL 532
             T              Q+ C L +    +  + ILG+ F+ + Y+  DL++  IA+
Sbjct: 383 SSTYDTSTNSSMFFSSGQEACFLTLYANTNTGLNILGEAFMKNIYMAMDLEDNTIAI 439

>CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {ON}
           similar to uniprot|Q06325 Saccharomyces cerevisiae
           YDR349c YPS7
          Length = 587

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 80/322 (24%), Positives = 129/322 (40%), Gaps = 64/322 (19%)

Query: 265 FSISYGDSTFASGTWAQDVLNL----SDLNVTG----------------LSFAVANMTNS 304
           +SI++ D    +GT   DV+ L    S LNV+G                LSF  A+ ++ 
Sbjct: 112 YSINFIDGISLNGTRYMDVMRLMNVSSSLNVSGVDSGVSFRNHTLTVQNLSFFNADYSSG 171

Query: 305 TV-GVLGIGLPALESTYSGASGATQRQMYQYMN----FPMVLKQSGAIHTTTYSLFL--- 356
            + G LG+G         G   +       ++N    F   LK++  I++++YSL+L   
Sbjct: 172 YLYGSLGLG---------GTLNSDTELEGDFINHSFFFLDALKEARLINSSSYSLWLGSQ 222

Query: 357 --------DDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMR----NSGYSNPIQFDVTL 404
                    D +E+ G ++FGA+D +   G+     MI  +        Y  P+     +
Sbjct: 223 KRNGFADTSDANEA-GYLIFGAVDPNLVEGEFRKFDMIPYIHPQTGKVAYGYPVVPMGPI 281

Query: 405 FGIGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCR 464
           +         N            D    +SY PT  +  +A QI A Y   L  + V C 
Sbjct: 282 YITSSSGRSLNVTTDGFSAPVLLDPSFALSYLPTKAIIQIAIQIAAVYVESLDLWLVSCD 341

Query: 465 SVSSNTNLVFDFGGFHISGPLQDFL-------------IQTSQQTCILAMAPQE-SQHVI 510
             SS   + F FG   I  PL D L               T Q+ C+L + P   + + +
Sbjct: 342 VASSGATVDFSFGDLTIKVPLSDLLASTHDQSTNTTLHFNTGQEACVLQLYPNTFTGYNV 401

Query: 511 LGDIFLTHAYVVYDLDNYVIAL 532
           LG  F+ +AY+  DL+   +A+
Sbjct: 402 LGQAFMKNAYLAVDLEGKGVAM 423

>ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR349C (YPS7)
          Length = 553

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 89/222 (40%), Gaps = 32/222 (14%)

Query: 341 LKQSGAIHTTTYSLF----------LDDLDESHGSVLFGAIDHSKYTGQLYT---VPMIN 387
           ++ +G I + +YSL+          L  + E  G+++ GA+D   Y G  Y    VP ++
Sbjct: 196 MRDAGLISSRSYSLWFGNDNTSAVDLPTVLEDIGTLMLGAVDPRLYYGNFYQYDGVPSVD 255

Query: 388 IMR----NSGYSNPIQFDVTLFGIGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSVVEL 443
           I        GY  PI     +  +G +  + N            +S    S+ P S+V+ 
Sbjct: 256 IASGQHTRGGY--PIVPLTRVQLLGTEGRQLNLTDDTFAEPVLLNSRFMTSFLPKSIVQQ 313

Query: 444 VARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQDFLIQT----------- 492
           +ARQ NA ++       V C  +    +  F FG   +  PL DF+  T           
Sbjct: 314 IARQTNAVFTKSSNRLIVECSLLKEEASFRFHFGELVVEVPLSDFIGPTNLRAGTSILAP 373

Query: 493 -SQQTCILAMAPQESQHV-ILGDIFLTHAYVVYDLDNYVIAL 532
            + +TC L + P       +LG   L   Y+  D ++  + +
Sbjct: 374 DTNETCYLKLMPSTGMGFSMLGMPILRKLYIAADTESGAVGM 415

>Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349C
           (YPS7) - GPI-anchored aspartic protease [contig 157]
           FULL
          Length = 593

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 96/230 (41%), Gaps = 43/230 (18%)

Query: 341 LKQSGAIHTTTYSL-FLDDLDESH--------------GSVLFGAIDHSKYTGQLY---T 382
           L Q+  I+T++YSL F  D+ ES+              G ++FG +D S YTG L    T
Sbjct: 203 LVQNNYINTSSYSLWFGGDVIESYAYSSALDSVAVENCGILIFGGVDRSLYTGDLVKIDT 262

Query: 383 VPMINI---MRNSGYSNPIQFDVTLFGIGLQNGE---RNXXXXXXXXXXXXDSGTTISYF 436
           +P  N+   + + GY  PI   V L  + +++     +N            D+    +Y 
Sbjct: 263 LPYYNVRTGVTSRGY--PI---VPLVKVDVKSKSGQVKNLTSEYFLEPVLLDTRYRYNYL 317

Query: 437 PTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQDFL------- 489
           P  ++  +A Q NA Y   L  + + C       +++FDFG   I  PL D +       
Sbjct: 318 PLDLIVKIATQANAYYVESLNRWLLACDVGKLGASILFDFGEVVIDVPLSDLMGPTYDST 377

Query: 490 ------IQTSQQTCILAMAPQESQHV-ILGDIFLTHAYVVYDLDNYVIAL 532
                    + Q C L   P       ILG  F+ + Y+  +L +  +AL
Sbjct: 378 TNGTLYFSNADQACELRFLPNSDLGFSILGGPFIKNVYLAAELQSNQVAL 427

>KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5.401
           YDR349C
          Length = 598

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 80/355 (22%), Positives = 135/355 (38%), Gaps = 60/355 (16%)

Query: 234 DIPRSERTLDCQEYGTF--NSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNV 291
           DI  ++    C E   F  N S S    +N   +++++ D+   +GT   D +N +D ++
Sbjct: 80  DIQCNKLHSGCFENDVFYPNESISGVSLSNSYEYNMNFIDNVRVNGTLFMDTMNFTDTSM 139

Query: 292 TG-----------------------LSFAVANMTNSTVGVLGIGLPALESTYSGASGATQ 328
            G                       +SF   + + + +G LG+G     S +   S   Q
Sbjct: 140 LGNLSNTVQNNSMLTMTSDYLALRNISFVTTSSSTTDLGSLGLGGSIHSSVFDIDSENFQ 199

Query: 329 RQMYQYMNFPMVLKQSGAIHTTTYSLFLDDL---------DESHGSV----LFGAIDHSK 375
              +        +     I + +YSL+L +          D  +GSV    + GA+D S 
Sbjct: 200 DTFF----LLKTMANLNLIKSKSYSLWLGNCRRTIDTITPDADNGSVAGKLILGAVDPSL 255

Query: 376 YTGQLYTVPMINIMRNSGYSNPIQFDVTLFG---IGLQNGER-NXXXXXXXXXXXXDSGT 431
           Y G+ +    I+ +  S   +   + +   G   +  Q G R N            DS  
Sbjct: 256 YEGEFFQFNTISYIEPSHNLSTFGYPILPMGPIYMTSQAGRRLNMTSEQYLQPALLDSSF 315

Query: 432 TISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQDFLIQ 491
             S+ P + +  +A QI A Y   L  + VPC   S   ++ F F G  I  PL D L  
Sbjct: 316 VGSFLPANTIIQIAIQIGAIYIESLNRWVVPCSVASMGAHIDFTFDGLDIKVPLSDLLTS 375

Query: 492 TS-------------QQTCILAMAPQESQHV-ILGDIFLTHAYVVYDLDNYVIAL 532
           +              +  C L +    +    +LG  F+ +AY+  DLD   +A+
Sbjct: 376 SKDPATNSTMHFAEGESACFLMLYSNNAMGFNVLGTSFIKNAYIAVDLDGTKVAI 430

>KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.401
           YDR349C
          Length = 596

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 76/315 (24%), Positives = 124/315 (39%), Gaps = 57/315 (18%)

Query: 257 TFKNNYTSFSISYGDSTFASGT----WAQDVLNLSDLNVTGLSFAVANMTNSTVGVLGIG 312
           + KNNYT+  +    S + + T    W ++V  L     T L            GVLG+G
Sbjct: 164 SIKNNYTNTLLQSNLSAYVNLTNDHLWVKNVSFLDSTTATSL----------YSGVLGLG 213

Query: 313 LPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLDES---------- 362
                S     SG      + +  F    K++    + +YSL+L + DES          
Sbjct: 214 GSITSSNEYENSGNYDSSYFIFNKF----KEANITQSNSYSLWLVE-DESSLTTTSTKFE 268

Query: 363 ----HGSVLFGAIDHSKYTGQLYTVPMI------NIMRNSGYSNPIQFDVTLFGIGLQNG 412
                G +L G ID + Y G LY   MI      +++ + GY  PI   + +  +  ++G
Sbjct: 269 EEGTFGKLLLGVIDPALYRGSLYQFDMIPYVDPESLVSSQGY--PI-LPMGVIYVKSESG 325

Query: 413 ER-NXXXXXXXXXXXXDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTN 471
            R N            DS    +Y P + +  +A QI A Y   +  + V C   S   +
Sbjct: 326 ARLNVTSKDFLEPVLLDSSQQGNYLPENAIIQIAIQIGATYIESMDRWLVSCDMASYGAS 385

Query: 472 LVFDFGGFHISGPLQDFLIQT-------------SQQTCILAMAPQESQ-HVILGDIFLT 517
           ++F F G  I  PL++ L  T              +  C L +    +  + +LG  F  
Sbjct: 386 VLFTFDGLEIDVPLENLLTNTFETGSNSSIYYSDGETACALTIYDNANMGYNLLGSAFFR 445

Query: 518 HAYVVYDLDNYVIAL 532
           + Y+  DL+   +A+
Sbjct: 446 NTYIAVDLEGNTVAI 460

>Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)
          Length = 110

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 44/84 (52%), Gaps = 9/84 (10%)

Query: 57  YVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPP 116
           YV+ P +K            ++ ++ + KRD+   +      + N    Y V++ IGTPP
Sbjct: 27  YVRFPVQKLA----NVPGMGSQDVSNVFKRDDVLNS-----TLINAVGMYVVKVEIGTPP 77

Query: 117 QHVTVLVDTGSADLWVTGSMNPFC 140
           Q   + +DTGS+D++V  + +P+C
Sbjct: 78  QTAYLQLDTGSSDMYVNDADSPYC 101

>YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protein
           of unknown function
          Length = 77

 Score = 43.5 bits (101), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 339 MVLKQSGAIHTT-TYSLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPM 385
           M  ++ G I    +YSLFL+  +   GS+LFGA+D SKY  +L T PM
Sbjct: 1   MAFERQGKIEKKISYSLFLNGPNVHFGSILFGAVDKSKYAEELCTHPM 48

>YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein with
           similarity to GPI-anchored aspartic proteases such as
           Yap1p and Yap3p
          Length = 165

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 9/86 (10%)

Query: 57  YVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPP 116
           YVK P +K+  D     T++   ++ + KR+        +  + N    Y V++ IGTPP
Sbjct: 27  YVKFPVQKF-ADIINIGTQD---VSTVFKRNE-----VLNTTVINGIGVYVVKMEIGTPP 77

Query: 117 QHVTVLVDTGSADLWVTGSMNPFCQS 142
           Q V + +DTGS+D+ V  +   +C+S
Sbjct: 78  QTVYLQLDTGSSDMIVNNADIAYCKS 103

>Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON}
           (70588..72576) [1989 nt, 663 aa]
          Length = 662

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 109/283 (38%), Gaps = 49/283 (17%)

Query: 289 LNVTGLSF-AVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAI 347
           LN++ +SF +  N    ++G LG+G           SG      +        LK++G I
Sbjct: 162 LNISSMSFFSTYNSGGLSIGSLGLGGNVESRNSDLDSGQYDGSFFLLEE----LKEAGLI 217

Query: 348 HTTTYSLFLD----DLDESHGSV----------LFGAIDHSKYTGQLYTVPMINIMRNSG 393
               YSL+L      L E  G+V          + GA++ +   G+  +  M+       
Sbjct: 218 EGRGYSLWLGGDNTSLVEQEGTVYSSESIAGRLILGAVNPNLIDGKFVSFNMLP------ 271

Query: 394 YSNPIQFDVT----LFGIGLQN------GERNXXXXXXXXXXXXDSGTTISYFPTSVVEL 443
           Y NP   +++    +  +G  N         N            DS  T S  P   +  
Sbjct: 272 YQNPDTLEMSNGYPILPMGPINIISKSGASLNMTSNNYLQPVLLDSRYTNSRLPIEAIIQ 331

Query: 444 VARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQDFL-------------I 490
           +A QI+A Y  +L  + V C  +  +  L F FG   I  PL+ FL             +
Sbjct: 332 IAIQIDASYVEQLNSWVVSCSILKESVVLEFSFGPLRIKVPLKQFLKKAIDPDTGNARTL 391

Query: 491 QTSQQTCILAMAP-QESQHVILGDIFLTHAYVVYDLDNYVIAL 532
               Q CIL++ P  +  + ILG  F+   Y+  D +   IAL
Sbjct: 392 SNGDQACILSLYPNHDIGYNILGAPFMKSIYLAVDNEGGTIAL 434

>NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {ON}
           Anc_5.401 YDR349C
          Length = 645

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/226 (20%), Positives = 87/226 (38%), Gaps = 33/226 (14%)

Query: 340 VLKQSGAIHTTTYSLFL---------------DDLDESHGSVLFGAIDHSKYTGQLY--- 381
           +L +SG I + +YSL+L                D   ++G +L G++D S +    Y   
Sbjct: 215 MLAESGLIDSQSYSLWLGNGAERDTQLSSQRTPDPQYNNGKLLLGSVDPSLFKEPFYQFD 274

Query: 382 TVPMINI-MRNSGYSNPIQFDVTLFGIGLQNGERNXXXXXXXXXXXXDSGTTISYFPTSV 440
            +P ++   +   +S P+     ++ +       N            +S    +Y P + 
Sbjct: 275 VLPYVDPNTQIESFSFPVIPMNAIYIVSKTGTGTNVTSEDFLEPVLLNSNFRSNYLPLNS 334

Query: 441 VELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQDFLIQT-------- 492
           +  +A Q+ A Y   L  + +PC   + N +  F F   +I  PL DFL  T        
Sbjct: 335 IIQIAIQVGATYVESLDRWLLPCSIANENVHFEFTFDKLNIKAPLIDFLESTFDSTTNTS 394

Query: 493 -----SQQTCILAMAPQESQHV-ILGDIFLTHAYVVYDLDNYVIAL 532
                + + C L + P        LG  FL   Y+  + +  ++ +
Sbjct: 395 MHFSDNSEACFLKLYPNTYVGFNALGRPFLKSVYLAVEQEGRIVGM 440

>TPHA0E03810 Chr5 (802496..804727) [2232 bp, 743 aa] {ON} Anc_1.29
           YCL045C
          Length = 743

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 56/131 (42%), Gaps = 24/131 (18%)

Query: 255 SSTFKNNYTSFSISYGDSTFASGTWAQDVLN-----LSDLNVTGLSFAVANMTNSTVGVL 309
           SST   NY S     GD    S + + D+L      ++D N  GLS  + N T+  +   
Sbjct: 381 SSTLYVNYKS-----GDKEIVSLSKSDDLLQNKVIFITDHNERGLSGHMQNSTDKIMNTW 435

Query: 310 GIGLPALESTYS------------GASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLD 357
            I +P  E   +            G     +  +Y+Y+ +P ++     +   T SL++D
Sbjct: 436 KIDIPKNEKLVAYAKRIDEPIANIGVVTGNRTVLYKYL-YPNLV-SYAVVDKETKSLYID 493

Query: 358 DLDESHGSVLF 368
            +D   GSVL+
Sbjct: 494 IVDSVTGSVLY 504

>Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {ON}
           similar to Ashbya gossypii ABL123C
          Length = 481

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 51/110 (46%), Gaps = 17/110 (15%)

Query: 428 DSGTTISYFPTSVVELVARQINAQYSARL---GFYTVPCRSVSSNTNLVFDFGGFHISGP 484
           DSG+T    P    ++ A  I++     +    ++ V C   +S  +L F+ G  + + P
Sbjct: 312 DSGSTFLVLP----KVDALDIHSYLPGSITDGNYFAVFC---NSTVDLTFELGNKNWTIP 364

Query: 485 LQDFLIQTSQQ------TCILAMAPQE-SQHVILGDIFLTHAYVVYDLDN 527
              +L +  Q+       C+  +  Q      ILGD+F+ + Y V+D+DN
Sbjct: 365 ASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDN 414

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,196,175
Number of extensions: 2233519
Number of successful extensions: 6712
Number of sequences better than 10.0: 147
Number of HSP's gapped: 6442
Number of HSP's successfully gapped: 252
Length of query: 652
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 536
Effective length of database: 40,180,143
Effective search space: 21536556648
Effective search space used: 21536556648
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)