Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0I032503.569ON70970937480.0
NCAS0E002503.569ON70870934130.0
KAFR0J028903.569ON70670932790.0
TDEL0D063703.569ON70670432370.0
Suva_7.163.569ON70870632290.0
YGL245W (GUS1)3.569ON70870632200.0
Smik_7.163.569ON70870632150.0
KNAG0I002203.569ON70770932020.0
Skud_7.223.569ON70870631980.0
CAGL0C01947g3.569ON70570831500.0
SAKL0F00748g3.569ON70770931440.0
Kpol_507.83.569ON70770931440.0
Kwal_47.192723.569ON70470430730.0
TPHA0A060203.569ON70770530320.0
ZYRO0E09570g3.569ON70670430220.0
KLLA0A00682g3.569ON70871030200.0
KLTH0G00682g3.569ON70470429990.0
TBLA0E001903.569ON70770429420.0
AFR264W3.569ON70770729410.0
ZYRO0C07018g6.51ON8034466232e-69
YOR168W (GLN4)6.51ON8093755976e-66
SAKL0E02134g6.51ON8015465951e-65
TDEL0G041906.51ON8093745951e-65
KNAG0M011006.51ON7994405906e-65
AGR259C6.51ON7983775872e-64
Smik_15.3486.51ON8103755844e-64
Kwal_56.225596.51ON8003875756e-63
Skud_15.3326.51ON8094065757e-63
TBLA0G004506.51ON8083845758e-63
Suva_8.2236.51ON8213755722e-62
Kpol_1037.386.51ON8083745695e-62
CAGL0L04532g6.51ON7953865678e-62
KLTH0C10340g6.51ON8003745661e-61
NDAI0K028606.51ON8143845661e-61
NCAS0F002406.51ON8114495642e-61
KAFR0G026106.51ON7943775633e-61
Ecym_31356.51ON8043775609e-61
TPHA0J005506.51ON8083775545e-60
KLLA0F20449g6.51ON8043845484e-59
NDAI0A084607.100ON5293521823e-13
KNAG0L006207.100ON5172181796e-13
NCAS0I005607.100ON5272191781e-12
TPHA0L005907.100ON5582751725e-12
YOL033W (MSE1)7.100ON5363671691e-11
Suva_15.1347.100ON5353671602e-10
TBLA0E021807.100ON5312761592e-10
Skud_15.1227.100ON5323231592e-10
Kpol_1044.127.100ON5363001564e-10
CAGL0F01133g7.100ON5323401531e-09
TDEL0H035007.100ON5342251484e-09
KAFR0D013207.100ON5142321441e-08
Smik_15.1327.100ON5353441404e-08
Ecym_26267.100ON5733461394e-08
KLLA0F07975g7.100ON5422891361e-07
AEL338C7.100ON5332311342e-07
KLTH0D02794g7.100ON5462261324e-07
Kwal_26.72027.100ON5672411271e-06
SAKL0B09548g7.100ON5542781262e-06
ZYRO0D05808g7.100ON5332331191e-05
Smik_12.4694.236ON89565790.75
ABL087Wna 1ON28757723.6
TBLA0I028804.236ON892144734.2
AFR527W8.771ON13762676.6
TPHA0J024506.229ON149032717.9
Kpol_1052.33.307ON1560104709.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0I03250
         (709 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {O...  1448   0.0  
NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569     1319   0.0  
KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {...  1267   0.0  
TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa] ...  1251   0.0  
Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1248   0.0  
YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}  GUS1Glutamyl...  1244   0.0  
Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1243   0.0  
KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569...  1238   0.0  
Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1236   0.0  
CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly...  1217   0.0  
SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly s...  1215   0.0  
Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON} (51597..53...  1215   0.0  
Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]...  1188   0.0  
TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa] ...  1172   0.0  
ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {...  1168   0.0  
KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly s...  1167   0.0  
KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly s...  1159   0.0  
TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569...  1137   0.0  
AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic ho...  1137   0.0  
ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly...   244   2e-69
YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}  GLN4Gluta...   234   6e-66
SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {...   233   1e-65
TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.5...   233   1e-65
KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6....   231   6e-65
AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}...   230   2e-64
Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168...   229   4e-64
Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {...   226   6e-63
Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168...   226   7e-63
TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}...   226   8e-63
Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W ...   224   2e-62
Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {O...   223   5e-62
CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highl...   223   8e-62
KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly...   222   1e-61
NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6....   222   1e-61
NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}...   221   2e-61
KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.5...   221   3e-61
Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar t...   220   9e-61
TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {...   218   5e-60
KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} high...   215   4e-59
NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON} Anc_7...    75   3e-13
KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON...    74   6e-13
NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}...    73   1e-12
TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {...    71   5e-12
YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}  MSE1Mitoc...    70   1e-11
Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033...    66   2e-10
TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {O...    66   2e-10
Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033...    66   2e-10
Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {O...    65   4e-10
CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {...    64   1e-09
TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.1...    62   4e-09
KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {O...    60   1e-08
Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033...    59   4e-08
Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar...    58   4e-08
KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {...    57   1e-07
AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON} Syn...    56   2e-07
KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {...    55   4e-07
Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {O...    54   1e-06
SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} simila...    53   2e-06
ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {...    50   1e-05
Smik_12.469 Chr12 complement(820772..823459) [2688 bp, 895 aa] {...    35   0.75 
ABL087W Chr2 (236014..236877) [864 bp, 287 aa] {ON} NOHBY208; No...    32   3.6  
TBLA0I02880 Chr9 complement(680214..682892) [2679 bp, 892 aa] {O...    33   4.2  
AFR527W Chr6 (1382320..1382733) [414 bp, 137 aa] {ON} Syntenic h...    30   6.6  
TPHA0J02450 Chr10 (539862..544334) [4473 bp, 1490 aa] {ON} Anc_6...    32   7.9  
Kpol_1052.3 s1052 (7826..12508) [4683 bp, 1560 aa] {ON} (7826..1...    32   9.7  

>NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {ON}
           Anc_3.569 YGL245W
          Length = 709

 Score = 1448 bits (3748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 701/709 (98%), Positives = 701/709 (98%)

Query: 1   MSANTLVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKI 60
           MSANTLVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKI
Sbjct: 1   MSANTLVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKI 60

Query: 61  IEGFPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSA 120
           IEGFPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSA
Sbjct: 61  IEGFPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSA 120

Query: 121 ADIACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNS 180
           ADIACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNS
Sbjct: 121 ADIACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNS 180

Query: 181 GKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIR 240
           GKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIR
Sbjct: 181 GKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIR 240

Query: 241 FDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTP 300
           FDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTP
Sbjct: 241 FDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTP 300

Query: 301 TEKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDP 360
           TEKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDP
Sbjct: 301 TEKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDP 360

Query: 361 VIYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMN 420
           VIYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMN
Sbjct: 361 VIYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMN 420

Query: 421 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNF 480
           LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPT        MTVEGLRNF
Sbjct: 421 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNF 480

Query: 481 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPK 540
           VLSQGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPK
Sbjct: 481 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPK 540

Query: 541 HKKNPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLD 600
           HKKNPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLD
Sbjct: 541 HKKNPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLD 600

Query: 601 GDFKKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADL 660
           GDFKKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADL
Sbjct: 601 GDFKKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADL 660

Query: 661 NVKDMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709
           NVKDMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 661 NVKDMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709

>NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569
          Length = 708

 Score = 1319 bits (3413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 627/709 (88%), Positives = 668/709 (94%), Gaps = 1/709 (0%)

Query: 1   MSANTLVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKI 60
           MSA TLVINGKAPVVAY +LIAARI+N+ KP SI I+FVDDKK+AP+ FNG +   FLKI
Sbjct: 1   MSA-TLVINGKAPVVAYAELIAARIVNETKPNSISIEFVDDKKAAPATFNGDNKDAFLKI 59

Query: 61  IEGFPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSA 120
           +  F ++F+ S ++ + +W K+A+EELV+KNFQKLSESLGKLDA LNLRTFILGGLKYSA
Sbjct: 60  VAQFSDVFSNSKEEDITQWVKMASEELVIKNFQKLSESLGKLDAHLNLRTFILGGLKYSA 119

Query: 121 ADIACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNS 180
           ADIACWGALRSNGMCGSI+KNKV+VNVSRWY+LLEMDP FGSVHE LTKSLQELKK +N+
Sbjct: 120 ADIACWGALRSNGMCGSIIKNKVEVNVSRWYTLLEMDPIFGSVHEFLTKSLQELKKTANA 179

Query: 181 GKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIR 240
           GKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIR
Sbjct: 180 GKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIR 239

Query: 241 FDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTP 300
           FDDTNPSKEKEEFQDSILEDLELLGIKGDRIT+SSDYFQ+MY+ C++MIKEGKAYCDDTP
Sbjct: 240 FDDTNPSKEKEEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCIQMIKEGKAYCDDTP 299

Query: 301 TEKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDP 360
           TEKMREERMDGIASARRDRSVEENL+IF EEMKNGTEEGLKNCVRAKIDYKALNKTLRDP
Sbjct: 300 TEKMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDP 359

Query: 361 VIYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMN 420
           VIYRCNLTPHHRTGTTWK+YPTYDFCVPIVD+LEGVTHALRTIEYRDRNAQY+WML A+N
Sbjct: 360 VIYRCNLTPHHRTGTTWKVYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLQALN 419

Query: 421 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNF 480
           LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPT        MTVEGLRNF
Sbjct: 420 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNF 479

Query: 481 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPK 540
           VLSQGPSRNVINLEWNLIWAFNKKVIDPVA RHTAIV+PVKIHLEGDDVPQTPK EMKPK
Sbjct: 480 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHLEGDDVPQTPKIEMKPK 539

Query: 541 HKKNPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLD 600
           HKKNPAVGEKKVIY+KDIVIDK DADL+E NEEVTMMDWGNVIIT+KNADGS+VGKLHL+
Sbjct: 540 HKKNPAVGEKKVIYFKDIVIDKDDADLLEANEEVTMMDWGNVIITQKNADGSLVGKLHLE 599

Query: 601 GDFKKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADL 660
           GDFKKTKHKLTWLADT DVVPVDLVDFDHLI+KDKLEEDESFEDFLTP TEFHT AIADL
Sbjct: 600 GDFKKTKHKLTWLADTPDVVPVDLVDFDHLITKDKLEEDESFEDFLTPVTEFHTDAIADL 659

Query: 661 NVKDMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709
           NVKDMKVGDIIQFERKGYYRLDA+ KDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 660 NVKDMKVGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {ON}
           Anc_3.569 YGL245W
          Length = 706

 Score = 1267 bits (3279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 602/709 (84%), Positives = 654/709 (92%), Gaps = 3/709 (0%)

Query: 1   MSANTLVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKI 60
           MSA TLVINGKAPVVAY  LIAAR++N A+P +I I+FVDDKKSAP+ FNGSS+ +F KI
Sbjct: 1   MSA-TLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKI 59

Query: 61  IEGFPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSA 120
           +  FP+ F  +N    +EW  +A+EE +VKNFQKL++SL KLDA LNLRTFI GGL+YSA
Sbjct: 60  VAAFPDAFRNAN--VASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSA 117

Query: 121 ADIACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNS 180
           ADIA WGALRSNGM GSI+KNKV VNVSRWYSLLEMDP FG+VHE LTKSLQELKK +++
Sbjct: 118 ADIAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASA 177

Query: 181 GKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIR 240
           GKKKETHKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIR
Sbjct: 178 GKKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 237

Query: 241 FDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTP 300
           FDDTNPSKEK EFQDSILEDLELLGIKGDR+TYSSDYFQ+MY+LCV++IKEG AYCDDTP
Sbjct: 238 FDDTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTP 297

Query: 301 TEKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDP 360
           TEKMREERMDGIASARRDR+VEENLRIF EEMKNGTEEGLKNCVRAKIDY ALNKTLRDP
Sbjct: 298 TEKMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDP 357

Query: 361 VIYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMN 420
           VIYRCNLTPHHRTG TWKMYPTYDFCVPIVD+LEGVTHALRTIEYRDRNAQY+WML+A++
Sbjct: 358 VIYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALH 417

Query: 421 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNF 480
           LRKVHIWDFARVNFVRTLLSKRKLQWMVDK LVSNWDDPRFPT        MTVEGLRNF
Sbjct: 418 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTVRGVRRRGMTVEGLRNF 477

Query: 481 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPK 540
           VLSQGPSRNVINLEWN+IWAFNKKVIDPVA RHTA+V+PVKIHL G+D P+TPK EMKPK
Sbjct: 478 VLSQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPK 537

Query: 541 HKKNPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLD 600
           HKKNPAVGEKKVIYYKDIV+DK DAD+IE NEEVT+MDWGN+IITKKNADGSM  K+HL+
Sbjct: 538 HKKNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLE 597

Query: 601 GDFKKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADL 660
           GDFKKT HKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTP TEFHTSAIADL
Sbjct: 598 GDFKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADL 657

Query: 661 NVKDMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709
           NVK+MKVGD+IQFERKGY+RLD++ KDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 658 NVKEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706

>TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa]
           {ON} Anc_3.569 YGL245W
          Length = 706

 Score = 1251 bits (3237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/704 (84%), Positives = 648/704 (92%), Gaps = 1/704 (0%)

Query: 6   LVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKIIEGFP 65
           L+INGKAPVVAY +LIAAR++N   P SI+++FVDDKK+AP+V +G S+  F+KIIE FP
Sbjct: 4   LIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIEAFP 63

Query: 66  EIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSAADIAC 125
           +IFTE   + +A W K A+ + V+KNFQKLS SL KLDA LNLRT+ILGGLKYSAADIAC
Sbjct: 64  KIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAADIAC 123

Query: 126 WGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNSGKKKE 185
           WGALRSNGM GSI+KNKVDVNVSRWY+LLE D  FG  HE LTKS+Q+LKK SN GKKKE
Sbjct: 124 WGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGKKKE 183

Query: 186 THKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTN 245
            HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFA+ YKGKLIIRFDDTN
Sbjct: 184 GHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDDTN 243

Query: 246 PSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKMR 305
           PSKEKEEFQDSI+EDL+LLGI+GDR+T+SSDYFQ+MY+LCVKMIKEGKAYCDDT TEKMR
Sbjct: 244 PSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEKMR 303

Query: 306 EERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRC 365
           EERMDGIASARRDR VEENLRIF +EMKNGTEEGLKNCVRAKIDY+A NKTLRDPVIYRC
Sbjct: 304 EERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIYRC 363

Query: 366 NLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVH 425
           NLTPHHRTGTT K YPTYDFCVP+VD++EGVTHALRTIEYRDRNAQYDWML+AMNLRKVH
Sbjct: 364 NLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRKVH 422

Query: 426 IWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQG 485
           IWDFARVNFVRTLLSKRKLQWMVDK LVSNWDDPRFPT        MTVEGLRNFVLSQG
Sbjct: 423 IWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQG 482

Query: 486 PSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPKHKKNP 545
           PSRNVINLEWNLIWAFNKKVIDPVA R TA+V+PVK+HL+G+D PQ+PKTEMKPKHKKNP
Sbjct: 483 PSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKKNP 542

Query: 546 AVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLDGDFKK 605
            VGEKKVI+YKD+VIDK DAD++E+NEEVT+MDWGNVIITKKNADGS+ GKL+LDGDFKK
Sbjct: 543 DVGEKKVIFYKDVVIDKDDADVLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDFKK 602

Query: 606 TKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADLNVKDM 665
           TKHKLTWLADTEDV PVDLVDFDHLISKDKLEEDESFEDFLTP TEFHTSAIADLNVKD+
Sbjct: 603 TKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVKDL 662

Query: 666 KVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709
           KVGDIIQFERKGYYRLDA+AKDGKPYVFFTIPDGKSVN+YGAKK
Sbjct: 663 KVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706

>Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1248 bits (3229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/706 (83%), Positives = 642/706 (90%)

Query: 4   NTLVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKIIEG 63
           +TL INGKAP VAY +LIAARI+N   P SI ++FVDDKK+  +  + +++  F KI   
Sbjct: 3   STLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVDDKKAPAAKLDDATEDVFNKITGK 62

Query: 64  FPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSAADI 123
           F  IF    K+ VA+W K+A EELVVKNF KLS+SL  LD QLNLRTFILGGLKYSAAD+
Sbjct: 63  FAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAADV 122

Query: 124 ACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNSGKK 183
           ACWGALRSNGMCGSI+KNKVDVNVSRWY+LLEMDP FG  HE LTKSLQE+KK +N GKK
Sbjct: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVGKK 182

Query: 184 KETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDD 243
           KETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGK+IIRFDD
Sbjct: 183 KETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDD 242

Query: 244 TNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEK 303
           TNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQ+MY+ CV+MIK+GKAYCDDTPTEK
Sbjct: 243 TNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEK 302

Query: 304 MREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 363
           MREERMDGIASARRDRSVEENLRIF EEMKNGTE GLKNCVRAKIDY+ALNKTLRDPVIY
Sbjct: 303 MREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIY 362

Query: 364 RCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRK 423
           RCNLTPHHRTG+TWK+YPTYDFCVPIVD+LEGVTHALRTIEYRDRNAQYDWML A+ LRK
Sbjct: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422

Query: 424 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 483
           VHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 423 VHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 482

Query: 484 QGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPKHKK 543
           QGPSRNVINLEWNLIWAFNKKVIDP+A RHTA+V+PVKIHLEG + PQ PK EMKPKHKK
Sbjct: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKHKK 542

Query: 544 NPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLDGDF 603
           NPAVGEKKVIYYKDIV+DK DAD+I+ +EEVT+MDWGNV+ITKKNADGSMV KLHL+GDF
Sbjct: 543 NPAVGEKKVIYYKDIVVDKDDADVIDVDEEVTLMDWGNVVITKKNADGSMVAKLHLEGDF 602

Query: 604 KKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADLNVK 663
           KKTKHKLTWLADT+D+VPVDLVDFDHL++KDKLEEDESFEDFLTP TEFHT AIADLNVK
Sbjct: 603 KKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLNVK 662

Query: 664 DMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709
           DMKVGDI+QFERKGY+RLDA+ KDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 663 DMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}
           GUS1Glutamyl-tRNA synthetase (GluRS), forms a complex
           with methionyl-tRNA synthetase (Mes1p) and Arc1p;
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1244 bits (3220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/706 (83%), Positives = 641/706 (90%)

Query: 4   NTLVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKIIEG 63
           +TL INGKAP+VAY +LIAARI+N   P SI I+ VDDKK+  +  + +++  F KI   
Sbjct: 3   STLTINGKAPIVAYAELIAARIVNALAPNSIAIKLVDDKKAPAAKLDDATEDVFNKITSK 62

Query: 64  FPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSAADI 123
           F  IF   +K+ VA+W  +A +ELV+KNF KLS+SL  LD+QLNLRTFILGGLKYSAAD+
Sbjct: 63  FAAIFDNGDKEQVAKWVNLAQKELVIKNFAKLSQSLETLDSQLNLRTFILGGLKYSAADV 122

Query: 124 ACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNSGKK 183
           ACWGALRSNGMCGSI+KNKVDVNVSRWY+LLEMDP FG  H+ L+KSL ELKK +N GKK
Sbjct: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLLELKKSANVGKK 182

Query: 184 KETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDD 243
           KETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIRFDD
Sbjct: 183 KETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242

Query: 244 TNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEK 303
           TNPSKEKEEFQDSILEDL+LLGIKGDRITYSSDYFQ+MY+ CV+MIK+GKAYCDDTPTEK
Sbjct: 243 TNPSKEKEEFQDSILEDLDLLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEK 302

Query: 304 MREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 363
           MREERMDG+ASARRDRSVEENLRIF EEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY
Sbjct: 303 MREERMDGVASARRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 362

Query: 364 RCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRK 423
           RCNLTPHHRTG+TWK+YPTYDFCVPIVD++EGVTHALRTIEYRDRNAQYDWML A+ LRK
Sbjct: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422

Query: 424 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 483
           VHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 482

Query: 484 QGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPKHKK 543
           QGPSRNVINLEWNLIWAFNKKVIDP+A RHTAIV+PVKIHLEG + PQ PK EMKPKHKK
Sbjct: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGSEAPQEPKIEMKPKHKK 542

Query: 544 NPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLDGDF 603
           NPAVGEKKVIYYKDIV+DK DAD+I  +EEVT+MDWGNVIITKKN DGSMV KL+L+GDF
Sbjct: 543 NPAVGEKKVIYYKDIVVDKDDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLNLEGDF 602

Query: 604 KKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADLNVK 663
           KKTKHKLTWLADT+DVVPVDLVDFDHLI+KD+LEEDESFEDFLTP TEFHT AIADLNVK
Sbjct: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662

Query: 664 DMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709
           DMK+GDIIQFERKGYYRLDA+ KDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 663 DMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1243 bits (3215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 584/706 (82%), Positives = 643/706 (91%)

Query: 4   NTLVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKIIEG 63
           +TL INGKAP+VAY +LIAARI+N   P SI I FVDDKK+  ++ + +++  F KI   
Sbjct: 3   STLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKITGK 62

Query: 64  FPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSAADI 123
           F  IF   +K+ +A+W  +A +ELVVKNF KLS+SL  LD+QLNLRTFILGGLKYSAAD+
Sbjct: 63  FAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAADV 122

Query: 124 ACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNSGKK 183
           ACWGALRSNGMCGSI+KNKVDVNVSRWY+LLEMDP FG  H+ L+KSLQELKK +N GKK
Sbjct: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVGKK 182

Query: 184 KETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDD 243
           KETHKANFEIDLP+AK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIRFDD
Sbjct: 183 KETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242

Query: 244 TNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEK 303
           TNPSKEKEEFQDSILEDL+LLGIKGD+ITYSSDYFQ+MY+ C++MIK+GKAYCDDTPTEK
Sbjct: 243 TNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPTEK 302

Query: 304 MREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 363
           MREERMDGIAS+RRDRSVEENLRIF EEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY
Sbjct: 303 MREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 362

Query: 364 RCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRK 423
           RCNLTPHHRTG+TWK+YPTYDFCVPIVD++EGVTHALRTIEYRDRNAQYDWML A+ LRK
Sbjct: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422

Query: 424 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 483
           VHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 482

Query: 484 QGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPKHKK 543
           QGPSRNVINLEWNLIWAFNKK+IDP+A RHTAIV+PVKIHLEG + PQ PKTE KPKHKK
Sbjct: 483 QGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQEPKTETKPKHKK 542

Query: 544 NPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLDGDF 603
           NPAVGEKKVIYYKDIV+DK DAD+I  +EE+T+MDWGNVIITKKN DGSM+ KL+L+GDF
Sbjct: 543 NPAVGEKKVIYYKDIVVDKDDADVINVDEEITLMDWGNVIITKKNEDGSMIAKLNLEGDF 602

Query: 604 KKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADLNVK 663
           KKTKHKLTWLADT+DVVPVDLVDFDHLI+KD+LEEDESFEDFLTP TEFHT AIADLNVK
Sbjct: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662

Query: 664 DMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709
           DMK+GDIIQFERKGYYRLDA+ KDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 663 DMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1238 bits (3202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/709 (82%), Positives = 638/709 (89%), Gaps = 2/709 (0%)

Query: 1   MSANTLVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKI 60
           MSA TLVINGKAP+VAYG LIAARI N AK +S+ I+FVDDK +AP+VFNG S+    KI
Sbjct: 1   MSAATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKI 60

Query: 61  IEGFPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSA 120
              FPE+F +     VA W K AN+E VVKNF KL+ESL KLDA LNLRTF+LGGLKYS 
Sbjct: 61  AAQFPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSV 120

Query: 121 ADIACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNS 180
           ADIACWGALRSNGM GSI+KNKV VNVSRWY+L EM P F + HE LTKS+QELKK S +
Sbjct: 121 ADIACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTA 180

Query: 181 GKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIR 240
           GKKKE+HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIR
Sbjct: 181 GKKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 240

Query: 241 FDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTP 300
           FDDTNPSKEKEEFQDSILEDL LLGIKGDR+TYSSDYFQQMY++C+++IKEG AYCDDTP
Sbjct: 241 FDDTNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTP 300

Query: 301 TEKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDP 360
           TEKMREERMDGIASARRDRSVEENL+IF EEMKNGTEEGLKNCVRAKIDY A NKTLRDP
Sbjct: 301 TEKMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDP 360

Query: 361 VIYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMN 420
           VIYRCNLTPHHRTG TWK+YPTYDFCVPIVDS+EGVTHALRTIEYRDRN QYDWML+A++
Sbjct: 361 VIYRCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALH 420

Query: 421 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNF 480
           LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLV NWDDPRFPT        MTVEGLRNF
Sbjct: 421 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTVRGVRRRGMTVEGLRNF 480

Query: 481 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPK 540
           VLSQGPSRNVINLEWNLIWAFNKKVIDPVA RHTA+VDPVK+H+EG   P+TPKTEMKPK
Sbjct: 481 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG--APETPKTEMKPK 538

Query: 541 HKKNPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLD 600
           HKKNPAVGEKKVI+Y+++VIDK DA  +E +EEVT+MDWGNVIITK++ DGS+ GKLHL+
Sbjct: 539 HKKNPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLE 598

Query: 601 GDFKKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADL 660
           GDFKKTKHKLTWLADTEDVVPVDLVDFDHLI+KD+LEE ESFEDFLTP TEF T AIADL
Sbjct: 599 GDFKKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADL 658

Query: 661 NVKDMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709
           NVK MKVGDIIQFERKGYYRLD++ KDGKPY+FFTIPDGKSVN+YGAKK
Sbjct: 659 NVKHMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707

>Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1236 bits (3198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/706 (82%), Positives = 641/706 (90%)

Query: 4   NTLVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKIIEG 63
           +TL +NGKAP VAY +LIAARI+N   P SI IQFVDDKK+  +  + +++  F KI   
Sbjct: 3   STLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVDDKKAPAAKLDDATEGVFNKITGK 62

Query: 64  FPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSAADI 123
           F  IF   +K+ V+ WT +A +ELVVKNF KLS+SL  LD+QLN+RTFILGGLKYSAAD+
Sbjct: 63  FAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAADV 122

Query: 124 ACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNSGKK 183
           ACWGALRSNGMCGSI+KNKVDVNVSRWY+LLEMDP FG  H+ LTKSLQELKK +N GKK
Sbjct: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVGKK 182

Query: 184 KETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDD 243
           KETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIRFDD
Sbjct: 183 KETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242

Query: 244 TNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEK 303
           TNPSKEKEEFQDSILEDL+LLGIKGD+ITYSSDYFQ+M++ CV+MIK+GKAYCDDTPTE+
Sbjct: 243 TNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPTER 302

Query: 304 MREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 363
           MREERMDGIASARR+RSVEENLR+F EEMKNGTEEGLKNCVRAKIDY+ALNKTLRDPVIY
Sbjct: 303 MREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIY 362

Query: 364 RCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRK 423
           RCNLTPHHRTG+TWK+YPTYDFCVPIVD++EGVTHALRTIEYRDRN QYDWML A+ LRK
Sbjct: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRK 422

Query: 424 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 483
           VHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 482

Query: 484 QGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPKHKK 543
           QGPSRNVINLEWNLIWAFNKKVIDP+A RHTAIV+PVKIHLEG + PQ PK EMKPKHKK
Sbjct: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKK 542

Query: 544 NPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLDGDF 603
           NPAVGEKK+IYYKDIV+D+ DAD+I  +EEVT+MDWGNVIITKKN DGSMV KLHL+GDF
Sbjct: 543 NPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEGDF 602

Query: 604 KKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADLNVK 663
           KKTKHKLTWLADT+DVVPVDLVDFDHLI+KD+LEEDESFEDFLTP TEFHT AIADLNVK
Sbjct: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662

Query: 664 DMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709
           DMKVGDIIQFERKGYYRLDA+ K+GKPYVFFTIPDGKSVN+YGAKK
Sbjct: 663 DMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708

>CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245w
          Length = 705

 Score = 1217 bits (3150), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/708 (83%), Positives = 645/708 (91%), Gaps = 5/708 (0%)

Query: 3   ANTLVINGKAPVVAYGDLIAARIINDAKP-TSIDIQFVDDKKSAPSVFNGSSDSTFLKII 61
           ++TLVINGKAPVVAY +LIAAR++ND+K   S+ ++FVDDKKSA + F+G SD+    I+
Sbjct: 2   SSTLVINGKAPVVAYAELIAARLVNDSKSDASVTVEFVDDKKSAAATFDGKSDNALEAIV 61

Query: 62  EGFPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSAA 121
             FPEI   +N+++   W K+A EELV+KNFQKL++SL KLDAQLN RT+I GGLK+ +A
Sbjct: 62  AKFPEILG-ANEES-KPWIKLAAEELVIKNFQKLAQSLEKLDAQLNFRTYINGGLKFDSA 119

Query: 122 DIACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNSG 181
           DIACWGALRSNGM GSI+KNKV VNVSRWY LLE +P+FG  HE LTKSLQELKK +N+G
Sbjct: 120 DIACWGALRSNGMVGSIIKNKVYVNVSRWYLLLESNPSFGQSHEFLTKSLQELKKAANAG 179

Query: 182 KKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRF 241
           KKKE+HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIRF
Sbjct: 180 KKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239

Query: 242 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPT 301
           DDTNPSKEK EFQDSILEDLELLGIKGDRITYSSDYFQ+MYELCVK+IKEGKAYCDDTPT
Sbjct: 240 DDTNPSKEKTEFQDSILEDLELLGIKGDRITYSSDYFQEMYELCVKLIKEGKAYCDDTPT 299

Query: 302 EKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 361
           EKMREERMDGIASARR+RSVEENL+IF E+MKNGTEEGLKNCVRAKIDY ALNKTLRDPV
Sbjct: 300 EKMREERMDGIASARRERSVEENLKIFTEDMKNGTEEGLKNCVRAKIDYAALNKTLRDPV 359

Query: 362 IYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNL 421
           IYRCNLTPHHRTG+ WKMYPTYDFCVPIVDS+EGVTHALRTIEYRDRNAQYDW LD +NL
Sbjct: 360 IYRCNLTPHHRTGSEWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWFLDNLNL 419

Query: 422 RKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFV 481
           RKVHIWDFARVNFVRTLLSKRKLQWMVDK LVSNWDDPRFPT        MTVEGLRNFV
Sbjct: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNFV 479

Query: 482 LSQGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPKH 541
           LSQGPSRNVINLEWNLIWAFNKKVIDPVA RHTAIV+PVKIH+EG   P++PKTEMKPKH
Sbjct: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHIEG--APESPKTEMKPKH 537

Query: 542 KKNPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLDG 601
           KKNPAVGEKKVIYY+++VIDK DAD IE+NEEVT+MDWGN+IITKKNADGSM  KLHL+G
Sbjct: 538 KKNPAVGEKKVIYYQNVVIDKEDADSIEDNEEVTLMDWGNIIITKKNADGSMEAKLHLEG 597

Query: 602 DFKKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADLN 661
           DFKKTKHKLTWLADT+D V VDLVDFDHLISKDKLEEDESFEDFLTP TEFHT AIADLN
Sbjct: 598 DFKKTKHKLTWLADTDDSVKVDLVDFDHLISKDKLEEDESFEDFLTPQTEFHTEAIADLN 657

Query: 662 VKDMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709
           VKDM VGDIIQFERKGYYRLDA AKDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 658 VKDMIVGDIIQFERKGYYRLDAEAKDGKPYVFFTIPDGKSVNKYGAKK 705

>SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 707

 Score = 1215 bits (3144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/709 (82%), Positives = 646/709 (91%), Gaps = 2/709 (0%)

Query: 1   MSANTLVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKI 60
           MSAN LVINGKAPVVAY +LIAARI+N +K  +I I+FVDDKK+AP+ FNG +DS F KI
Sbjct: 1   MSAN-LVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKI 59

Query: 61  IEGFPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSA 120
           I  + ++F+E  + + +EW+K+A+EE ++KNFQKLS SL KLD++LNLRT+IL     + 
Sbjct: 60  INAYQDVFSEGVQGS-SEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATP 118

Query: 121 ADIACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNS 180
           ADIACWGALRSNGM GSI+KNKV VNVSRWY++LE+DP F   HE LTKSLQELKK SNS
Sbjct: 119 ADIACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNS 178

Query: 181 GKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIR 240
            KKKETHKANFEI LPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIR
Sbjct: 179 NKKKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 238

Query: 241 FDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTP 300
           FDDTNPSKEK EFQDSILEDL+LLGIKGD+ITYSSDYF++MY+LCV++IKEGKAYCDDTP
Sbjct: 239 FDDTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTP 298

Query: 301 TEKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDP 360
           TEKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNK LRDP
Sbjct: 299 TEKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDP 358

Query: 361 VIYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMN 420
           VI+RCNLTPHHRTGTTWKMYPTYDFCVPIVD++EGVTHALRTIEYRDRN QY+WMLDA++
Sbjct: 359 VIFRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALH 418

Query: 421 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNF 480
           LRKVHIWDFARVNFVRTLLSKRKLQWMVDKG VSNWDDPRFPT        MTVEGLRNF
Sbjct: 419 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTVRGVRRRGMTVEGLRNF 478

Query: 481 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPK 540
           VLSQGPSRNVINLEWNLIWAFNKKVIDPVA RHTA+V PVK+HLEGDDVPQ PK EMK K
Sbjct: 479 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLK 538

Query: 541 HKKNPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLD 600
           HKKNP VGEKKVIYYKD++ID+ DAD++ E EE+T+MDWGNVIITKKN+DGS+VGKLHL+
Sbjct: 539 HKKNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLE 598

Query: 601 GDFKKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADL 660
           GDFKKTK KLTWLADTED V VDLVDFDHLISKDKLEE ++FEDFLTP TEFHT AIADL
Sbjct: 599 GDFKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADL 658

Query: 661 NVKDMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709
           NVKDMKVGD+IQFERKGYYRLD++AKDGKPYVFFTIPDGK+VNKYGAKK
Sbjct: 659 NVKDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707

>Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON}
           (51597..53720) [2124 nt, 708 aa]
          Length = 707

 Score = 1215 bits (3144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/709 (81%), Positives = 638/709 (89%), Gaps = 2/709 (0%)

Query: 1   MSANTLVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKI 60
           MSA TLVI GKAPVVAY +LIAARI+N +KP SI I+FV+DKK++P+  NG S     KI
Sbjct: 1   MSA-TLVIGGKAPVVAYAELIAARIVNSSKPDSIKIEFVEDKKASPATLNGDSVDVLSKI 59

Query: 61  IEGFPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSA 120
           +    ++F E   ++  EW KIA+EELVVKNFQ+L++SL KLDA LNLRT+I GGL ++ 
Sbjct: 60  VTANSDVFPEGAANS-TEWIKIASEELVVKNFQQLNKSLEKLDAHLNLRTYINGGLNFTV 118

Query: 121 ADIACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNS 180
           ADIACWGALRSNGM GSI+KNKV+VNVSRWY+LLE +  FG VHE LTKSLQELKK S +
Sbjct: 119 ADIACWGALRSNGMVGSIIKNKVNVNVSRWYTLLEENTLFGGVHEFLTKSLQELKKASTA 178

Query: 181 GKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIR 240
           GKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIR
Sbjct: 179 GKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 238

Query: 241 FDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTP 300
           FDDTNPSKE  EFQDSILEDLELLGIKGDRIT+SSDYFQ+MY+ CV++IK+GKAYCDDTP
Sbjct: 239 FDDTNPSKENVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQLIKDGKAYCDDTP 298

Query: 301 TEKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDP 360
           TEKMR+ERM+GIAS RRDRSVEENL+IF EEMKNGTEEGLKNCVRAKIDY+ALNKTLRDP
Sbjct: 299 TEKMRDERMNGIASVRRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDP 358

Query: 361 VIYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMN 420
           VI+RCNLTPHHRTG+ WKMYPTYDFCVPIVD+LEGVTHALRTIEYRDRNAQY+WML+A+ 
Sbjct: 359 VIFRCNLTPHHRTGSQWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALK 418

Query: 421 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNF 480
           LRKVHIWDFARVNFVRTLLSKRKLQWMVDK LVSNW+DPRFPT        MTVEGLRNF
Sbjct: 419 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWEDPRFPTVRGVRRRGMTVEGLRNF 478

Query: 481 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPK 540
           VLSQGPSRNVINLEWNLIW+FNKKVIDPV  R TA+VDPVKIHLEG+D PQ+ K EMKPK
Sbjct: 479 VLSQGPSRNVINLEWNLIWSFNKKVIDPVCPRLTAVVDPVKIHLEGEDAPQSAKVEMKPK 538

Query: 541 HKKNPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLD 600
           H KNP VGEKKV++YKDIVID+ DAD IE+ EE+T+M+WGN IITKKNADGS+  KLHL+
Sbjct: 539 HPKNPVVGEKKVVFYKDIVIDREDADSIEDGEEITLMNWGNAIITKKNADGSLNAKLHLE 598

Query: 601 GDFKKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADL 660
           GDFKKTKHK+TWLADTEDVV VDLVDFDHLISKDKLEEDESFEDFLTP TEFHTSAIADL
Sbjct: 599 GDFKKTKHKVTWLADTEDVVKVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADL 658

Query: 661 NVKDMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709
           NVKDMKVGDIIQFERKGYYRLD++A DGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 659 NVKDMKVGDIIQFERKGYYRLDSLAADGKPYVFFTIPDGKSVNKYGAKK 707

>Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]
           {ON} YGL245W - Protein required for cell viability
           [contig 344] FULL
          Length = 704

 Score = 1188 bits (3073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/704 (80%), Positives = 621/704 (88%), Gaps = 3/704 (0%)

Query: 6   LVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKIIEGFP 65
           L +  KAPVVAY +LIAAR+ N  KP +I+I FV+DKK++P+ F G+S+     I+E FP
Sbjct: 4   LTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVESFP 63

Query: 66  EIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSAADIAC 125
           E F +   D   +W++ A+EELVVKNFQKLS SL KLDAQLNLRTF+LGG  YS ADIAC
Sbjct: 64  EAF-KGGFDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADIAC 122

Query: 126 WGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNSGKKKE 185
           WG+LRSNGM GSI+KN+V VNVSRWY+LLE  P FGS HE LTK++QELKK S   KKKE
Sbjct: 123 WGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKKKE 182

Query: 186 THKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTN 245
           THKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQ YKGKLIIRFDDTN
Sbjct: 183 THKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTN 242

Query: 246 PSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKMR 305
           PSKEKEEFQDSILEDLELLGIKGDR+TYSSDYFQ+MYELCVKMI+EGKAYCDDT TE+MR
Sbjct: 243 PSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATERMR 302

Query: 306 EERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRC 365
           EERMDGIASARRDRSVEENLRIF  EMKNGTEEGLKNCVRAKIDY+A NKTLRDPVIYRC
Sbjct: 303 EERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYRC 362

Query: 366 NLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVH 425
           NLTPHHRTG+TWK+YPTYDFCVPIVD+LEGVTHALRTIEYRDRNAQYDWML+A++LRKVH
Sbjct: 363 NLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKVH 422

Query: 426 IWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQG 485
           IWDFARVNFVRTLLSKRKLQWMVDK LVSNWDDPRFPT        MTVEGLRNFVLSQG
Sbjct: 423 IWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQG 482

Query: 486 PSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPKHKKNP 545
           PSRNVINLEWNLIWAFNKKVIDPVA RHTA+V+PVK H++G   PQTP  +MK KHKKNP
Sbjct: 483 PSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDG--APQTPDVQMKLKHKKNP 540

Query: 546 AVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLDGDFKK 605
           AVGEKKVIYY D++ID+ DA LIEE EE+T+MDWGNVI+TKKNADGS+ GKLHL+GDFKK
Sbjct: 541 AVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDFKK 600

Query: 606 TKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADLNVKDM 665
           TK K+TWLADT D V VDLVDFDHLISKDKLEE E F DFLTP TEFH  AIADLNVKDM
Sbjct: 601 TKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVKDM 660

Query: 666 KVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709
           K GDIIQFERKGYYRLDAVA   KPYVFF+IPDGKSVNKYGAKK
Sbjct: 661 KKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704

>TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa]
           {ON} Anc_3.569 YGL245W
          Length = 707

 Score = 1172 bits (3032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/705 (79%), Positives = 624/705 (88%), Gaps = 1/705 (0%)

Query: 5   TLVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKIIEGF 64
           TL+I GK+ VVAY +LIAARI+N  KP SI I+FV+DKK+A +  NG +D    KI+   
Sbjct: 4   TLIIGGKSSVVAYSELIAARIVNSVKPDSITIEFVEDKKAAAASLNGETDDVLSKIVSAN 63

Query: 65  PEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSAADIA 124
            ++F E    +  EW K+A  ELV+KNFQKL+ SL KLDA LNLRTFI GGL YS ADIA
Sbjct: 64  ADVFPEGVTGS-EEWVKLAVSELVIKNFQKLATSLDKLDAHLNLRTFINGGLSYSIADIA 122

Query: 125 CWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNSGKKK 184
           CWGALRSNGM GSI+KNKV+VNVSRWY+L E +P FG  +E LTKSLQELKK S++GKKK
Sbjct: 123 CWGALRSNGMVGSIIKNKVNVNVSRWYTLFESNPIFGEANEFLTKSLQELKKASSAGKKK 182

Query: 185 ETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDT 244
           ETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFA AYKGKLIIRFDDT
Sbjct: 183 ETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFADAYKGKLIIRFDDT 242

Query: 245 NPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKM 304
           NPSKEK EFQ+SILEDL LLGIKGDRIT+SSDYFQ+MY+ C+++IKEGKAYCDDTP +KM
Sbjct: 243 NPSKEKVEFQESILEDLALLGIKGDRITHSSDYFQEMYDYCIQLIKEGKAYCDDTPVDKM 302

Query: 305 REERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYR 364
           REERMDGIASARR+RSVEENL+IF EEM+NGTEEGL+NCVRAKIDY+ALNKTLRDPVIYR
Sbjct: 303 REERMDGIASARRNRSVEENLKIFTEEMQNGTEEGLQNCVRAKIDYEALNKTLRDPVIYR 362

Query: 365 CNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKV 424
           CNL PHHRTGT WKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQY+WML+AMNLRKV
Sbjct: 363 CNLNPHHRTGTAWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLNAMNLRKV 422

Query: 425 HIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQ 484
           HIWDFARVNFVRTLLSKRKLQWMVDK LVSNWDDPRFPT        MT+EGLRNFV+SQ
Sbjct: 423 HIWDFARVNFVRTLLSKRKLQWMVDKELVSNWDDPRFPTVRGVRRRGMTIEGLRNFVISQ 482

Query: 485 GPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPKHKKN 544
           GPSRNVINLEWNLIWAFNKKVIDPVA R T +++P+KIHL G D P+TP+ EMKPKH KN
Sbjct: 483 GPSRNVINLEWNLIWAFNKKVIDPVAPRLTCVINPIKIHLSGADAPETPRVEMKPKHPKN 542

Query: 545 PAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLDGDFK 604
           PAVGEK+VI+ KDIVIDK DAD+IEE EE+T+M+WGN II KKNADGS+   LHL+GDFK
Sbjct: 543 PAVGEKRVIFSKDIVIDKDDADVIEEGEEITLMNWGNAIIDKKNADGSIDATLHLEGDFK 602

Query: 605 KTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADLNVKD 664
           KTKHK+TWLA+TEDV  VDLVDFDHLI+KDKLEEDESFE+FLTP TEFHT AIAD+NVKD
Sbjct: 603 KTKHKITWLAETEDVTKVDLVDFDHLITKDKLEEDESFENFLTPNTEFHTDAIADVNVKD 662

Query: 665 MKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709
           MKVGDIIQFERKGYYRLDA+ KDGKPY+FFTIPDGK+VNKYGAKK
Sbjct: 663 MKVGDIIQFERKGYYRLDALPKDGKPYIFFTIPDGKAVNKYGAKK 707

>ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {ON}
           highly similar to uniprot|P46655 Saccharomyces
           cerevisiae YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS)
           forms a complex with methionyl-tRNA synthetase (Mes1p)
           and Arc1p complex formation increases the catalytic
           efficiency of both tRNA synthetases and ensures their
           correct localization to the cytoplasm
          Length = 706

 Score = 1168 bits (3022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/704 (78%), Positives = 619/704 (87%), Gaps = 1/704 (0%)

Query: 6   LVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKIIEGFP 65
           LVINGKAPVVAY +LIA+RI+N A   +I ++FVD+K +AP VFNGSSD TF KII  +P
Sbjct: 4   LVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTYP 63

Query: 66  EIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSAADIAC 125
           ++F   + + VA W K+A E+LVVKNFQ+LS+SL +LDA LNLRTFILGGLK SAADI C
Sbjct: 64  DVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADIVC 123

Query: 126 WGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNSGKKKE 185
           WGALRSNGM GSI+KNKV VNVSRWY+LLE++P+FG  HE LTKS+Q +KK   +GKKKE
Sbjct: 124 WGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKKKE 183

Query: 186 THKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTN 245
            HKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILN+YFA AYKGKLIIRFDDTN
Sbjct: 184 GHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTN 243

Query: 246 PSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKMR 305
           PSKE+ EFQD+ILEDLEL+GIKGD+ITYSSDYFQ+MY+LCV++IKEGKAYCDDT  EKMR
Sbjct: 244 PSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMR 303

Query: 306 EERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRC 365
           EERM+GI SA+RD SVEENLRIF EEMKNGTE G KNCVRAKIDYKA NKTLRDPVIYRC
Sbjct: 304 EERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRC 363

Query: 366 NLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVH 425
           NLTPHHRT   WKMYPTYDFCVPIVDS+EGVTHALRTIEYRDRNAQYDWML A+ LRKVH
Sbjct: 364 NLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVH 423

Query: 426 IWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQG 485
           IWDFARVNF+RTLLSKRKLQWMVD GLVSNWDDPRFPT        MTVEGLRNFV+SQG
Sbjct: 424 IWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVISQG 483

Query: 486 PSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPKHKKNP 545
           PS+NVINLEWNLIWA NKK+IDPVA RHTA+VDPV+I LEG+  P+TPK E+KPKHKKNP
Sbjct: 484 PSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNP 543

Query: 546 AVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLDGDFKK 605
           AVGEKKVIY   I+IDK DA ++E  EE+T+MDWGN+IIT KNADGS+V K +L GDFKK
Sbjct: 544 AVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDFKK 603

Query: 606 TKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADLNVKDM 665
           TKHK+TWLA+T D VPV++VDFDHLI+KDKLEEDE+F DF+TP TEFHT A+ D+NVKDM
Sbjct: 604 TKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVKDM 662

Query: 666 KVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709
           KVGDIIQFERKGY RLD+ A+  KPY+FFTIPDGKSVN+YGAKK
Sbjct: 663 KVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706

>KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1167 bits (3020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/710 (78%), Positives = 621/710 (87%), Gaps = 3/710 (0%)

Query: 1   MSANTLVINGKAPVVAYGDLIAARIINDAKP-TSIDIQFVDDKKSAPSVFNGSSDSTFLK 59
           MSA +L+I  KAPV+AY +LIAAR +N +K   +I+I FV+DKK+A + FNG ++    K
Sbjct: 1   MSA-SLIIGAKAPVIAYPELIAARKVNASKGDNTIEISFVEDKKAAAASFNGETEDVLTK 59

Query: 60  IIEGFPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYS 119
           +   +P+I  + N D+ AEW +   ++LV+KNFQ+L+ESL KL+A LNLRT+IL  L+ S
Sbjct: 60  LSAAYPDILND-NSDSSAEWIEFGAKQLVIKNFQQLAESLAKLNAHLNLRTYILNTLEPS 118

Query: 120 AADIACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSN 179
            ADIA WG LRSNGM GSI+KNKV +NVSRWYS  E+ P FG  HE LTKSLQELKK SN
Sbjct: 119 LADIAVWGYLRSNGMVGSIIKNKVYINVSRWYSTFELIPEFGQAHEFLTKSLQELKKASN 178

Query: 180 SGKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLII 239
             KKKETHKANFEI LPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLII
Sbjct: 179 VNKKKETHKANFEIGLPDAKVGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII 238

Query: 240 RFDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDT 299
           RFDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQ+MY+ CV+MIKEGKAYCDDT
Sbjct: 239 RFDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKEGKAYCDDT 298

Query: 300 PTEKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRD 359
           PTE+MREER +GI S+RR+R+VEENL+IF EEMKNGTEEGLKNCVRAKIDY+ALNK +RD
Sbjct: 299 PTERMREERTEGIPSSRRERTVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKAMRD 358

Query: 360 PVIYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAM 419
           PVIYRCNLTPHHRTGT WK+YPTYDFCVPIVDSLEGVTHALRTIEYRDRN QYDWML+A+
Sbjct: 359 PVIYRCNLTPHHRTGTAWKIYPTYDFCVPIVDSLEGVTHALRTIEYRDRNPQYDWMLNAL 418

Query: 420 NLRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRN 479
           +LRKVHIWDFARVNFVRTLLSKRKLQW+VDK +VSNWDDPRFPT        MT+EGLRN
Sbjct: 419 HLRKVHIWDFARVNFVRTLLSKRKLQWLVDKDIVSNWDDPRFPTVRGVRRRGMTIEGLRN 478

Query: 480 FVLSQGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKP 539
           FVLSQGPSRNVINLEWNLIW+FNKKVIDPVA RHTAIV PVK+HLEGDDVPQTP  EMK 
Sbjct: 479 FVLSQGPSRNVINLEWNLIWSFNKKVIDPVAPRHTAIVSPVKVHLEGDDVPQTPNVEMKL 538

Query: 540 KHKKNPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHL 599
           KHKKNPA+GEKKVIYYKDIVID+ DA L+ E EEVT+MDWGN IITKKN DGS   KLHL
Sbjct: 539 KHKKNPAIGEKKVIYYKDIVIDEEDAKLLSEGEEVTLMDWGNAIITKKNDDGSFNAKLHL 598

Query: 600 DGDFKKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIAD 659
           +GDFK TK KLTWLADT+D V  DLVDFDHLISKDKLEE E+FEDFLTP TEFHT+A AD
Sbjct: 599 EGDFKTTKFKLTWLADTDDKVEADLVDFDHLISKDKLEEGENFEDFLTPKTEFHTTAYAD 658

Query: 660 LNVKDMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709
           LNVKDMKVGDIIQFERKGY+RLD++ KDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 659 LNVKDMKVGDIIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 708

>KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 704

 Score = 1159 bits (2999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/704 (80%), Positives = 619/704 (87%), Gaps = 3/704 (0%)

Query: 6   LVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKIIEGFP 65
           L+I  KAPVVAY +LIAAR++N AK  +I+I+FV+DKKS+P+ F  S D    +I++ +P
Sbjct: 4   LIIASKAPVVAYSELIAARLVNSAKTDAIEIEFVEDKKSSPATFEDSCDDVLKRIVQTYP 63

Query: 66  EIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSAADIAC 125
           E+F    ++   EW K+A+EEL VKNFQKLS SL KLDA LN RTFILGG  +SAADIAC
Sbjct: 64  EVFKHGFENC-DEWAKLASEELTVKNFQKLSVSLAKLDACLNFRTFILGGTTFSAADIAC 122

Query: 126 WGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNSGKKKE 185
           WG+LRSNGM GSI+KNKV VNVSRWY+LLE  P FGS HE L K+LQELKK S S KKKE
Sbjct: 123 WGSLRSNGMVGSIIKNKVYVNVSRWYTLLEQIPEFGSAHEFLVKTLQELKKASTSNKKKE 182

Query: 186 THKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTN 245
           THKANFEIDL DAK+GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQ YKGKLIIRFDDTN
Sbjct: 183 THKANFEIDLQDAKVGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDTN 242

Query: 246 PSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKMR 305
           PSKEKEEFQDSILEDLELLGIKGDR+TYSSDYFQ+MY+LCVKMI+EG AYCDDTPT+KMR
Sbjct: 243 PSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVKMIEEGNAYCDDTPTDKMR 302

Query: 306 EERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRC 365
           EERMDG+ASARRDRSVEENLRIF +EMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRC
Sbjct: 303 EERMDGLASARRDRSVEENLRIFTQEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRC 362

Query: 366 NLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVH 425
           NLTPHHRTG+TWK+YPTYDFCVPIVD+LEGVTHALRTIEYRDRNAQY WMLDA++LRKVH
Sbjct: 363 NLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYQWMLDALHLRKVH 422

Query: 426 IWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQG 485
           IWDFARVNFVRTLLSKRKLQWMVDK LVSNWDDPRFPT        MTVEGLRNFVLSQG
Sbjct: 423 IWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQG 482

Query: 486 PSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPKHKKNP 545
           PSRNVINLEWNLIWAFNKKVIDPVA RHTAIV PVK H+EG   PQTP  ++K KHKKNP
Sbjct: 483 PSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVKPVKFHVEG--APQTPDVQIKLKHKKNP 540

Query: 546 AVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLDGDFKK 605
           AVGEKKVIYY DI+ID+ DAD + E EE+T+MDWGN I+TKKNADGS+ GKLHL+GDFKK
Sbjct: 541 AVGEKKVIYYADILIDQDDADAVTEGEELTLMDWGNAIVTKKNADGSLTGKLHLEGDFKK 600

Query: 606 TKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADLNVKDM 665
           TK KLTWLADT+D V VDLVDFDHLI+KDKLEE E F D+LTP TEFH SA+ADLNVKDM
Sbjct: 601 TKLKLTWLADTDDKVDVDLVDFDHLITKDKLEEGEDFADYLTPQTEFHVSAVADLNVKDM 660

Query: 666 KVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709
           K GDIIQFERKGYYRLD+ A   KPYVFF IPDGKSVNKYGAKK
Sbjct: 661 KKGDIIQFERKGYYRLDSFATADKPYVFFAIPDGKSVNKYGAKK 704

>TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1137 bits (2942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/704 (78%), Positives = 628/704 (89%), Gaps = 1/704 (0%)

Query: 6   LVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKIIEGFP 65
           L+++GKA  VAYG+LIAARI+N++   ++DI FV+DKK+AP+  +GSSD    KI+   P
Sbjct: 5   LILSGKAQAVAYGELIAARIVNNSSANAVDISFVEDKKAAPATLDGSSDDVLAKIVALSP 64

Query: 66  EIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSAADIAC 125
             F  ++K+ VA WTK+A E+LVVKNFQ+L+++L  LDAQLNLR+F+LGGL +SAAD+A 
Sbjct: 65  SSFASASKEDVAHWTKLAQEKLVVKNFQQLAQTLEILDAQLNLRSFVLGGLNFSAADVAV 124

Query: 126 WGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNSGKKKE 185
           WGALRSNGM GSI+KNKV VNVSRWYS LE++P FG  HE LTKSLQELKK +N+GKKKE
Sbjct: 125 WGALRSNGMVGSIIKNKVYVNVSRWYSFLELEPAFGESHEFLTKSLQELKKAANAGKKKE 184

Query: 186 THKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTN 245
           +HKANFEIDL DAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTN
Sbjct: 185 SHKANFEIDLQDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTN 244

Query: 246 PSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKMR 305
           PSKEKEEF++SI+EDL LLGIKGDR+T+SSDYFQ+MY+ C++MIKEGKAYCDDTPTEKMR
Sbjct: 245 PSKEKEEFEESIIEDLALLGIKGDRVTHSSDYFQEMYDYCIQMIKEGKAYCDDTPTEKMR 304

Query: 306 EERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRC 365
           EERM+G  SARR+RSVEENL+IF E+M NGTEEGLKNCVRAKIDYKALNKTLRDPVIYRC
Sbjct: 305 EERMEGEPSARRNRSVEENLKIFTEDMTNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRC 364

Query: 366 NLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVH 425
           NLTPHH TG  WK+YPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQY+WMLDA+ LR VH
Sbjct: 365 NLTPHHITGDKWKVYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLDALKLRHVH 424

Query: 426 IWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQG 485
           IWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPT        M++EGLRNFVLSQG
Sbjct: 425 IWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMSIEGLRNFVLSQG 484

Query: 486 PSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPKHKKNP 545
           PSRNVINLEWNLIWAFNKKVIDP A RHTA+V+P K+HLEG +VPQT K EMKPKHKKNP
Sbjct: 485 PSRNVINLEWNLIWAFNKKVIDPTAPRHTAVVNPFKVHLEGSEVPQTDKIEMKPKHKKNP 544

Query: 546 AVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLDGDFKK 605
            VGEKKV++ K+I+IDK DAD++EE EE T+MDWGN IITKK+A+ S+  KLHL+GDFKK
Sbjct: 545 DVGEKKVVFSKNIIIDKEDADVLEEGEEFTLMDWGNAIITKKDAN-SITAKLHLEGDFKK 603

Query: 606 TKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADLNVKDM 665
           TKHK+TWLADT+DVV VDLVDFDHL++KD++EE ESFEDFLT  TEFHTSAIADLNVKDM
Sbjct: 604 TKHKITWLADTKDVVSVDLVDFDHLLNKDRIEEGESFEDFLTEKTEFHTSAIADLNVKDM 663

Query: 666 KVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709
           K+GD IQFERKGYYRLD++ K+G PYVFFTIPDGK+VNKYGAKK
Sbjct: 664 KIGDFIQFERKGYYRLDSLPKNGNPYVFFTIPDGKAVNKYGAKK 707

>AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL245W (GUS1)
          Length = 707

 Score = 1137 bits (2941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/707 (75%), Positives = 610/707 (86%), Gaps = 1/707 (0%)

Query: 3   ANTLVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKIIE 62
           ++TL+I  K+P VAY +LIAAR +N+AK  ++ IQF + K++A + F+G S +   +++E
Sbjct: 2   SSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMVE 61

Query: 63  GFPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSAAD 122
            +P++     ++A A W   A  +LVVK+F+KLS SL KLDA LNLRTF+LGG++ + AD
Sbjct: 62  KYPDVLGSVPEEA-AWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVAD 120

Query: 123 IACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNSGK 182
           +A WGALRSNG  GSI+KNKV VNVSRWY+ LE+ P FG  HE L KSL+ELK   N  K
Sbjct: 121 VAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVNK 180

Query: 183 KKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFD 242
           KKETHKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIRFD
Sbjct: 181 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240

Query: 243 DTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTE 302
           DTNPSKE+ EFQDSILEDLELLGIKGDRIT+SSDYFQ+MY+ CV+MIKEGKAYCDDTPTE
Sbjct: 241 DTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPTE 300

Query: 303 KMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVI 362
           +MREERM+GIASARR+RSVEENL+IF EEMKNGTEEGLKNCVRAK DY ALNKTL+DPV+
Sbjct: 301 RMREERMEGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVL 360

Query: 363 YRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLR 422
           YRCNLTPHHRTGT WK+YPTYDFCVPIVD+LEGVTHALRTIEYRDRNAQY+WML+A+ LR
Sbjct: 361 YRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLR 420

Query: 423 KVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVL 482
           KVHIWDFARVNFVRTLLSKRKLQW+VDK +VSNWDDPRFPT        MT+EGLRNFVL
Sbjct: 421 KVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVL 480

Query: 483 SQGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPKHK 542
           SQGPSRNVINLEWNLIWAFNKKVIDP+A RHT + +PVK+HL G DVPQTP TEMKPKHK
Sbjct: 481 SQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHK 540

Query: 543 KNPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLDGD 602
           KNPAVGEKKVIYYKD++I   DA ++   EEVT+MDWGN II  KN DGS+   L+L+GD
Sbjct: 541 KNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEGD 600

Query: 603 FKKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADLNV 662
           FKKTK KLTWLADT D VPVDLVDFDHLISKD+LEE+++FEDFLTP TEFHT+AIADLNV
Sbjct: 601 FKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLNV 660

Query: 663 KDMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709
           KDMKVGD+IQFER GYYRLD V    KP+VFFTIPDGK+VNKYGAKK
Sbjct: 661 KDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707

>ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 803

 Score =  244 bits (623), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 152/446 (34%), Positives = 243/446 (54%), Gaps = 30/446 (6%)

Query: 198 AKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSI 257
           A  G V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 246 ATHGLVHTRFPPEPNGYLHIGHSKAIMVNFGYAKFHGGHCYLRFDDTNPEAEAPEYFESI 305

Query: 258 LEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKMREER---MDGI-- 312
           +  +  LG    +ITYSSDYF Q+YEL  ++I +GK Y  +   E+++  R    DG   
Sbjct: 306 IRMVNWLGFHPWKITYSSDYFDQLYELAERLISKGKGYVCNCAAEEIKASRGIKPDGTPG 365

Query: 313 ----ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLT 368
               A   R RSVEENL  F + MK+G  +  +  +R K D  + +  + D + YR    
Sbjct: 366 GERHACKHRSRSVEENLTEFRK-MKDGHYQPGEATLRMKQDLSSPSPQMWDLIAYRVLNA 424

Query: 369 PHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVHIWD 428
           PH RTG  W++YPTYDF   +VDS E +TH+L T E+      Y+W+ D +++ +    +
Sbjct: 425 PHPRTGNKWRIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVDVFRPTQRE 484

Query: 429 FARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 488
           + R+N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 485 YGRLNITGTVLSKRKIAKLVDEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 489 NVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMK-PKHKKNPAV 547
           +V N++     +  +K ++    R   I+DPV++ +  D+VP + +  +  P     P  
Sbjct: 545 SVTNIQLVRFESAIRKYLEDTTPRLMFILDPVEVVV--DNVPDSFEDVVSIPFRPGTPEF 602

Query: 548 GEKKVIYYKDIVIDKADADLIEENEE---------VTMMDWGNVIITK---KNADGSMVG 595
           GE++V + K + ID++D      ++E         V ++   + +I K   K++DG +  
Sbjct: 603 GEREVPFTKRVFIDRSDFSENASDKEFFRLTPEQPVGLIKVPHALIYKSLEKDSDGKIT- 661

Query: 596 KLHL----DGDFKKTKHKLTWLADTE 617
           K+H+    +G  KK K  + W+  +E
Sbjct: 662 KIHVHYDTEGKIKKPKTYIQWVPLSE 687

>YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}
           GLN4Glutamine tRNA synthetase, monomeric class I tRNA
           synthetase that catalyzes the specific glutaminylation
           of tRNA(Glu); N-terminal domain proposed to be involved
           in enzyme-tRNA interactions
          Length = 809

 Score =  234 bits (597), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 131/375 (34%), Positives = 210/375 (56%), Gaps = 15/375 (4%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 261 LELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKMREER---MDGI----- 312
           +  LG K  +ITYSSDYF ++Y L   +IK GKAY      E+++  R    DG      
Sbjct: 310 VSWLGFKPWKITYSSDYFDELYRLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 369

Query: 313 -ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHH 371
            A   RD+S+E+NL+ F  +M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 370 YACKHRDQSIEQNLQEF-RDMRDGKYKPGEAILRMKQDLNSPSPQMWDLIAYRVLNAPHP 428

Query: 372 RTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVHIWDFAR 431
           RTGT W++YPTYDF   +VDS+E +TH+L T E+      Y+W+ D +++ +    ++ R
Sbjct: 429 RTGTKWRIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 432 VNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 492 NLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLE--GDDVPQTPKTEMKPKHKKNPAVGE 549
           N++     +  +K ++    R   ++DPV++ ++   DD  +      +P     P  GE
Sbjct: 549 NIQVVRFESAVRKYLEDTTPRLMFVLDPVEVVVDNLSDDYEELATIPYRP---GTPEFGE 605

Query: 550 KKVIYYKDIVIDKAD 564
           + V +     I+++D
Sbjct: 606 RTVPFTNKFYIERSD 620

>SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {ON}
           highly similar to uniprot|P13188 Saccharomyces
           cerevisiae YOR168W GLN4 Glutamine tRNA synthetase
           monomeric class I tRNA synthetase that catalyzes the
           specific glutaminylation of tRNA(Glu) N-terminal domain
           proposed to be involved in enzyme-tRNA interactions
          Length = 801

 Score =  233 bits (595), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 164/546 (30%), Positives = 279/546 (51%), Gaps = 61/546 (11%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 246 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGVCYLRFDDTNPEAEAPEYFESIKRM 305

Query: 261 LELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKMREER---MDG------ 311
           +  LG +  +ITYSSDYF ++Y+L   +IK GKAY      E+++  R    DG      
Sbjct: 306 VSWLGFEPWKITYSSDYFDKLYDLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 365

Query: 312 IASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHH 371
           +A   RDR +EENL  F + M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 366 VACVHRDRPIEENLEEFRK-MRDGVYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 424

Query: 372 RTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVHIWDFAR 431
           RTG  WK+YPTYDF   +VDS E +TH+L T E+      Y+W+ D +++ +    ++ R
Sbjct: 425 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 484

Query: 432 VNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +V++G+V  W+DPR  T        +    + +F+ + G + +  
Sbjct: 485 LNITGTVLSKRKIAKLVNEGIVRGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 544

Query: 492 NLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMK-PKHKKNPAVGEK 550
           N++     +  +K ++   AR   ++DPV+I +  D++P+  +  +  P     P  G++
Sbjct: 545 NIQVVRFESAIRKYLEDTTARLMFVLDPVEIVV--DNLPEDYEEMVTIPYRPGTPEFGDR 602

Query: 551 KVIYYKDIVIDKAD-ADLIEENEEVTMMDWGNVIITK-----------KNADGSMVGKLH 598
            V + K   I+++D ++  ++ E   +     V + K           +++DG +V ++H
Sbjct: 603 TVPFTKKFFIERSDFSEAADDKEFFRLTPTQPVGLIKVPYTVSFQSVDRDSDGKIV-RIH 661

Query: 599 LDGD-----FKKTKHKLTWLA-DTEDVVPVDLVD---FDHLI-SKDKLEEDESFEDFLTP 648
           +  D      KK K  + W+    +   PV + +   ++ L  S++     E + + + P
Sbjct: 662 VKYDNDQAKAKKPKAYIQWVPFSAKHNSPVTISETRVYNQLFNSENPSSHPEGYLNDINP 721

Query: 649 TTEF-HTSAIADLNV------------------------KDMKVGDIIQFERKGYYRLDA 683
            +E  +T ++ + N                         KD K     Q  R GY+ LD 
Sbjct: 722 ESEIVYTKSLVEHNFDHVIKNSPWVVNSVKESPFYVEEEKDRKEVCRFQAMRVGYFTLDK 781

Query: 684 VAKDGK 689
            ++DGK
Sbjct: 782 DSEDGK 787

>TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.51
           YOR168W
          Length = 809

 Score =  233 bits (595), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 135/374 (36%), Positives = 213/374 (56%), Gaps = 13/374 (3%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G+  +RFDDTNP  E  E+ +SI   
Sbjct: 252 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNGGETYLRFDDTNPEAEAPEYFESIKRM 311

Query: 261 LELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKMREER---MDG------ 311
           +  LG K  +ITYSSDYF ++YEL   +IK GK Y     +E+++  R    DG      
Sbjct: 312 VSWLGFKPFKITYSSDYFDKLYELAEVLIKSGKGYVCHCTSEEVKAGRGIKEDGTPGGER 371

Query: 312 IASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHH 371
            A   RDRS+EE L  F + M+NG  +  +  +R K D  + +  + D V YR    PH 
Sbjct: 372 FACKDRDRSIEETLDEFRK-MRNGFYKPGEATLRMKQDLSSPSPQMWDLVAYRVLNAPHP 430

Query: 372 RTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVHIWDFAR 431
           RTG+ WK+YPTYDF   +VDS E +TH+L T E+      Y+W+ D +++ +    ++ R
Sbjct: 431 RTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPTQREYGR 490

Query: 432 VNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 491 LNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 550

Query: 492 NLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMK-PKHKKNPAVGEK 550
           N++     +  +K ++    R   ++DPV++ L  D++P+  +  +K P    +P  GE+
Sbjct: 551 NIQVVRFESAIRKYLEDSTPRLMFVLDPVEVVL--DNLPEDYEELVKIPFRPGSPEFGER 608

Query: 551 KVIYYKDIVIDKAD 564
           +V + K   I+++D
Sbjct: 609 EVPFTKRFFIERSD 622

>KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6.51
           YOR168W
          Length = 799

 Score =  231 bits (590), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 142/440 (32%), Positives = 241/440 (54%), Gaps = 28/440 (6%)

Query: 198 AKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSI 257
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 246 ATAGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESI 305

Query: 258 LEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKMREER---MDG--- 311
              +  LG +  +ITYSSDYF ++YEL   +IK GK Y      E++R  R    DG   
Sbjct: 306 KRMVSWLGFEPWKITYSSDYFDKLYELAKVLIKNGKGYICHCTAEEIRRGRGIKEDGQPG 365

Query: 312 ---IASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLT 368
                   R+ S+E+NL  F E MK G  +  +  +R K D+ + +  + D + YR    
Sbjct: 366 GERFGCKHRENSIEKNLEEF-ENMKEGKYQPGEATLRMKQDFSSPSPQMWDLIAYRVLNA 424

Query: 369 PHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVHIWD 428
           PH RTG+ WK+YPTYDF   +VDS E +TH+L T E+      Y+W+ D +++ +    +
Sbjct: 425 PHPRTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 484

Query: 429 FARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 488
           + R+N   T+LSKRK+  +V++ +V  WDDPR  T        +    + +F+ + G + 
Sbjct: 485 YGRLNITGTILSKRKIAKLVEEKIVRGWDDPRLYTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 489 NVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPKHKKNPA-V 547
           +V N++     +  +K ++    R   ++DP+++ +  D++P+  +  ++  +K   A  
Sbjct: 545 SVTNIQAVRFESAIRKYLEETTPRLMFVLDPIEVVV--DNLPEDHEELVEVPYKAGSAEF 602

Query: 548 GEKKVIYYKDIVIDKAD-ADLIEENEEVTMMDWGNVIITK-----------KNADGSMVG 595
           G + + +     ID++D ++ +++ E   +    +V + K           K+A+G +  
Sbjct: 603 GSRTLPFTNRFYIDRSDFSETVDDKEFFRLTPSQSVGLVKVPRTVTFVSVEKDANGHIT- 661

Query: 596 KLHLDGDFKKTKHK--LTWL 613
           +LH++ D +K K K  + W+
Sbjct: 662 RLHVNYDSEKKKPKTYIQWV 681

>AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR168W
           (GLN4)
          Length = 798

 Score =  230 bits (587), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 133/377 (35%), Positives = 209/377 (55%), Gaps = 13/377 (3%)

Query: 198 AKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSI 257
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 242 ATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHHGGVCYLRFDDTNPEAEAPEYFESI 301

Query: 258 LEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKMREER---MDG--- 311
              +  LG    +ITYSSDYF Q+YEL   +IK GK Y      E++R  R    DG   
Sbjct: 302 ERMVAWLGFSPWKITYSSDYFDQLYELAEVLIKNGKGYICHCTAEEIRRGRGIKEDGTPG 361

Query: 312 ---IASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLT 368
              +  A R+R +EENL  F   M++G     +  +R K D  + +  + D V YR    
Sbjct: 362 GERLPCAHRERPIEENLAEFRN-MRDGKYAPGEAILRMKQDLSSPSPQMWDLVAYRVLNA 420

Query: 369 PHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVHIWD 428
           PH RTG+ W++YPTYDF   +VDSLE +TH+L T E+      Y+W+ D +++ +    +
Sbjct: 421 PHPRTGSKWRIYPTYDFTHCLVDSLENITHSLCTAEFYLSRESYEWLCDQVHVFRPAQRE 480

Query: 429 FARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 488
           + R+N   T+LSKRK+  +V +  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 481 YGRLNITGTVLSKRKIAKLVHEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 540

Query: 489 NVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMK-PKHKKNPAV 547
           +  N++     +  +K ++   AR   ++DP+++ +  D++P+  +  +  P     P  
Sbjct: 541 STTNIQVVRFESAIRKYLEDTTARLMFVLDPIEVIV--DNLPEDYEELVSIPYRPGTPEF 598

Query: 548 GEKKVIYYKDIVIDKAD 564
           GE+ V + K   I+++D
Sbjct: 599 GERTVPFSKRFYIERSD 615

>Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168W
           (REAL)
          Length = 810

 Score =  229 bits (584), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 130/375 (34%), Positives = 207/375 (55%), Gaps = 15/375 (4%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 251 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFESIKRM 310

Query: 261 LELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKMREER---MDG------ 311
           +  LG    +ITYSSDYF ++Y L   +IK GK Y      E+++  R    DG      
Sbjct: 311 VSWLGFMPWKITYSSDYFDELYGLAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTPGGQR 370

Query: 312 IASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHH 371
            A   RD+S+E NL+ F  +M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 371 FACKHRDQSIELNLQEF-RDMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 429

Query: 372 RTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVHIWDFAR 431
           RTGT WK+YPTYDF   +VDS+E +TH+L T E+      Y+W+ D +++ +    ++ R
Sbjct: 430 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 432 VNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 549

Query: 492 NLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLE--GDDVPQTPKTEMKPKHKKNPAVGE 549
           N++     +  +K ++    R   ++DPV++ ++   DD  +      +P     P  GE
Sbjct: 550 NIQVVRFESAVRKYLEDTTPRLMFVLDPVEVIVDNLSDDYEELATIPFRP---GTPEFGE 606

Query: 550 KKVIYYKDIVIDKAD 564
           + V +     I+++D
Sbjct: 607 RTVPFTNRFYIERSD 621

>Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {ON}
           YOR168W (GLN4) - glutaminyl-tRNA synthetase [contig 185]
           FULL
          Length = 800

 Score =  226 bits (575), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 136/387 (35%), Positives = 210/387 (54%), Gaps = 15/387 (3%)

Query: 198 AKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSI 257
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G   +RFDDTNP  E  E+ +SI
Sbjct: 242 ATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDGVCYLRFDDTNPEAEAPEYFESI 301

Query: 258 LEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAY---CDDTPTEKMREERMDGI-- 312
              +  LG K  +ITYSSDYF ++YEL   +I   KAY   C     ++ R  + DG   
Sbjct: 302 KNMVAWLGFKPWKITYSSDYFDKLYELAEVLISNSKAYVCHCSGEEIKRGRGIKEDGTPG 361

Query: 313 ----ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLT 368
               A   R RSVEENL  F  +M++G  +  +  +R K D ++ +  + D + YR    
Sbjct: 362 GERRACVHRSRSVEENLTEF-RKMRDGHYKPGEAILRMKQDLESPSPQMWDLIAYRVLNA 420

Query: 369 PHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVHIWD 428
           PH RTG  WK+YPTYDF   +VDS E +TH+L T E+      Y+W+ D +++ +    +
Sbjct: 421 PHPRTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 480

Query: 429 FARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 488
           + R+N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 481 YGRLNITGTVLSKRKIAKLVNEHYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 540

Query: 489 NVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEG--DDVPQTPKTEMKPKHKKNPA 546
           +  N++     +  +K ++    R   I+DPV++ ++   DD  +  K   +P     P 
Sbjct: 541 STTNIQVVRFESAIRKYLEDNTPRLMMILDPVEVVVDNLPDDYEELVKIPYRP---GTPE 597

Query: 547 VGEKKVIYYKDIVIDKADADLIEENEE 573
            GE+ V + K   I+++D      N+E
Sbjct: 598 FGERSVPFTKKFYIERSDFSEATGNKE 624

>Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168W
           (REAL)
          Length = 809

 Score =  226 bits (575), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 136/406 (33%), Positives = 219/406 (53%), Gaps = 21/406 (5%)

Query: 171 LQELKKVS-NSGKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYF 229
           L++L KV  N     E  K + E+       G+V TRFPPEP+GYLHIGH+KA ++N  +
Sbjct: 224 LKDLHKVGENPQAYPELMKKHLEV-----TGGKVRTRFPPEPNGYLHIGHSKAIMVNFGY 278

Query: 230 AQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMI 289
           A+ + G   +RFDDTNP KE  E+ +SI   +  LG K  +ITYSSDYF ++Y L   +I
Sbjct: 279 ARYHNGTCYLRFDDTNPEKEAPEYFESIKRMVSWLGFKPWKITYSSDYFDELYGLAEVLI 338

Query: 290 KEGKAY---CDDTPTEKMREERMDG------IASARRDRSVEENLRIFNEEMKNGTEEGL 340
             GK Y   C     ++ R  + DG       A   RD+S+E NL+ F  +M++G  +  
Sbjct: 339 NNGKGYVCHCTGEEIKRSRGIKEDGTPGGERFACKHRDQSIELNLKEF-RDMRDGKYKPG 397

Query: 341 KNCVRAKIDYKALNKTLRDPVIYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHAL 400
           +  +R K D  + +  + D + YR    PH RTGT WK+YPTYDF   +VDS+E +TH+L
Sbjct: 398 EAILRMKQDLSSPSPQMWDLIAYRVLNAPHPRTGTKWKIYPTYDFTHCLVDSMENITHSL 457

Query: 401 RTIEYRDRNAQYDWMLDAMNLRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPR 460
            T E+      Y+W+ D +++ +    ++ R+N   T+LSKRK+  +VD+  V  WDDPR
Sbjct: 458 CTTEFYLSRESYEWLCDQVHVFRPAQREYGRLNITGTVLSKRKIAQLVDEKFVRGWDDPR 517

Query: 461 FPTXXXXXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPV 520
             T        +    + +F+ + G + +  N++     +  +K ++    R   ++DP+
Sbjct: 518 LFTLEAIRRRGVPPGAILSFINTLGVTTSTTNIQVIRFESAVRKYLEDTTPRLMFVLDPI 577

Query: 521 KIHLEG--DDVPQTPKTEMKPKHKKNPAVGEKKVIYYKDIVIDKAD 564
           ++ ++   DD  +      +P   +    GE+ V +     I+++D
Sbjct: 578 EVVVDNLPDDYEELAIIPFRPGTSE---FGERTVPFTNKFYIERSD 620

>TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  226 bits (575), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 129/384 (33%), Positives = 206/384 (53%), Gaps = 15/384 (3%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 251 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 310

Query: 261 LELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKMREERM---------DG 311
           +  LG K  +ITYSSDYF ++YEL   +I   K Y      E+++  R          D 
Sbjct: 311 VSWLGFKPWKITYSSDYFDKLYELAEVLINNDKGYICHCTAEEIKRGRGIKEDGTPGGDR 370

Query: 312 IASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHH 371
            A   R+R +EENL+ F   M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 371 FACVHRNRPIEENLKEFRS-MRDGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNAPHP 429

Query: 372 RTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVHIWDFAR 431
           RTGT WK+YPTYDF   +VDS E +TH+L T E+      Y+W+ D +++ +    ++ R
Sbjct: 430 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 432 VNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEAIRRRGVPPGSILSFINTLGVTTSTT 549

Query: 492 NLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLE--GDDVPQTPKTEMKPKHKKNPAVGE 549
           N++     +  +K ++    R   I+DP+++ ++   DD  +      +P     P  GE
Sbjct: 550 NIQVTRFESAIRKYLEDSTPRLMFILDPIEVVVDNLADDYEELVSIPYRP---ATPEFGE 606

Query: 550 KKVIYYKDIVIDKADADLIEENEE 573
           + V +     I+++D      N+E
Sbjct: 607 RNVPFTNKFYIERSDFSEDSSNKE 630

>Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W
           (REAL)
          Length = 821

 Score =  224 bits (572), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 127/375 (33%), Positives = 205/375 (54%), Gaps = 15/375 (4%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 261 LELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAY---CDDTPTEKMREERMDG------ 311
           +  LG +  +ITYSSDYF ++Y L   +I   K Y   C     ++ R  + DG      
Sbjct: 310 VSWLGFEPWKITYSSDYFDELYRLAEVLINNDKGYICHCTAEEIKRGRGIKEDGTPGGER 369

Query: 312 IASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHH 371
            A   RD+ +E NL+ F   M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 370 FACKHRDQPIELNLQEF-RNMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 428

Query: 372 RTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVHIWDFAR 431
           RTGT WK+YPTYDF   +VDS+E +TH+L T E+      Y+W+ D +++ +    ++ R
Sbjct: 429 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 432 VNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 492 NLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLE--GDDVPQTPKTEMKPKHKKNPAVGE 549
           N++     +  +K ++    R   ++DP+++ ++   DD  +      +P     PA GE
Sbjct: 549 NIQVVRFESAIRKYLEDTTPRLMFVLDPIEVVVDNLADDFEELATIPYRP---GTPAFGE 605

Query: 550 KKVIYYKDIVIDKAD 564
           + V +     I+++D
Sbjct: 606 RTVPFTNKFYIERSD 620

>Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {ON}
           complement(93063..95489) [2427 nt, 809 aa]
          Length = 808

 Score =  223 bits (569), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 127/374 (33%), Positives = 206/374 (55%), Gaps = 13/374 (3%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 251 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYWDGVCYLRFDDTNPEAEAPEYFESIKRM 310

Query: 261 LELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAY---CDDTPTEKMREERMDGI----- 312
           +  LG K  +ITYSSDYF ++YEL   +I+  + Y   C     ++ R  + DG      
Sbjct: 311 VSWLGFKPWKITYSSDYFDKLYELAEILIQNDRGYICHCTAEEIKRGRGIKEDGTPGGER 370

Query: 313 -ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHH 371
            A   RDR VEE+L+ F   M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 371 SACKHRDRPVEESLKEFRN-MRDGVYQPGEATLRMKQDLTSPSPQMWDLIAYRVLNAPHP 429

Query: 372 RTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVHIWDFAR 431
           RTG+ WK+YPTYDF   +VDS E +TH+L T E+      Y+W+ D +++ +    ++ R
Sbjct: 430 RTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 432 VNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEGNYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 549

Query: 492 NLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQ-TPKTEMKPKHKKNPAVGEK 550
           N++     +  +K ++    R   ++DP+++ +  D++P+   +    P     P  GE+
Sbjct: 550 NIQVVRFESAVRKFLEDTTPRLMFVLDPIEVVV--DNLPEDYEEIASIPYRPGTPEFGER 607

Query: 551 KVIYYKDIVIDKAD 564
            V + K   I+++D
Sbjct: 608 NVPFTKKFYIERSD 621

>CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168w GLN4
          Length = 795

 Score =  223 bits (567), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 213/386 (55%), Gaps = 13/386 (3%)

Query: 198 AKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSI 257
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 238 ATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESI 297

Query: 258 LEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKMREER---MDGI-- 312
              +  LG K  ++TYSSDYF ++YEL   +IK GK Y      E+++  R    DG   
Sbjct: 298 KRMVSWLGFKPWKVTYSSDYFDKLYELAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTPG 357

Query: 313 ----ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLT 368
               A   RD+SVE+NL  F   M++G  +  +  +R K + ++ +  + D + YR    
Sbjct: 358 GERHACKHRDQSVEKNLEEFRA-MRDGKYKPGEAILRMKQNLESPSPQMWDLIAYRVLNA 416

Query: 369 PHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVHIWD 428
           PH RTGT WK+YPTYDF   +VDS E +TH+L T E+      Y+W+ D +++ +    +
Sbjct: 417 PHPRTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 476

Query: 429 FARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 488
           + R+N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 477 YGRLNITGTVLSKRKIAKLVDEHFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 536

Query: 489 NVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMK-PKHKKNPAV 547
           +  N++     +  +K ++    R   I+DP+++ +E  ++P+  +  +  P        
Sbjct: 537 STTNIQVVRFESAIRKYLEDSTPRLMMILDPIEVVVE--NLPEDYEELVTIPYRAGTKEF 594

Query: 548 GEKKVIYYKDIVIDKADADLIEENEE 573
           G++ V +     I++AD     E++E
Sbjct: 595 GDRNVPFTNKFYIERADFSENTEDKE 620

>KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 800

 Score =  222 bits (566), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 130/374 (34%), Positives = 208/374 (55%), Gaps = 13/374 (3%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G   +RFDDTNP  E  E+ +SI   
Sbjct: 245 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDGVCYLRFDDTNPEAEAPEYFESIKSM 304

Query: 261 LELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKMREER---MDGI----- 312
           +  LG K  +ITYSSDYF ++YEL  K+I  GKAY      E+++  R    DG      
Sbjct: 305 VSWLGFKPWKITYSSDYFDKLYELAEKLITNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 364

Query: 313 -ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHH 371
            A   R RSVEENL  F  +M++G  +  +  +R K D ++ +  + D + YR     H 
Sbjct: 365 HACVHRGRSVEENLAEFR-KMRDGAYKPGEATLRMKQDLESPSPQMWDLIAYRVLNASHP 423

Query: 372 RTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVHIWDFAR 431
           RTG  WK+YPTYDF   +VDS E +TH+L T E+      Y+W+ D +++ +    ++ R
Sbjct: 424 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 483

Query: 432 VNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +V++  V  W+DPR  T        +    + +F+ + G + +  
Sbjct: 484 LNITGTILSKRKIAKLVNEHYVRGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 543

Query: 492 NLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMK-PKHKKNPAVGEK 550
           N++     +  +K ++    R   ++DPV++ +  D++P+  +  +  P     P  GE+
Sbjct: 544 NIQVVRFESAIRKYLEDNTPRLMMVLDPVEVVV--DNLPEDYEELVTVPYRPGTPEFGER 601

Query: 551 KVIYYKDIVIDKAD 564
           +V +     I+++D
Sbjct: 602 QVPFTGKFYIERSD 615

>NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6.51
           YOR168W
          Length = 814

 Score =  222 bits (566), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 129/384 (33%), Positives = 207/384 (53%), Gaps = 15/384 (3%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 255 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 314

Query: 261 LELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAY---CDDTPTEKMREERMDGI----- 312
           +  LG    +ITYSSDYF ++Y+L   +I  GK Y   C     ++ R  + DG      
Sbjct: 315 VHWLGFTPWKITYSSDYFDKLYDLAELLINNGKGYICHCTAEEIKRGRGIKEDGTPGGER 374

Query: 313 -ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHH 371
            A   RDR +EENL+ F   M++G  +  +  +R K D  + +  + D + YR     H 
Sbjct: 375 HACKHRDRPIEENLQEF-RNMRDGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNAAHP 433

Query: 372 RTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVHIWDFAR 431
           RTGT WK+YPTYDF   +VDS E +TH+L T E+      Y+W+ D +++ +    ++ R
Sbjct: 434 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 493

Query: 432 VNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 494 LNITGTVLSKRKIAKLVDEKFVRGWDDPRLFTLEAIRRRGVPPGSILSFINTLGVTTSTT 553

Query: 492 NLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLE--GDDVPQTPKTEMKPKHKKNPAVGE 549
           N++     +  +K ++    R   I+DP+++ ++   DD  +       P     P  GE
Sbjct: 554 NIQVVRFESAIRKYLEDTTPRLMFILDPIEVIVDNLSDDYEELVTI---PYRAGTPEFGE 610

Query: 550 KKVIYYKDIVIDKADADLIEENEE 573
           + V +     I+++D   + +++E
Sbjct: 611 RTVPFTNKFFIERSDFSEVTDDKE 634

>NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}
           Anc_6.51 YOR168W
          Length = 811

 Score =  221 bits (564), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 143/449 (31%), Positives = 236/449 (52%), Gaps = 33/449 (7%)

Query: 198 AKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSI 257
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G  I+RFDDTNP  E  E+ +SI
Sbjct: 251 ATGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNDGVCILRFDDTNPEAEAPEYFESI 310

Query: 258 LEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAY---CDDTPTEKMREERMDGI-- 312
              +  LG    +ITYSSDYF ++Y+L   +I   + Y   C     ++ R  + DG   
Sbjct: 311 KRMVSWLGFVPWKITYSSDYFDKLYDLAEVLINNDRGYICHCTAEEIKRGRGIKEDGTPG 370

Query: 313 ----ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLT 368
               A   R  S+E NL+ F   M++G  +  +  +R K D  + +  + D + YR    
Sbjct: 371 GERSACVHRSNSIETNLKEF-RNMRDGVYKPGEATLRMKQDLTSPSPQMWDLIAYRVLNA 429

Query: 369 PHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVHIWD 428
           PH RTGT WK+YPTYDF   +VDS E +TH+L T E+R     Y+W+ D +++ +    +
Sbjct: 430 PHPRTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFRLSRESYEWLCDQVHVFRPAQRE 489

Query: 429 FARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 488
           + R+N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 490 YGRLNITGTVLSKRKIAKLVDEHHVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 549

Query: 489 NVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMK-PKHKKNPAV 547
           +  N++        +K ++    R   I+DP++I +  D++P+  +  +  P     P  
Sbjct: 550 STTNIQVARFENSIRKYLEDSTPRLMFILDPIEIVV--DNLPEDYEEILSIPYRAGTPEF 607

Query: 548 GEKKVIYYKDIVIDKAD-ADLIEENEEVTMMDWGNVIITK-----------KNADGSMVG 595
           G++ V + K   I+++D +++ ++ E   +    NV + K           K+++G +  
Sbjct: 608 GDRTVPFTKRFYIERSDFSEVSDDKEFFRLTPTQNVGLIKVPHTVSFKSVEKDSNGKIT- 666

Query: 596 KLHL-------DGDFKKTKHKLTWLADTE 617
           K+H+       +G  KK K  + W+  +E
Sbjct: 667 KIHVHYNNEAQEGKPKKPKTYIQWVPVSE 695

>KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.51
           YOR168W
          Length = 794

 Score =  221 bits (563), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 134/377 (35%), Positives = 206/377 (54%), Gaps = 18/377 (4%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + GK  +RFDDTNP  E  E+ +SI   
Sbjct: 247 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHFGGKCYLRFDDTNPEAEAPEYFESIKRM 306

Query: 261 LELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAY---CDDTPTEKMREERMDGI----- 312
           +  LG K  +ITYSSDYF ++Y+L   +IK  K Y   C     ++ R  + DG      
Sbjct: 307 VSWLGFKPWKITYSSDYFDKLYDLAEFLIKSDKGYICHCTAEEIKRGRGIKEDGTPGGER 366

Query: 313 -ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHH 371
            A A R R +EE+L  F  +MK+G  E  K  +R K D ++ N  + D + YR    PH 
Sbjct: 367 SACAHRSRPIEESLAEF-RKMKDGFYEPGKAILRMKQDLQSPNPQMWDLIAYRVLNAPHP 425

Query: 372 RTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVHIWDFAR 431
           RTG  W++YPTYDF   +VDS E +TH+L T E+      Y+W+ D +++ +    ++ R
Sbjct: 426 RTGDKWRIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 485

Query: 432 VNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 486 LNITGTILSKRKIAKLVELHHVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSDT 545

Query: 492 NLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLE--GDDVPQTPKTEMKPKHKKNPAVGE 549
           N++        +K ++    R   I+DP++I ++   +D  +       P  KK    G+
Sbjct: 546 NIQVARFETAVRKYLEETTPRLMFILDPIEIIVDNLAEDYEEIVSI---PYSKK---FGD 599

Query: 550 KKVIYYKDIVIDKADAD 566
           + V + K I I++ D D
Sbjct: 600 RTVPFTKRIYIERKDFD 616

>Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar to
           Ashbya gossypii AGR259C
          Length = 804

 Score =  220 bits (560), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 126/377 (33%), Positives = 208/377 (55%), Gaps = 13/377 (3%)

Query: 198 AKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSI 257
           A  G V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 248 ATGGRVQTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGICYLRFDDTNPEAEAPEYFESI 307

Query: 258 LEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAY---CDDTPTEKMREERMDGI-- 312
              +  LG K  +ITYSSDYF Q+Y+L   +I+  K Y   C     ++ R  + DG   
Sbjct: 308 ERMVTWLGFKPWKITYSSDYFDQLYDLAEVLIQNNKGYVCHCTGEEIKRGRGIKEDGTPG 367

Query: 313 ----ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLT 368
               + + R+RS+ ENL  F  +M++G  +  +  +R K D  + +  + D + YR    
Sbjct: 368 GERKSCSHRERSITENLAAF-RKMRDGFYKPGEAILRMKQDLNSPSPQMWDLIAYRVLDA 426

Query: 369 PHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVHIWD 428
           PH RTG+ WK+YPTYDF   +VDS E +TH+L T E+      Y+W+ D +++ +    +
Sbjct: 427 PHPRTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 486

Query: 429 FARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 488
           + R+N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 487 YGRLNITGTVLSKRKIARLVNEKYVRGWDDPRLFTLEAIRRRGIPPGAILSFINTLGVTT 546

Query: 489 NVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMK-PKHKKNPAV 547
              N++     +  +K ++   AR   ++DP+++ +  +++P+  +  +  P     P  
Sbjct: 547 TTTNIQVVRFESAIRKYLEDTTARLMFLLDPIEVVV--NNLPEDYQELVTIPYRPGTPEF 604

Query: 548 GEKKVIYYKDIVIDKAD 564
           G++ V + K   I++ D
Sbjct: 605 GDRTVPFTKRFYIERTD 621

>TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  218 bits (554), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 128/377 (33%), Positives = 201/377 (53%), Gaps = 18/377 (4%)

Query: 166 SLTKSLQELKKVSNSGKKKETHKAN--------FEIDLPDAKMGEVVTRFPPEPSGYLHI 217
           S T S +  + + N G   + HKA           I+   A  G V TRFPPEP+GYLHI
Sbjct: 208 SKTASNEPKRTMFNEGFLGDLHKAGENPQAYPEMMIEHLKATGGRVQTRFPPEPNGYLHI 267

Query: 218 GHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDY 277
           GH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   +  LG K  ++TYSSDY
Sbjct: 268 GHSKAIMVNFGYAKYWNGVCYLRFDDTNPEAEAPEYFESIQRMVSWLGFKPWKVTYSSDY 327

Query: 278 FQQMYELCVKMIKEGKAY---CDDTPTEKMREERMDGI------ASARRDRSVEENLRIF 328
           F ++YEL   +IK  K Y   C     ++ R  + DG       A   RDR +EE+L+ F
Sbjct: 328 FDKLYELAEVLIKNDKGYICHCTAEEIKRGRGIKEDGTPGGERSACKHRDRPIEESLQEF 387

Query: 329 NEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHHRTGTTWKMYPTYDFCVP 388
              M+ G  +  +  +R K D  + +  + D + YR   +PH RTG  WK+YPTYDF   
Sbjct: 388 RN-MREGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNSPHPRTGDKWKIYPTYDFTHC 446

Query: 389 IVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVHIWDFARVNFVRTLLSKRKLQWMV 448
           +VDS E ++H+L T E+      Y+W+ D +++ +    ++ R+N   T+LSKRK+  +V
Sbjct: 447 LVDSFENISHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGRLNITGTVLSKRKIAKLV 506

Query: 449 DKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVIDP 508
           +   V  WDDPR  T        +    + +F+ + G + +  N++     +  +K ++ 
Sbjct: 507 EGSYVRGWDDPRLYTLEAIRRRGIPPGAILSFINTLGVTTSTTNIQVARFESAIRKFLED 566

Query: 509 VAARHTAIVDPVKIHLE 525
              R   I+DP+++ +E
Sbjct: 567 TTPRLMFILDPIEVIVE 583

>KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 804

 Score =  215 bits (548), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 130/384 (33%), Positives = 205/384 (53%), Gaps = 27/384 (7%)

Query: 198 AKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSI 257
           A  G+V TRFPPEP+GYLHIGH+KA ++N  FA+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 246 ATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGFAKYHNGVCYLRFDDTNPEAEAPEYFESI 305

Query: 258 LEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAY---CDDTPTEKMREERMDGI-- 312
              +  LG K  + TYSSDYF ++Y+L   +IK GKAY   C     ++ R  + DG   
Sbjct: 306 KSMVSWLGFKPWKTTYSSDYFDELYQLAETLIKNGKAYVCHCSAEEIKRGRGIKEDGTPG 365

Query: 313 ----ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLT 368
               A   R+R +EE+L  F + M++G  +  +  +R K D  + +  + D + YR    
Sbjct: 366 GERKACVSRERPIEESLTEFRK-MRDGFYKPGEAILRMKQDLNSPSPQMWDLIAYRVLDA 424

Query: 369 PHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVHIWD 428
           PH RTG  WK+YPTYDF   +VDSLE +TH+L T E+      Y+W+ D +++ +    +
Sbjct: 425 PHPRTGDKWKIYPTYDFTHCLVDSLENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 484

Query: 429 FARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 488
           + R+N   T+LSKRK+  +V  G VS W+DPR  T        +    + +F+ + G + 
Sbjct: 485 YGRLNITGTVLSKRKIAKLVTGGYVSGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 489 NVINLEWNLIWAFNKKVIDPVAARHTAIV--------DPVKIHLEGDDVPQTPKTEMKPK 540
           +  N++     +  +K ++    R   I+        +  +  +E  ++P  P T     
Sbjct: 545 STTNIQVVRFESAIRKYLEDTTPRLMFILDPVEVVVDNVDEDFVELCNIPYRPNT----- 599

Query: 541 HKKNPAVGEKKVIYYKDIVIDKAD 564
               P  G++ V + K   I+++D
Sbjct: 600 ----PEFGDRTVPFTKRFYIERSD 619

>NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON}
           Anc_7.100 YOL033W
          Length = 529

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 85/352 (24%), Positives = 142/352 (40%), Gaps = 68/352 (19%)

Query: 204 VTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLEL 263
           +TRF P P+G LH+G  + A+ N   A++  GK I+R +DT+ S+   E   +I E L+ 
Sbjct: 43  ITRFAPSPTGLLHLGSLRTALYNYLLARSTNGKFILRLEDTDQSRIHPEAISNIYETLKW 102

Query: 264 LGIKGDR-ITYSSDYFQQMYELCVKMIKEGKAY---CDDTPTEKMREERMDGIASARRDR 319
            GI  D      SD     ++    ++  G AY   C     E++R +  +   S   DR
Sbjct: 103 CGINYDEGFIKQSDRLPIYHKYIKILLDSGAAYHCFCTKDRLEQLRRKNSNTPNSPSYDR 162

Query: 320 S--------VEENL--------RIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 363
           +        VE NL        R+ + +      + L   V  +++ K       DP++ 
Sbjct: 163 NCYHLDTEIVESNLTANLPYTIRLKSPDRYPPFTDLLHGQVDIQLNQKERGVWFDDPILI 222

Query: 364 RCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRK 423
           + +             YPTY F   + D L G+TH +R  E+     ++      + L +
Sbjct: 223 KSD------------GYPTYHFANVVDDHLMGITHVIRGEEWLPSTPKH------VALYQ 264

Query: 424 VHIWDFARVNFVRTL-------LSKRKLQWMV----DKGLVS----------NWDDPRFP 462
           +  WD  +   +  L       LSKRK  + V    +KG++            W  PR  
Sbjct: 265 LFGWDMPKFIHIPLLTSIDDKKLSKRKGDFSVLSLKEKGVLPEALVNFCALLGWSPPRDI 324

Query: 463 TXXXXXXXXMT-VEGLRNFVLSQGPSRNVINLEWNLIWAFNK-----KVIDP 508
                    M  +E L N       ++  + +++  +W FNK     K+ DP
Sbjct: 325 AKANHECFTMNEIEKLFNL---NHLTKGNVKVDYKKLWFFNKHFLREKIKDP 373

>KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON}
           Anc_7.100 YOL033W
          Length = 517

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 97/218 (44%), Gaps = 26/218 (11%)

Query: 200 MGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILE 259
           +  VVTRF P P+G LH+G  + A+ N   A+   GK I+R +DT+  +   E + +IL+
Sbjct: 38  VAPVVTRFAPSPTGLLHLGSLRTALYNYLLAKNTGGKFILRLEDTDRKRYHAEAEQNILD 97

Query: 260 DLELLGIKGDRITY-SSDYFQQ-MYELCVKMIKEG----KAYCDDTPTEKMREERMDGIA 313
            L+   IK D   Y  SD  ++ +Y    + + +G    K +C       +REE  D   
Sbjct: 98  TLDWCHIKWDGPMYRQSDRAREGLYTRYAEQLVKGGFAYKCFCSKERLNNLREEGYDRHC 157

Query: 314 SARRDRSVEEN------LRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNL 367
           +   D+ V         +R    E+ +  ++ L   VR  I  +       DPV+ + + 
Sbjct: 158 THLSDQEVNAFQGTPYVIRFKAPEVYDAVDDLLHGSVR--IQPRRDRHGFDDPVLLKSD- 214

Query: 368 TPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEY 405
                       +PTY     + D L GVTH +R  E+
Sbjct: 215 -----------RFPTYHLANVVDDHLMGVTHVIRGEEW 241

>NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}
           Anc_7.100 YOL033W
          Length = 527

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 99/219 (45%), Gaps = 26/219 (11%)

Query: 203 VVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLE 262
           V+TRF P P+G LH+G  + A+ N   A+   GK I+R +DT+ ++   E   +I + L+
Sbjct: 46  VITRFAPSPTGLLHLGSLRTALYNYLLAKNTNGKFILRLEDTDQTRLHPEALKNIFDTLK 105

Query: 263 LLGIKGDRITYSSDYFQQMY-ELCVKMIKEGKAYCDDTPTEKMREERMDGIA--SARRDR 319
              ++ D           +Y E   K++K G AY      E++ + R   +A  S   DR
Sbjct: 106 WCNMEYDEGPIEQSQRLPIYQEYIKKLLKSGHAYYCFCSRERLEQLRTGNMAPGSLSYDR 165

Query: 320 SVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY-----RCNLTPHHRTG 374
                + +  E +K   ++G+   +R K          R P+I+       N+ P++R G
Sbjct: 166 KC---IHLDEETIKVNLDKGIPYTIRMK-------SPERYPLIHDLLHGELNIQPNNREG 215

Query: 375 TTW--------KMYPTYDFCVPIVDSLEGVTHALRTIEY 405
             +          +PTY F   + D L  VTH +R  E+
Sbjct: 216 MWFDDPILIKSDGFPTYHFANVVDDHLMKVTHVIRGEEW 254

>TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {ON}
           Anc_7.100 YOL033W
          Length = 558

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 124/275 (45%), Gaps = 48/275 (17%)

Query: 203 VVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLE 262
           V TRF P P+G++H+G  + A+ N   A++  G+ ++R +DT+  +  E  ++ I E L+
Sbjct: 46  VRTRFAPSPTGFMHLGSLRTALYNYLLAKSTGGQFLLRLEDTDQKRLVEGAEEDIYETLK 105

Query: 263 LLGIKGDR--ITYSSDY--FQQ-----MYELCVKMIKEG----KAYCDDTPTEKMRE--E 307
             GI+ D      S  Y  F+Q     +Y   +K++ E     K +C     ++M+E  +
Sbjct: 106 WCGIEYDEGPNVNSEAYGPFRQSERTKIYAKHIKVLLENGDAYKCFCTKERLDEMKESAQ 165

Query: 308 RMDGIASARRDRSV----EE------------NLRIFNEEMKNGTEEGLKNCVRAKIDYK 351
           +++  +SA  DR      EE             +R+ + E     E+ L   +  +I Y 
Sbjct: 166 KLNPPSSASYDRHCLHLNEEEIKQKELLNSPYTIRLKSPEKYPEFEDLLHGKLSIQIQYN 225

Query: 352 ALNKTLRDPVIYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQ 411
              KT  DP++ + +              PTY F   + D L  +TH +R  E+     +
Sbjct: 226 PHKKTYDDPILIKSD------------GLPTYHFANVVDDHLMKITHVIRGEEWLPSTPK 273

Query: 412 YDWMLDAMNLRK---VHIWDFARVNFVRTLLSKRK 443
           +  M +A+  +    +HI     +N  +  LSKRK
Sbjct: 274 HISMYNALGWQAPKYIHIPLLTSINDKK--LSKRK 306

>YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}
           MSE1Mitochondrial glutamyl-tRNA synthetase, predicted to
           be palmitoylated
          Length = 536

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 86/367 (23%), Positives = 150/367 (40%), Gaps = 60/367 (16%)

Query: 203 VVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLE 262
           V TRF P P+G+LH+G  + A+ N   A+   G+ ++R +DT+  +  E  +++I E L+
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIEGAEENIYEILK 104

Query: 263 LLGIKGDRITYSSDYFQQMYELCVK-MIKEGKAYCDDTPTEKMREERMDGI-----ASAR 316
              I  D         + +Y+  VK ++  GKAY      E++ + R   +     + A 
Sbjct: 105 WCNINYDETPIKQSERKLIYDKYVKILLSSGKAYRCFCSKERLNDLRHSAMELKPPSMAS 164

Query: 317 RDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHHRTGTT 376
            DR       +  EE+K+   +G+   VR K   +    T  D +  + NL P  +    
Sbjct: 165 YDRCCAH---LGEEEIKSKLAQGIPFTVRFKSPERY--PTFTDLLHGQINLQP--QVNFN 217

Query: 377 WKMY-----------PTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVH 425
            K Y           PTY     + D L G+TH +R  E+     ++  + +A       
Sbjct: 218 DKRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG----- 272

Query: 426 IW---DFARVNFVRTL----LSKR---------KLQWMVDKGLVS-----NWDDPRFPTX 464
            W    F  +  + T+    LSKR         K Q ++ + L++      W  PR    
Sbjct: 273 -WACPKFIHIPLLTTVGDKKLSKRKGDMSISDLKRQGVLPEALINFCALFGWSPPR--DL 329

Query: 465 XXXXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFN-----KKVIDPVAARHTAIVDP 519
                   ++E L       G ++    ++   +W FN     K++++P   R   +VD 
Sbjct: 330 ASKKHECFSMEELETIFNLNGLTKGNAKVDDKKLWFFNKHFLQKRILNPSTLRE--LVDD 387

Query: 520 VKIHLEG 526
           +   LE 
Sbjct: 388 IMPSLES 394

>Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 84/367 (22%), Positives = 147/367 (40%), Gaps = 60/367 (16%)

Query: 203 VVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLE 262
           V TRF P P+G+LH+G  + A+ N   A+  KG+ ++R +DT+  +     +++I E L+
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTKGQFLLRLEDTDQKRLVPGAEENIYEVLK 104

Query: 263 LLGIKGDRITYSSDYFQQMYELCVK-MIKEGKAYCDDTPTEKMREERMDGI-----ASAR 316
              I  D         + +Y+  VK ++  G AY      E++ + R   +     + A 
Sbjct: 105 WCKISYDETPVKQSERKSVYDKYVKILLSSGMAYRCFCSKERLNDLRRSAMELKPPSMAS 164

Query: 317 RDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHHRTGTT 376
            DR       +  EE+++   + +   VR K   +    T  D +    NL P  +    
Sbjct: 165 YDRCCAH---LAKEEIESKLAQDMPFTVRFKSPEQY--PTFTDVLHGEINLQP--QVNYN 217

Query: 377 WKMY-----------PTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVH 425
            + Y           PTY     + D L G+TH +R  E+     ++  + +A       
Sbjct: 218 DRRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG----- 272

Query: 426 IWDFARVNFVRTL-------LSKRKL---------QWMVDKGLVS-----NWDDPRFPTX 464
            WD+ +   +  L       LSKRK          Q ++ + LV+      W  PR    
Sbjct: 273 -WDYPKFIHIPLLTTVGDKKLSKRKGDMSISSLKNQGILPEALVNFCALFGWSPPR--DL 329

Query: 465 XXXXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNK-----KVIDPVAARHTAIVDP 519
                   ++E L       G ++    ++   +W FNK     ++ DPV  +   +VD 
Sbjct: 330 ASKKHECFSMEDLEKLFNLNGLTKGNAKVDDKKLWFFNKHFLQERISDPVMLKE--LVDG 387

Query: 520 VKIHLEG 526
           +   LE 
Sbjct: 388 IMPSLES 394

>TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {ON}
           Anc_7.100 YOL033W
          Length = 531

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/276 (23%), Positives = 120/276 (43%), Gaps = 50/276 (18%)

Query: 203 VVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLE 262
           V TRF P P+G LH+G  + A+ N   A+   G+ I+R +DT+  +  +  +++I   L+
Sbjct: 44  VRTRFAPSPTGSLHLGSLRTALYNYLLARNTGGQFILRIEDTDQKRLVKGAEENIYSSLK 103

Query: 263 LL---------GIKGDRITYSSDYFQQMYELCV-KMIKEGKAY---CDDTPTEKMRE--E 307
            L         GI G    Y       +Y+  + +++  GKAY   C       ++E  +
Sbjct: 104 WLGLQFDEGPNGINGPYGPYKQSERSSIYQKYINELLDNGKAYRCFCSKERLTGLKESAQ 163

Query: 308 RMDGIASARRDR--------SVEENL--------RIFNEEMKNGTEEGLKNCVRAKIDYK 351
           ++    +A  DR         +EENL        R+ + ++    E+ L   +  +  Y 
Sbjct: 164 KLKPPTTASYDRKCTNLTKSQIEENLKNKVPYTVRLLSPDLYPAFEDLLHGKLNIQPQYN 223

Query: 352 ALNKTLRDPVIYRC-NLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNA 410
           ++++   DPV+ +  NL             PTY F   + D L  ++H +R  E+     
Sbjct: 224 SIDRRFDDPVLMKSDNL-------------PTYHFANVVDDHLMKISHVIRGEEWLPSTP 270

Query: 411 QYDWMLDAMNLRK---VHIWDFARVNFVRTLLSKRK 443
           ++  + +A   +    +HI     +N  +  LSKRK
Sbjct: 271 KHIAIYEAFGWKPPKYIHIPLLTTLNDKK--LSKRK 304

>Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033W
           (REAL)
          Length = 532

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 78/323 (24%), Positives = 131/323 (40%), Gaps = 54/323 (16%)

Query: 145 VNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNSGKKKETHKANFEIDLPDAKMGEVV 204
           + + R +  L + PT G    SL KSL   K       K++ H ++            V 
Sbjct: 4   LRIPRRFYCLSLKPTKGVGPSSLNKSLLSRKT------KEDIHPSS-----------PVR 46

Query: 205 TRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLELL 264
           TRF P P+G+LH+G  + A+ N   A+   G+ ++R +DT+  +     +++I + L+  
Sbjct: 47  TRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIPGAEENIYDVLKWC 106

Query: 265 GIKGDRITYSSDYFQQMYELCVK-MIKEGKAYCDDTPTEKMREERMDGI-----ASARRD 318
            I  D         + +Y+  VK ++  G AY      E++ E R   +     + A  D
Sbjct: 107 KINYDETAVKQSERKPIYDKYVKILLSSGMAYRCFCSKERLNELRRSAMELKPPSMASYD 166

Query: 319 RSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHHRTGTTWK 378
           R       +  EE+ +   +G+   VR K   K       D +    NL P  +     +
Sbjct: 167 RCCS---YLGEEEVNSKLSQGMPFTVRFKSPEKY--PLFADLLHGEINLQP--QVNFNDR 219

Query: 379 MY-----------PTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVHIW 427
            Y           PTY     + D L G+TH +R  E+     ++  + +A        W
Sbjct: 220 RYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG------W 273

Query: 428 D---FARVNFVRTL----LSKRK 443
           D   F  +  + T+    LSKRK
Sbjct: 274 DCPKFIHIPLLTTVGDKKLSKRK 296

>Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {ON}
           complement(21668..23278) [1611 nt, 537 aa]
          Length = 536

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 71/300 (23%), Positives = 131/300 (43%), Gaps = 44/300 (14%)

Query: 200 MGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILE 259
           +  V TRF P P+G+LH+G  + A+ N   A+   G+ ++R +DT+  +  ++ +++I E
Sbjct: 38  ISPVRTRFAPSPTGFLHLGSLRTALYNYLLAKNTGGQFLLRLEDTDRKRLVKDAEENIYE 97

Query: 260 DLELLGIKGDRITYSSD-----YFQ----QMYELCV-KMIKEGKAYCDDTPTEKM----- 304
            L+  GI  D    S +     Y Q    ++Y+  + K++  G AY    P E++     
Sbjct: 98  SLKWCGIDYDEGPNSQNQQFGPYRQSDRTKIYQKYIDKLLDNGHAYRCFCPKERLDSLRD 157

Query: 305 REERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKID--YKALNKTLRDPVI 362
             +++    +   DR+    L + ++E++N    G+   VR K    Y   +  L   + 
Sbjct: 158 SAQKLQPPTTVSYDRNC---LHLNHDEIQNNINNGVSYTVRMKSPEIYPPFDDLLHGHIN 214

Query: 363 YRCNLTPHHRTGTTWKM-----YPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLD 417
            +  +  + R      +      PTY F   I D L  +TH +R  E+     ++  + +
Sbjct: 215 IQPQINSNDRRYDDPILMKSDNLPTYHFANVIDDHLMKITHVIRGEEWLPSTPKHIALYE 274

Query: 418 AM---NLRKVHIWDFARVNFVRTLLSKRK----LQWMVDKGLVS----------NWDDPR 460
           A    + + VH+      N  +  LSKRK    +  + DKG++            W  PR
Sbjct: 275 AFGWDSPKFVHLPLLTSTNDQK--LSKRKGDSSVLSLRDKGILPEALVNFSVLFGWSPPR 332

>CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033w MSE1
          Length = 532

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 77/340 (22%), Positives = 133/340 (39%), Gaps = 49/340 (14%)

Query: 203 VVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLE 262
            VTRF P P+G LH+G  + A+ N   A+   GK I+R +DT+ S+ K+   D+I   L+
Sbjct: 46  AVTRFAPSPTGMLHLGSLRTALYNYLLAKKTGGKFILRIEDTDRSRLKDGAMDNIYNSLK 105

Query: 263 LLGIKGDRITYSSDYFQQMYELCVK-MIKEGKAY---CDDTPTEKMREE--RMDGIASAR 316
              +K D   Y       +Y   +  +I+ G+AY   C     + +R+   R+    +  
Sbjct: 106 WCNLKWDEGPYLQSERTDIYRKHINHLIETGRAYRCFCTKERLDDLRQSALRLVPPTNVS 165

Query: 317 RDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHHRTG-- 374
            DR       +   E+K+  ++G+   VR K   K       D +  + +L P       
Sbjct: 166 YDRHCA---HLSEGEIKSKLDQGIPFTVRFKAPEKY--PPFEDLLHGKIDLQPQQNPSDI 220

Query: 375 -------TTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVHIW 427
                       YPTY     I D    ++H +R  E+     ++  + +A        W
Sbjct: 221 RYDDPILMKSDNYPTYHLANVIDDHDMKISHVIRGEEWLPSTPKHIALYEAFG------W 274

Query: 428 D---FARVNFVRTL----LSKR---------KLQWMVDKGLVS-----NWDDPRFPTXXX 466
           +   F  +  + T     LSKR         K Q ++ + LV+      W  PR      
Sbjct: 275 EPPKFTHLPLLTTTEDKKLSKRRNDMSVMSLKEQGILPEALVNFSVLFGWSPPR--ELAS 332

Query: 467 XXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVI 506
                 T++   N       ++    ++   +W FNK+ +
Sbjct: 333 KNHECFTLQEFENLFDLDSLTKGNAKVDMKKLWFFNKQFL 372

>TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.100
           YOL033W
          Length = 534

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 100/225 (44%), Gaps = 25/225 (11%)

Query: 203 VVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLE 262
           V TRF P P+G LHIG  + A+ N   A+  +G+ ++R +DT+ ++  +  +++I + L+
Sbjct: 41  VRTRFAPSPTGMLHIGSLRTALYNYLLAKNTRGQFLLRLEDTDQNRLIQGAEENIYDSLK 100

Query: 263 LLGIKGD-------------RITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKMRE--E 307
             GI+ D             R +  ++ +QQ  +  +K     + +C     + +RE  +
Sbjct: 101 WCGIEYDEGPGVNDEKFGPYRQSERTEIYQQHVDGLLKSGHAYRCFCSKERLDGLRESAK 160

Query: 308 RMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKID--YKALNKTLRDPVIYRC 365
           R+    +   DR  E    +   E++    + + + +R K    Y A +  L   V  + 
Sbjct: 161 RLKPPTTVTYDRKCES---LSQGEIEERLAQQIPHTIRLKAPERYPAFHDLLHGTVDIQP 217

Query: 366 NLTPHHRTGTTWKM-----YPTYDFCVPIVDSLEGVTHALRTIEY 405
            +  + R      +      PTY F   I D L  +TH +R  E+
Sbjct: 218 QVNVNDRRYDDPILIKSDNLPTYHFANVIDDHLMKITHVIRGEEW 262

>KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {ON}
           Anc_7.100 YOL033W
          Length = 514

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 93/232 (40%), Gaps = 27/232 (11%)

Query: 202 EVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDL 261
            VVTRF P P+G LHIG  + A+ N   A++  GK I+R +DT+ ++ K   +  I + L
Sbjct: 39  RVVTRFAPSPTGLLHIGSLRTALYNFLLARSTNGKFILRIEDTDRTRLKSGAEQDICDIL 98

Query: 262 ELLGIKGD-RITYSSDYFQQMYELCVKMIKEGKAY---CDDTPTEKMREERMDGIASARR 317
               +K D      SD      E   K+++ G AY   C       MR    D       
Sbjct: 99  NWCNLKYDVGPIRQSDRIPIYEEYANKLLETGAAYRCFCTKDRLSTMRAHGYDRHCLHLS 158

Query: 318 DRSVEE---------NLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLT 368
           D  V            LR+ +    +  ++ L   V   I  +       DP++ + +  
Sbjct: 159 DNDVRRLFDAGHTRPVLRLKSPNKYDSFQDMLHGTV--NIQERKDRVGFDDPILMKSD-- 214

Query: 369 PHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMN 420
                      +PTY F   + D L  VTH +R  E+     ++  +  A++
Sbjct: 215 ----------GFPTYHFANVVDDHLMEVTHVIRGDEWLPSTPKHIALYKALS 256

>Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 78/344 (22%), Positives = 132/344 (38%), Gaps = 57/344 (16%)

Query: 203 VVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLE 262
           V TRF P P+G LH+G  + A+ N   A+   G+ ++R +DT+  +     +  I + L 
Sbjct: 45  VRTRFAPSPTGLLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVPGAEKDIYDVLN 104

Query: 263 LLGIKGDRITYSSDYFQQMYELCVK-MIKEGKAYCDDTPTEKMREERMDGI-----ASAR 316
              I+ D         + +Y+  VK ++  G AY      E++ + R   +     + A 
Sbjct: 105 WCKIEYDETVVRQSERKLVYDKYVKILLSSGMAYRCFCSKERLNDLRHSAMELKPPSMAS 164

Query: 317 RDRSVEENLRIFNEEMKNGTEEGLKNCVRAKI--DYKALNKTLRDPVIYRCNLTPHHRTG 374
            DR       +  EE+ +   +G+   VR K    Y      L   V    NL P  +  
Sbjct: 165 YDRCCAH---LKEEEINSNLTQGIPFTVRFKSPEQYPVFTDLLHGEV----NLQP--QVN 215

Query: 375 TTWKMY-----------PTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRK 423
              K Y           PTY     + D L G+TH +R  E+     ++  + +A     
Sbjct: 216 FNDKRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG--- 272

Query: 424 VHIW---DFARVNFVRTL----LSKR---------KLQWMVDKGLVS-----NWDDPRFP 462
              W    F  +  + T+    LSKR         K Q ++ + L++      W  PR  
Sbjct: 273 ---WVCPKFIHIPLLTTVGDKKLSKRKGDMSISSLKKQGVLPEALINFCALFGWSPPR-- 327

Query: 463 TXXXXXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVI 506
                     ++E L N     G ++    ++   +W FNK  +
Sbjct: 328 DLASKRHECFSMEELENLFNLNGLTKGNAKVDDKKLWFFNKHFL 371

>Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AEL338C
          Length = 573

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 73/346 (21%), Positives = 135/346 (39%), Gaps = 61/346 (17%)

Query: 205 TRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLELL 264
           TRF P P+G+LH+G  + A+ N   A+   G+ ++R +DT+ ++     + ++ +  + L
Sbjct: 62  TRFAPSPTGFLHLGSLRTALFNYLLAKKTGGQFLLRLEDTDRTRLVPGSEQNLYDSFKWL 121

Query: 265 GIK-----GDRITY----SSDYFQQMYELCVKMIKEGKAYCDDTPTEKMREERMDGIA-- 313
           GI+     G   TY     SD  +   +   ++I  G AY      E+++  R   +A  
Sbjct: 122 GIQYDEGPGVNETYGPYRQSDRTEIYKKYSDQLISTGHAYRCFCSKERLKGLRDSAMALK 181

Query: 314 ---SARRDR----------------SVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALN 354
              +   DR                 V   +R+ + E+    E+ L N +  +     ++
Sbjct: 182 PPTNVTYDRHCAKLSKEDIRSKIKMGVPYTIRLKSPEIYEPFEDLLHNEINLQPQINPID 241

Query: 355 KTLRDPVIYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDW 414
               DP++ + +              PTY F   I D L  +TH +R  E+     ++  
Sbjct: 242 VRYDDPILIKSS------------GLPTYHFAHVIDDHLMEITHVIRGQEWLPATPKHIV 289

Query: 415 MLDAMNLRK---VHIWDFARVNFVRTLLSKRK----LQWMVDKGLVS----------NWD 457
           +  A        +H+   A  N  +  LSKRK    +Q + +KG++            W 
Sbjct: 290 LYKAFGWNPPQFIHLPLLASTNNKK--LSKRKGDTNIQQLREKGILPEALINFCVLFGWA 347

Query: 458 DPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNK 503
            P             ++  L N       ++    L+ + +W FNK
Sbjct: 348 PPSPEDPDRKQSYRFSLAELENLFNLNHLTKGNAKLDESRLWNFNK 393

>KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 542

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/289 (22%), Positives = 117/289 (40%), Gaps = 53/289 (18%)

Query: 203 VVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLE 262
           V TRF P P+G+LH+G  + A+ N   A+   G+ ++R +DT+  +     + S+ + L+
Sbjct: 51  VRTRFAPSPTGFLHMGSLRTALYNYLLAKNTGGEFLLRLEDTDQKRLVPGAEQSLYDALK 110

Query: 263 LLGIKGD------------RITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKMREE--- 307
              IK D            R +  +  +Q+     V+     K +C     + +RE    
Sbjct: 111 WCNIKYDEGPGVNEIYGPYRQSDRTKIYQEYINTLVEKGDAYKCFCSKERLDALRESAQK 170

Query: 308 -------RMDGIASARRDRSVEENLRI---FNEEMKNGTE-EGLKNCVRAKIDYK----A 352
                    D   S   D+ VE NL+    F    K+  +    ++ +  K+D +     
Sbjct: 171 LQPPTTVSYDRHCSKLSDQEVEANLKAGIPFTVRFKSPDKYPPFEDLLHGKLDIQPQVNP 230

Query: 353 LNKTLRDPVIYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQY 412
           L+    DP++ + +              PTY F   I D L  +TH +R  E+     ++
Sbjct: 231 LDIRYDDPILMKSD------------NLPTYHFANVIDDHLMKITHVIRGEEWLPSTPKH 278

Query: 413 DWMLDAMNLRKVHIWDFARVNFVRTL----LSKRK----LQWMVDKGLV 453
             + +A      H   +  +  + T     LSKRK    ++ M  KG++
Sbjct: 279 TALYEAYGWTPPH---YVHIPLLTTTSDKKLSKRKGDADVRAMRAKGIL 324

>AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL033W
           (MSE1)
          Length = 533

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/231 (22%), Positives = 93/231 (40%), Gaps = 42/231 (18%)

Query: 205 TRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLELL 264
           TRF P P+GYLH+G  + A+ N   A+   G+ ++R +DT+  +   + + +I + L+ L
Sbjct: 45  TRFAPSPTGYLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVSDAEQNIYDTLQWL 104

Query: 265 GIKGDR--------ITYSSDYFQQMYELCV-KMIKEGKAY---CDDTPTEKMREERM--- 309
           GI+ D           Y       +Y+    K++  G AY   C     E +R   M   
Sbjct: 105 GIQFDEGPGVNEVYGPYRQSDRSAIYKAHADKLLASGHAYRCFCSKERLENLRTSAMALQ 164

Query: 310 -----------DGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKT-- 356
                        ++    D  +++N+            E  ++ +  ++D +       
Sbjct: 165 PPTNVSYDRECANLSQEHIDHKLDQNVPFTLRFKSPAVYEPFEDLLHGRVDLQPQTNPND 224

Query: 357 LR--DPVIYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEY 405
           +R  DPV+ + +              PTY F   + D L  +TH +R  E+
Sbjct: 225 IRYDDPVLMKSD------------GLPTYHFANVVDDHLMKITHVIRGEEW 263

>KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 546

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 93/226 (41%), Gaps = 31/226 (13%)

Query: 205 TRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLELL 264
           TRF P P+G LHIG  + A+ N   A++  G  ++R +DT+ ++     + +I E L   
Sbjct: 47  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGSFLLRLEDTDQNRLVPGAEKNIYESLSWC 106

Query: 265 GIKGD-------------RITYSSDYFQQMYELCVKMIKEGKAY---CDDTPTEKMRE-- 306
           GI  D             R +  ++ +QQ      K++  G AY   C     + +RE  
Sbjct: 107 GIHYDEGPGVNDKKNGPFRQSDRTEIYQQYTN---KLLDSGHAYRCFCTKERLDGLRESA 163

Query: 307 ERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKID--YKALNKTLRDPVIYR 364
           +++    +A  DR       +   E++   ++ +   +R K    Y      L   +  +
Sbjct: 164 QKLQPPTTASYDRHCSH---LSEGEIREKLDQKVPFTIRLKSPERYPPFEDLLHGKLDMQ 220

Query: 365 CNLTPHHRTG-----TTWKMYPTYDFCVPIVDSLEGVTHALRTIEY 405
             + P+ R             PTY F   + D L  +TH +R  E+
Sbjct: 221 PQVNPNDRRYDDPILVKSDALPTYHFANVVDDHLMDITHVVRGEEW 266

>Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {ON}
           YOL033W (MSE1) - Mitochondrial glutamyl-tRNA synthetase
           [contig 47] FULL
          Length = 567

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/241 (21%), Positives = 98/241 (40%), Gaps = 33/241 (13%)

Query: 205 TRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLELL 264
           TRF P P+G LHIG  + A+ N   A++  G+ ++R +DT+  +     ++SI E L+  
Sbjct: 54  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGEFLLRLEDTDQKRLVPGAEESIYESLKWC 113

Query: 265 GI-----------------KGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKMRE- 306
           G+                 + DR      Y  ++ +L V      + +C     + +R+ 
Sbjct: 114 GLSFDEGPGVNDAEFGPFRQSDRTKIYQSYINKLLDLGVAY----RCFCPKERLDNLRDS 169

Query: 307 -ERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKI--DYKALNKTLRDPVIY 363
            +++    +   DR    +     E+++   ++ +   VR K    Y      L   +  
Sbjct: 170 AQKLQPPTTVSYDRHCAHH---STEKIQEQLDQKIPFTVRLKSPQKYPPFEDLLHGSIDM 226

Query: 364 RCNLTPH-HRTGTTWKM----YPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDA 418
           +  + P+  R      M     PTY F   + D L  +TH +R  E+     ++  + +A
Sbjct: 227 QPQVNPNDMRYDDPILMKSDGLPTYHFANVVDDHLMKITHVVRGEEWLPSTPKHIALYNA 286

Query: 419 M 419
            
Sbjct: 287 F 287

>SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} similar
           to uniprot|P48525 Saccharomyces cerevisiae YOL033W MSE1
           Mitochondrial glutamyl-tRNA synthetase encoded by a
           nuclear gene
          Length = 554

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/278 (21%), Positives = 111/278 (39%), Gaps = 54/278 (19%)

Query: 203 VVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLE 262
           V TRF P P+G LH+G  + A+ N   A++  G+ ++R +DT+  +     + +I + L+
Sbjct: 61  VRTRFAPSPTGLLHMGSLRTALYNYLLARSTGGQFLLRLEDTDQKRLVPGAEQNIYDSLK 120

Query: 263 LLGIKGDR---------ITYSSDYFQQMYELCVK-MIKEGKAY---CDDTPTEKMRE--E 307
             G++ D            Y      ++Y+  +K ++  G AY   C     + +R   +
Sbjct: 121 WCGVEYDEGPGVNEDKFGPYRQSDRTEIYQHYIKQLLNSGHAYRCFCSKERLDGLRSSAQ 180

Query: 308 RMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKI--DYKALNKTLR------- 358
           ++    +A  DR   E   +  +E+    ++G+   VR K    Y      L        
Sbjct: 181 QLQPPTTASYDRHCTE---LTEDEIAENLKKGVPCTVRLKAPKKYPPFEDLLHGQLDMQI 237

Query: 359 ----------DPVIYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDR 408
                     DP++ + +              PTY F   + D L  +TH +R  E+   
Sbjct: 238 QINMNDIRYDDPILMKSD------------GLPTYHFANVVDDHLMRITHVIRGEEWLPS 285

Query: 409 NAQYDWMLDAMNLRK---VHIWDFARVNFVRTLLSKRK 443
             ++  + +A        +HI      N  +  LSKRK
Sbjct: 286 TPKHIALYNAFGWNPPQFIHIPLLTSTNDKK--LSKRK 321

>ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 533

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 96/233 (41%), Gaps = 42/233 (18%)

Query: 203 VVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDL- 261
           V TRF P P+G LH+G  + A+ N   A+   G+ I+R +DT+ S+  E  +++I + L 
Sbjct: 40  VRTRFAPSPTGLLHMGSLRTALYNYLLAKNTGGQFILRLEDTDQSRLVEGAEENIYDSLR 99

Query: 262 -------ELLGIKGDRITYSSDYFQQMYELCV-KMIKEGKAY---CDDTPTEKMRE--ER 308
                  E   + G    Y      ++Y   +  +++ G AY   C     E +RE   +
Sbjct: 100 WCKLHYDEGPMVGGPFGPYRQSERTEIYRSYIGTLLESGHAYRCFCPKERLEDLRESARK 159

Query: 309 MDGIASARRDR--------SVEENL--------RIFNEEMKNGTEEGLKNCVRAKIDYKA 352
           +    +A  DR         +++NL        R+   E     ++ L   +  +    A
Sbjct: 160 LQPPTTASYDRHCAHMSPHEIKQNLDNDVAYTIRLRAPEKYPIIQDLLHGTLDIQPQVNA 219

Query: 353 LNKTLRDPVIYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEY 405
            +    DP++ + +              PTY F   I D L  +TH +R  E+
Sbjct: 220 NDVRYDDPILVKSD------------NLPTYHFANVIDDHLMEITHVIRGEEW 260

>Smik_12.469 Chr12 complement(820772..823459) [2688 bp, 895 aa] {ON}
           YLR382C (REAL)
          Length = 895

 Score = 35.0 bits (79), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 174 LKKVSNSGKK--KETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQ 231
           +KK+   GKK  ++T +   E D P      ++ +FP  PSG LHIGH +  +++    +
Sbjct: 21  VKKLIAIGKKWKQKTIRGPIEHDTPKKGSKYILCQFP-YPSGALHIGHLRVYVISDSLNR 79

Query: 232 AYKGK 236
            YK +
Sbjct: 80  FYKQR 84

>ABL087W Chr2 (236014..236877) [864 bp, 287 aa] {ON} NOHBY208; No
           homolog in Saccharomyces cerevisiae
          Length = 287

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 25/57 (43%)

Query: 228 YFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYEL 284
           Y    Y   LI+ F  T  S E          D+E L  KG ++  S DY +Q+ E+
Sbjct: 13  YIVVTYVLPLILTFHTTYESNELSRHIAKGYSDMEALQFKGSQVIKSEDYLRQLEEV 69

>TBLA0I02880 Chr9 complement(680214..682892) [2679 bp, 892 aa] {ON}
           Anc_4.236 YLR382C
          Length = 892

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 59/144 (40%), Gaps = 29/144 (20%)

Query: 209 PEPSGYLHIGHAKAAILNQYFAQAYK--GKLIIR---FD-------------DTNPS--- 247
           P PSG LH+GH +  +++   ++ YK  G  +I    +D             D NPS   
Sbjct: 66  PYPSGVLHLGHLRVYVISDSLSRFYKQRGYDVIHPMGWDAFGLPAENAAIDRDCNPSTWT 125

Query: 248 -----KEKEEFQDSILE---DLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDT 299
                K KE+ ++ +     D EL     D   ++   F ++Y+  +   KE +   D  
Sbjct: 126 YDNIAKMKEQMKNMLANFDWDRELTTCSKDYYKFTQMIFLELYKHGLAYHKEAEINWDPV 185

Query: 300 PTEKMREERMDGIASARRDRSVEE 323
               +  E++D    + R  ++ E
Sbjct: 186 DKTVLANEQVDSTGHSWRSGALVE 209

>AFR527W Chr6 (1382320..1382733) [414 bp, 137 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR236W (TAF9)
          Length = 137

 Score = 30.4 bits (67), Expect = 6.6,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 7/62 (11%)

Query: 617 EDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADLNVKDMK--VGDIIQFE 674
           ED VP+ L+DF H  ++  L++   + ++       + SA ADL V+D++  +G   Q++
Sbjct: 27  EDQVPLQLMDFAHRYTRGVLKDAMMYNEYAN-----NGSAPADLTVEDVRLAIGSRTQYQ 81

Query: 675 RK 676
            K
Sbjct: 82  FK 83

>TPHA0J02450 Chr10 (539862..544334) [4473 bp, 1490 aa] {ON} Anc_6.229
            YGL131C
          Length = 1490

 Score = 32.0 bits (71), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 41   DKKSAPSVFNGSSDSTFLKIIEGFPEIFTESN 72
            +  S PS+FNGS  S+ +K    +   FTESN
Sbjct: 1070 NNSSEPSIFNGSDISSIMKFYHCYNPSFTESN 1101

>Kpol_1052.3 s1052 (7826..12508) [4683 bp, 1560 aa] {ON}
           (7826..12508) [4683 nt, 1561 aa]
          Length = 1560

 Score = 31.6 bits (70), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 47/104 (45%), Gaps = 19/104 (18%)

Query: 82  IANEELVVKNFQ--------KLSESLGK---LDAQLNLRTFI----LGGLKYSAADIACW 126
           I N++L + N+Q        KL+E L     LDA L+    I    L  +K     +  W
Sbjct: 2   IINDQLPIVNYQRADPKSLLKLTEKLANDSYLDAYLSSHQLIILERLLSIKDEDKKLMIW 61

Query: 127 GALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKS 170
             L    M G+IL N V+V   +  +++E +P   +   S TKS
Sbjct: 62  NEL----MNGNILLNVVNVESGQKDAIIETNPENNTSSNSTTKS 101

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 80,537,805
Number of extensions: 3756009
Number of successful extensions: 12348
Number of sequences better than 10.0: 77
Number of HSP's gapped: 12640
Number of HSP's successfully gapped: 77
Length of query: 709
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 592
Effective length of database: 40,065,477
Effective search space: 23718762384
Effective search space used: 23718762384
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)