Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0I032403.567ON56353823330.0
NCAS0E002603.567ON55854116310.0
YGL244W (RTF1)3.567ON55854415170.0
Smik_7.173.567ON56554615140.0
Skud_7.233.567ON56454514900.0
Suva_7.173.567ON56955014540.0
ZYRO0E09526g3.567ON56054414450.0
TDEL0D063503.567ON56555314280.0
KNAG0I002303.567ON57156014260.0
KAFR0J028803.567ON55548713930.0
Kpol_507.103.567ON46146613810.0
TPHA0A060003.567ON54948613790.0
CAGL0H07711g3.567ON56655013640.0
KLTH0G00726g3.567ON56149013570.0
AFR266W3.567ON56255613391e-180
TBLA0E002203.567ON57055513221e-177
Ecym_25973.567ON56250313131e-176
Kwal_47.192653.567ON56751312841e-171
KLLA0A00737g3.567ON58249912171e-161
SAKL0F00814g3.567ON57433311171e-146
YNL254C (RTC4)1.106ON40170761.0
SAKL0E02618gsingletonON27377713.9
SAKL0E02684g2.486ON27377688.6
Kpol_1054.581.530ON40175688.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0I03240
         (563 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0I03240 Chr9 complement(760626..762317) [1692 bp, 563 aa] {O...   903   0.0  
NCAS0E00260 Chr5 (38732..40408) [1677 bp, 558 aa] {ON} Anc_3.567...   632   0.0  
YGL244W Chr7 (41498..43174) [1677 bp, 558 aa] {ON}  RTF1Subunit ...   588   0.0  
Smik_7.17 Chr7 (36297..37994) [1698 bp, 565 aa] {ON} YGL244W (REAL)   587   0.0  
Skud_7.23 Chr7 (45674..47368) [1695 bp, 564 aa] {ON} YGL244W (REAL)   578   0.0  
Suva_7.17 Chr7 (36045..37754) [1710 bp, 569 aa] {ON} YGL244W (REAL)   564   0.0  
ZYRO0E09526g Chr5 complement(758296..759978) [1683 bp, 560 aa] {...   561   0.0  
TDEL0D06350 Chr4 complement(1140059..1141756) [1698 bp, 565 aa] ...   554   0.0  
KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567...   553   0.0  
KAFR0J02880 Chr10 complement(547671..549338) [1668 bp, 555 aa] {...   541   0.0  
Kpol_507.10 s507 (57107..58492) [1386 bp, 461 aa] {ON} (57107..5...   536   0.0  
TPHA0A06000 Chr1 complement(1356928..1358577) [1650 bp, 549 aa] ...   535   0.0  
CAGL0H07711g Chr8 (752900..754600) [1701 bp, 566 aa] {ON} highly...   530   0.0  
KLTH0G00726g Chr7 (49910..51595) [1686 bp, 561 aa] {ON} similar ...   527   0.0  
AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic ho...   520   e-180
TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567...   513   e-177
Ecym_2597 Chr2 complement(1160898..1162586) [1689 bp, 562 aa] {O...   510   e-176
Kwal_47.19265 s47 complement(1162019..1163722) [1704 bp, 567 aa]...   499   e-171
KLLA0A00737g Chr1 (72233..73981) [1749 bp, 582 aa] {ON} similar ...   473   e-161
SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar ...   434   e-146
YNL254C Chr14 complement(168043..169248) [1206 bp, 401 aa] {ON} ...    34   1.0  
SAKL0E02618g Chr5 complement(210003..210824) [822 bp, 273 aa] {O...    32   3.9  
SAKL0E02684g Chr5 complement(214237..215058) [822 bp, 273 aa] {O...    31   8.6  
Kpol_1054.58 s1054 (144394..145599) [1206 bp, 401 aa] {ON} (1443...    31   8.8  

>NDAI0I03240 Chr9 complement(760626..762317) [1692 bp, 563 aa] {ON}
           Anc_3.567 YGL244W
          Length = 563

 Score =  903 bits (2333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/538 (83%), Positives = 449/538 (83%)

Query: 26  TTSGKRAKNHDQVGSKRKKIXXXXXXXXXXXXXYNPYGGNQSEEEEIDEPNPFPLENKYK 85
           TTSGKRAKNHDQVGSKRKKI             YNPYGGNQSEEEEIDEPNPFPLENKYK
Sbjct: 26  TTSGKRAKNHDQVGSKRKKIEVDSEAEEEEEDDYNPYGGNQSEEEEIDEPNPFPLENKYK 85

Query: 86  DEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKXXXXXXXXXXXGKKTR 145
           DEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIK           GKKTR
Sbjct: 86  DEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKEQQERNELEEEGKKTR 145

Query: 146 SSTRATHATGHSDXXXXXXXXXXXXRERKTRXXXXXXXXXXXXXXXXXXXXNYKHXXXXX 205
           SSTRATHATGHSD            RERKTR                    NYKH     
Sbjct: 146 SSTRATHATGHSDLKASKLSQLKKQRERKTRDQDYNDVEDEDDLDDYAPDDNYKHEDSEY 205

Query: 206 XXXXXXXXXXYNPYATRKSYDMDKDEVEWAEEQTDREAELDDFNKVKVGRSFIAKYCFYP 265
                     YNPYATRKSYDMDKDEVEWAEEQTDREAELDDFNKVKVGRSFIAKYCFYP
Sbjct: 206 EEEGEEDEEDYNPYATRKSYDMDKDEVEWAEEQTDREAELDDFNKVKVGRSFIAKYCFYP 265

Query: 266 GFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDFFTNQYLGVTQGHDRK 325
           GFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDFFTNQYLGVTQGHDRK
Sbjct: 266 GFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDFFTNQYLGVTQGHDRK 325

Query: 326 VLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQAFVSEPLTAKMTDAI 385
           VLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQAFVSEPLTAKMTDAI
Sbjct: 326 VLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQAFVSEPLTAKMTDAI 385

Query: 386 VRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQLRNLEKRMSVYEKHH 445
           VRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQLRNLEKRMSVYEKHH
Sbjct: 386 VRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQLRNLEKRMSVYEKHH 445

Query: 446 ENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKEDHGLDSKSDPFSRLKTRTKIYYQEVX 505
           ENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKEDHGLDSKSDPFSRLKTRTKIYYQEV 
Sbjct: 446 ENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKEDHGLDSKSDPFSRLKTRTKIYYQEVQ 505

Query: 506 XXXXXXXXXXXXXXXXXLQENKALNEHKEKELLLARFKRLGGLENLIQNLDINVTFDI 563
                            LQENKALNEHKEKELLLARFKRLGGLENLIQNLDINVTFDI
Sbjct: 506 KEENEKAQAMAEAKQKQLQENKALNEHKEKELLLARFKRLGGLENLIQNLDINVTFDI 563

>NCAS0E00260 Chr5 (38732..40408) [1677 bp, 558 aa] {ON} Anc_3.567
           YGL244W
          Length = 558

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/541 (63%), Positives = 388/541 (71%), Gaps = 10/541 (1%)

Query: 26  TTSGKRAKNHDQVGSKRKKIXXXXXXXXXXXXXYNPYG-GNQSEEEEIDEPNPFPLENKY 84
           TTS KRAKNH+   SKRKKI                +G GN SEEEE  E NPFPLE KY
Sbjct: 25  TTSNKRAKNHEHASSKRKKIEVDSEAEEEDDYDPGNFGAGNISEEEEEMEQNPFPLEGKY 84

Query: 85  KDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKXXXXXXXXXXXGKKT 144
           KDE DRE LESLPEMERETLLFERSQ MRKYQERKLFRERQRN+K           G KT
Sbjct: 85  KDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLKEQQQRNAPSEEGTKT 144

Query: 145 RSSTRATHATGHSDXXXXXXXXXXXXRERKT--RXXXXXXXXXXXXXXXXXXXXNYKHXX 202
           R+STR THATGHSD            RERK   R                     YK   
Sbjct: 145 RTSTRTTHATGHSDLKASKLSQLKKQRERKGLHRRGSDEEGSEFEEEEEEYDEEEYKKDE 204

Query: 203 XXXXXXXXXXXXXYNPYATRKSYDMDKDEVEWAEEQTDREAELDDFNKVKVGRSFIAKYC 262
                           Y+  K+     DEVEWAEEQTDRE ELDDFNKVK+GRSF+AKYC
Sbjct: 205 DSEYEEEYNPYERKGRYSEDKN-----DEVEWAEEQTDRETELDDFNKVKIGRSFVAKYC 259

Query: 263 FYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDFFTNQYLGVTQGH 322
           FYPGF++L+KGCYG+VNVGTDRRTG +SYRMVKIEK+FL+ PYRMG+FFTNQY GVTQG 
Sbjct: 260 FYPGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIFLQKPYRMGEFFTNQYFGVTQGS 319

Query: 323 DRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQAFVSEPLTAKMT 382
           +RKV QMN FSDGLFT  EF+RY R+L+ SH+TKPSI+ L+ K+KEIQ+F+SEPLT ++ 
Sbjct: 320 NRKVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSIYTLKNKAKEIQSFISEPLTEQLM 379

Query: 383 DAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQLRNLEKRMSVYE 442
           D IVRNRM+FNKKLSGTNAVLEKTVL+DKLRYA+ENNNERDVAKYSSQLRNLEKR+SVYE
Sbjct: 380 DTIVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDVAKYSSQLRNLEKRLSVYE 439

Query: 443 KHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKEDHGLDSKSDPFSRLKTRTKIYYQ 502
           KHHENDQ+G NKLGALTSKNRKVNMDKI+N  H KKE+ G DSKSDPFSRLKTRTKIYYQ
Sbjct: 440 KHHENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKKEEIGFDSKSDPFSRLKTRTKIYYQ 499

Query: 503 EVXXXXXXXXXXXXXXXXXXLQENKALNEHKEKELLLARFKRLGGLENLIQNLDINVTFD 562
           EV                  L+EN      KE ELLLA+F+RLGGLEN+I +L+++V FD
Sbjct: 500 EV--QQEENEKAKALAAEKQLKENNEAQARKENELLLAKFRRLGGLENMINSLNLDVNFD 557

Query: 563 I 563
           I
Sbjct: 558 I 558

>YGL244W Chr7 (41498..43174) [1677 bp, 558 aa] {ON}  RTF1Subunit of
           RNAPII-associated chromatin remodeling Paf1 complex;
           regulates gene expression by directing cotranscriptional
           histone modification, influences transcription and
           chromatin structure through several independent
           functional domains; directly or indirectly regulates
           DNA-binding properties of Spt15p and relative activities
           of different TATA elements; involved in transcription
           elongation as demonstrated by the G-less-based run-on
           (GLRO) assay
          Length = 558

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/544 (57%), Positives = 374/544 (68%), Gaps = 19/544 (3%)

Query: 26  TTSGKRAKNHDQVGSKRKKIXXXXXXXXXXXXXYNPYG-GNQ---SEEEEIDEPNPFPLE 81
           TTS KRAKN+DQ  SK+++I             YNPY  GN    SEEEE  E NPFPLE
Sbjct: 26  TTSAKRAKNNDQSLSKKRRIEVGSVEDDDEEDDYNPYSVGNADYGSEEEE--EANPFPLE 83

Query: 82  NKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKXXXXXXXXXXXG 141
            KYKDE DREHLESLPEMERETLLFERSQ+M+KYQERKLFR R R++K            
Sbjct: 84  GKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAKNDEDS 143

Query: 142 KKTRSSTRATHATGHSDXXXXXXXXXXXXRERKTRXXXXXXXXXXXXXXXXXXXXNYKHX 201
           +KTR+STR+THATGHSD            R RK R                    +YK  
Sbjct: 144 RKTRASTRSTHATGHSDIKASKLSQLKKQRARKNRHYSDNEDEDDEEDYREE---DYKDD 200

Query: 202 XXXXXXXXXXXXXXYNPYATRKSYDM-DKDEVEWAEEQTDREAELDDFNKVKVGRSFIAK 260
                         YNP+  R +YD  ++ E    E++ DRE E+ DFNK+++GRSF+AK
Sbjct: 201 EGSEYGDDEE----YNPFDRRDTYDKREEVEWAEEEDEQDREPEISDFNKLRIGRSFVAK 256

Query: 261 YCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDFFTNQYLGVTQ 320
           +CFYPGF D +KGCYGRVNVGTD+RTG +SYRMV+IE+VFL+ PY MG F+TNQY GVTQ
Sbjct: 257 FCFYPGFEDAVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFGVTQ 316

Query: 321 GHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQAFVSEPLTAK 380
           G DRKV QMN FSDGLF   E+ RY RAL+NS + KPS+H L  K+KE+  FV+ PLT K
Sbjct: 317 GKDRKVFQMNYFSDGLFAEDEYQRYLRALDNSQMIKPSLHSLSNKTKEVMDFVNTPLTDK 376

Query: 381 MTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQLRNLEKRMSV 440
            TD +VR+RM FNKKLSGTNAVLEKTVL++KL+YA+E NNE+D+AKYS+QLRN EKRMSV
Sbjct: 377 TTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMSV 436

Query: 441 YEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKED-HGLDSKSDPFSRLKTRTKI 499
           YEKHHENDQ  + KLG LTSKNRK+NM  IRNAEH+KKED +  DSKSDPFSRLKTRTK+
Sbjct: 437 YEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDSNNFDSKSDPFSRLKTRTKV 496

Query: 500 YYQEVXXXXXXXXXXXXXXXXXXLQENKALNEHKEKELLLARFKRLGGLENLIQNLDINV 559
           YYQE+                  LQE+K   + +EKELL+A+F+RLGGLE ++  LDI  
Sbjct: 497 YYQEI--QKEENAKAKEIAQQEKLQEDKDAKDKREKELLVAQFRRLGGLERMVGELDIK- 553

Query: 560 TFDI 563
            FD+
Sbjct: 554 -FDL 556

>Smik_7.17 Chr7 (36297..37994) [1698 bp, 565 aa] {ON} YGL244W (REAL)
          Length = 565

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/546 (56%), Positives = 370/546 (67%), Gaps = 18/546 (3%)

Query: 26  TTSGKRAKNHDQVGSKRKKIX-----XXXXXXXXXXXXYNPYG-GNQS-EEEEIDEPNPF 78
           TTS KRAKN+DQ  SK+++I                  YNPY  GN S   EE++EPNPF
Sbjct: 26  TTSAKRAKNNDQSLSKKRRIEVGNAEEDDEEDEDEEDDYNPYSVGNASYGSEEVEEPNPF 85

Query: 79  PLENKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKXXXXXXXXX 138
           PLE KYK+E DREHLESLPEMERETLLFERSQ+M+KYQERKLFR R R++K         
Sbjct: 86  PLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAKND 145

Query: 139 XXGKKTRSSTRATHATGHSDXXXXXXXXXXXXRERKTRXXXXXXXXXXXXXXXXXXXXNY 198
              +KTR+STR+THATGHSD            R RK R                      
Sbjct: 146 EDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNRHYSDNEGEVDDEDEYR------ 199

Query: 199 KHXXXXXXXXXXXXXXXYNPYATRKSYD--MDKDEVEWAEEQTDREAELDDFNKVKVGRS 256
           +                YNP+     YD   ++ E    E++ DRE E+ DFNKV++GRS
Sbjct: 200 EDDYKDDEGSEYGDDEEYNPFDRGDLYDKREEEVEWAEEEDELDREPEISDFNKVRIGRS 259

Query: 257 FIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDFFTNQYL 316
           F+AK+CFYPGF D++KGCYGRVNVGTD+RTG +SYRMV+IE+VFL+ PY MG F+TNQY 
Sbjct: 260 FVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYF 319

Query: 317 GVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQAFVSEP 376
           GVTQG DRKV QMN FSDGLF   E+ RY RAL+NS + KPS+H L  K+KE+  FV+ P
Sbjct: 320 GVTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNKTKEVMDFVNTP 379

Query: 377 LTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQLRNLEK 436
           LT K TD +VR+RM FNKKLSGTNAVLEKTVL++KL+YA+E NNE+D+AKYS+QLRN EK
Sbjct: 380 LTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEK 439

Query: 437 RMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKED-HGLDSKSDPFSRLKT 495
           RMSVYEKHHENDQ  + KLG LTSKNRK+NM  IRNAEH+KKED +  DSKSDPFSRLKT
Sbjct: 440 RMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNFDSKSDPFSRLKT 499

Query: 496 RTKIYYQEVXXXXXXXXXXXXXXXXXXLQENKALNEHKEKELLLARFKRLGGLENLIQNL 555
           RTK+YYQE+                  LQE+K   E +EKELLLA+F+RLGGLE +I  L
Sbjct: 500 RTKVYYQEI--QKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRLGGLERMIGEL 557

Query: 556 DINVTF 561
           DI   F
Sbjct: 558 DIKFDF 563

>Skud_7.23 Chr7 (45674..47368) [1695 bp, 564 aa] {ON} YGL244W (REAL)
          Length = 564

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/545 (55%), Positives = 369/545 (67%), Gaps = 17/545 (3%)

Query: 26  TTSGKRAKNHDQVGSKRKKIXXXXXXXXXXXXX----YNPYG-GNQSEEEEIDEPNPFPL 80
           +TS KRAKN+DQ  SK+++I                 YNPY  GN     E +E NPFPL
Sbjct: 26  STSAKRAKNNDQSVSKKRRIEVDSAEEEDEEDEEEDDYNPYSVGNAGYGSEGEEANPFPL 85

Query: 81  ENKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKXXXXXXXXXXX 140
           E K+KDE+DREHLESLPEMERETLLFERSQ+M+KYQERKLFR R R++K           
Sbjct: 86  EGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAKDKED 145

Query: 141 GKKTRSSTRATHATGHSDXXXXXXXXXXXXRERKTRXXXXXXXXXXXXXXXXXXXXNYKH 200
            +KTR+STR+THATGHSD            R RK R                    NYK+
Sbjct: 146 SRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNRQYSDNEDEEDDEDEYRED--NYKN 203

Query: 201 XXXXXXXXXXXXXXXYNPYATRKSYD---MDKDEVEWAEEQTDREAELDDFNKVKVGRSF 257
                           NP+  +  YD    + +  E  E++ DRE E+ D+NK+++GRSF
Sbjct: 204 EEESEYEDDEEY----NPFDRKDLYDKREEEVEWAEEGEDELDREPEISDYNKLRIGRSF 259

Query: 258 IAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDFFTNQYLG 317
           +AK+CFYPGF D++KGCYGRVN+GTD+RTG +SYRMV+IE+VFL+ PY MG F+TNQY G
Sbjct: 260 VAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFYTNQYFG 319

Query: 318 VTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQAFVSEPL 377
           VTQG DRKV QMN FSDG F   E+ RY +AL+NSH+ KPS+H L  K+KE+  FV+ PL
Sbjct: 320 VTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMDFVNTPL 379

Query: 378 TAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQLRNLEKR 437
           T K TD +VR+RM FNKKLSGTNAVLEKTVL++KL+YA+E NNE+D+AKYS+QLRN EKR
Sbjct: 380 TDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKR 439

Query: 438 MSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKEDHG-LDSKSDPFSRLKTR 496
           MS+YEKHHENDQ  +  LG LTSKNRK+NM  IRNAEH+KKED+   DSKSDPFSRLKTR
Sbjct: 440 MSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPFSRLKTR 499

Query: 497 TKIYYQEVXXXXXXXXXXXXXXXXXXLQENKALNEHKEKELLLARFKRLGGLENLIQNLD 556
           TK+YYQE+                  LQE+K   + +EKELLLA+F+RLGGLE +I  LD
Sbjct: 500 TKVYYQEI--QKEENAKAKEIAQQEKLQEDKEAKDKREKELLLAQFRRLGGLERMIGELD 557

Query: 557 INVTF 561
           I   F
Sbjct: 558 IKFDF 562

>Suva_7.17 Chr7 (36045..37754) [1710 bp, 569 aa] {ON} YGL244W (REAL)
          Length = 569

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/550 (55%), Positives = 372/550 (67%), Gaps = 22/550 (4%)

Query: 26  TTSGKRAKNHDQVGSKRKKIXXXXXXXXXXXXX----YNPYG----GNQSEEEEIDEPNP 77
           +TS KRAKN+DQ  SK+++I                 YNPY     G  SEEEE  EPNP
Sbjct: 26  STSAKRAKNNDQSISKKRRIEVGSAEEEEEEDEEEDDYNPYSVGNTGYGSEEEEEVEPNP 85

Query: 78  FPLENKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKXXXXXXXX 137
           FPLE KYKDE DREHLESLPEMERETLLFERSQ+M+KYQERKLFR R +++K        
Sbjct: 86  FPLEGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQQQRKRA 145

Query: 138 X--XXGKKTRSSTRATHATGHSDXXXXXXXXXXXXRERKTRXXXXXXXXXXXXXXXXXXX 195
                 +KTR+STR+THATGHSD            R RK R                   
Sbjct: 146 RDDEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNRQYSDSEDEQDDQEEYRED- 204

Query: 196 XNYKHXXXXXXXXXXXXXXXYNPYATRKSYD---MDKDEVEWAEEQTDREAELDDFNKVK 252
            +YK+               YNP+  +  YD    + +  E  E++ DR+ E+ DFNK++
Sbjct: 205 -DYKNDEGSEYGDDEE----YNPFDRKGVYDKREEEVEWAEEEEDELDRDPEISDFNKLR 259

Query: 253 VGRSFIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDFFT 312
           +GRSF+AK+CFYPGF D++KGCYGRVNVGTD+RTG +SYRMV+IE++FL+ PY MG FFT
Sbjct: 260 IGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMGKFFT 319

Query: 313 NQYLGVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQAF 372
           NQY GVTQG DRKV QMN FSDGLFT  E+ RY +AL+ SH+ KPS+H L  K+KE+  F
Sbjct: 320 NQYFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKEVIDF 379

Query: 373 VSEPLTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQLR 432
           V+ PLT K TD +VR+RM FNKKLSGTNAVLEKTVL++KL+YA+E NNE+D+AKYS+QLR
Sbjct: 380 VNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLR 439

Query: 433 NLEKRMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKED-HGLDSKSDPFS 491
           N EKRMSVYEKHHENDQ  +  LG LTSKNRK+N+  IRNAEH+KKED    DSKSDPFS
Sbjct: 440 NFEKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNFDSKSDPFS 499

Query: 492 RLKTRTKIYYQEVXXXXXXXXXXXXXXXXXXLQENKALNEHKEKELLLARFKRLGGLENL 551
           RLKTRTK+YYQE+                  LQE++   E +EKELLLA+F+RLGGLE +
Sbjct: 500 RLKTRTKVYYQEI--QKEENAKAKEMAQQEKLQEDRESKERREKELLLAQFRRLGGLERM 557

Query: 552 IQNLDINVTF 561
           I  LDI   F
Sbjct: 558 IGELDIKFDF 567

>ZYRO0E09526g Chr5 complement(758296..759978) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53064 Saccharomyces cerevisiae
           YGL244W RTF1 Subunit of the RNA polymerase II-associated
           Paf1 complex directly or indirectly regulates
           DNA-binding properties of Spt15p (TATA box-binding
           protein) and relative activities of different TATA
           elements
          Length = 560

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/544 (52%), Positives = 364/544 (66%), Gaps = 14/544 (2%)

Query: 26  TTSGKRAKNHDQVGSKRKKIXXXXXXXXXXXXX--YNPY----GGNQSEEEEIDEPNPFP 79
            +S KR+   D+  SK+++I               YNP     G    ++EE +E NPFP
Sbjct: 25  ASSAKRSGKSDRASSKKRRIEVEGGEDDEDEDEDDYNPAASGAGTGDYDDEEEEEENPFP 84

Query: 80  LENKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKXXXXXXXXXX 139
           LE KYKDE DR++L  LPEMERET+LFERSQ+M+KYQ+RK+FR+R +N+K          
Sbjct: 85  LEGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLKEQQQRSKQQE 144

Query: 140 XGKKTRSSTRATHATGHSDXXXXXXXXXXXXRERKTRXXXXXXXXXXXXXXXXXXXXNYK 199
            GKKTRSSTR+T ATGHSD            RE+K++                      K
Sbjct: 145 EGKKTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNRPYSDEEEEGEDEGDDYGYEDK 204

Query: 200 HXXXXXXXXXXXXXXXYNPYATRKSYDMDKDEVEWAEEQTDREAELDDFNKVKVGRSFIA 259
                           Y+PY+ R  ++ D+DEV+WAEE  DREA + DFNK K+GRSF+A
Sbjct: 205 KYSDEEDEEE------YDPYSRRSRFEEDEDEVQWAEEALDREANVADFNKAKIGRSFVA 258

Query: 260 KYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDFFTNQYLGVT 319
            +CFYPGF+D+++G YGRVNVGTD+R+G + YRMVKIEKVFL+ PY MG F TNQY GVT
Sbjct: 259 NFCFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVT 318

Query: 320 QGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQAFVSEPLTA 379
           QG DRKV QM  FSDG  T  EF+RY  ALE  H+T PS++ L  K+KEI +FVS+PLT 
Sbjct: 319 QGKDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTE 378

Query: 380 KMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQLRNLEKRMS 439
           ++T+ IVRNRM+FNKKLSG NAVLEKTVLK+KL+YA E  NERD+AKYSSQLR+ EKRMS
Sbjct: 379 QLTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMS 438

Query: 440 VYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKEDHGLDSKSDPFSRLKTRTKI 499
            YEK HEND++G+NKL ALT+KNR+VN+D+++NAE +KKED   DSKSDPFSRLKTRTK 
Sbjct: 439 TYEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTSFDSKSDPFSRLKTRTKF 498

Query: 500 YYQEVXXXXXXXXXXXXXXXXXXLQENKALNEHKEKELLLARFKRLGGLENLIQNLDINV 559
           YYQE+                  L+E+++  E K+ ELL ARF+RLGGL+ +I  +D   
Sbjct: 499 YYQEI--QKEENEKAKNDAEQKQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQF 556

Query: 560 TFDI 563
           + DI
Sbjct: 557 SIDI 560

>TDEL0D06350 Chr4 complement(1140059..1141756) [1698 bp, 565 aa]
           {ON} Anc_3.567 YGL244W
          Length = 565

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/553 (54%), Positives = 359/553 (64%), Gaps = 27/553 (4%)

Query: 26  TTSGKRAKNHDQVGSKRKKIXXXXXXXXXXXXX-----YNPYGGNQSEE---------EE 71
           TTS KR K  D   SKR+KI                  YNP    Q+E          +E
Sbjct: 25  TTSAKRNKTSDNASSKRRKIAVEGAEEDEDEDEDEEDDYNP-AAVQTESGRYSEEDEEDE 83

Query: 72  IDEPNPFPLENKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKXX 131
            +E NPFPLE KYKD++DR HLE LPEMERETLLFERSQ+M+KY +R+LFRER RN+K  
Sbjct: 84  EEEENPFPLEGKYKDDNDRAHLEGLPEMERETLLFERSQIMQKYHDRRLFRERGRNMKEQ 143

Query: 132 XXXXXXXXXGKKTRSSTRATHATGHSDXXXXXXXXXXXXRERKTRXXXXXXXXXXXXXXX 191
                    G KTRSS R THATGHSD            RE+K                 
Sbjct: 144 QKNRQLRE-GNKTRSSARTTHATGHSDLKASKLSQLRKQREQKGHRANRDRDFEEEEEEE 202

Query: 192 XXXXXNYKHXXXXXXXXXXXXXXXYNPYATRKSYDMDKDEVE-WAEEQTDREAELDDFNK 250
                                   Y+PY  +   D  K        +Q DREA++ DFNK
Sbjct: 203 EDRYEG--------SEYEDEDEEDYDPYNRKSHRDARKGRRSGMGRDQLDREADITDFNK 254

Query: 251 VKVGRSFIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDF 310
           +K+GRSF+AK+CFYPGF+D++KG YGRVNVG D+R+G + YRMVKIEKVF + PY MG+F
Sbjct: 255 IKIGRSFVAKFCFYPGFNDVVKGHYGRVNVGVDKRSGQTQYRMVKIEKVFFQKPYNMGNF 314

Query: 311 FTNQYLGVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQ 370
           FTNQY GVTQG DRKV QMN FSDG FT +E+DRY RAL+  H+TKPS++ L  K+KE+ 
Sbjct: 315 FTNQYFGVTQGKDRKVFQMNFFSDGNFTQSEYDRYLRALDGVHITKPSMYSLDNKAKEMN 374

Query: 371 AFVSEPLTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQ 430
           AFVS+PLT K+TD IVRNRM+FNKKLSG+NAVLEKTVLK+KLRYA+E  N+RD+AKYSSQ
Sbjct: 375 AFVSQPLTDKLTDDIVRNRMLFNKKLSGSNAVLEKTVLKEKLRYAQETGNDRDIAKYSSQ 434

Query: 431 LRNLEKRMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKEDHGLDSKSDPF 490
           LRNL KRMS YEKHHE DQ G+ KLGALTSKNRKVNMD+IRNAEHIKKED   D+KSDPF
Sbjct: 435 LRNLVKRMSAYEKHHETDQSGIKKLGALTSKNRKVNMDRIRNAEHIKKEDVNFDAKSDPF 494

Query: 491 SRLKTRTKIYYQEVXXXXXXXXXXXXXXXXXXLQENKALNEHKEKELLLARFKRLGGLEN 550
           SRLKTRTK+YYQE+                  L E++     +EKELL + FKRLGGLE 
Sbjct: 495 SRLKTRTKVYYQEI--QKEENERAQDIARQKQLDESEEAIARREKELLSSDFKRLGGLER 552

Query: 551 LIQNLDINVTFDI 563
           +I  + +  TFD+
Sbjct: 553 VIGQMQLPFTFDV 565

>KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567
           YGL244W
          Length = 571

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/560 (54%), Positives = 368/560 (65%), Gaps = 38/560 (6%)

Query: 26  TTSGKRAKNHDQVGSKRKKIXXXXXXX---------XXXXXXYNPYG-GN---QSEEEEI 72
           +T  KR+K  D   SK+++I                      YNP+  GN     +E E 
Sbjct: 26  STVSKRSKQSDATASKKRRIYEGSEEEVYDDEADDVDEEEDDYNPHEVGNYDTGDDEAEN 85

Query: 73  DEPNPFPLENKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKXXX 132
           +E NPFPL+ KYKDE DRE+LESLPE+ERET+LF+RSQ MRKYQERKLFRER+R      
Sbjct: 86  EEQNPFPLQGKYKDEKDREYLESLPEVERETVLFDRSQTMRKYQERKLFRERKR------ 139

Query: 133 XXXXXXXXGKKTRSSTRATHATGHSDXXXXXXXXXXXXRERK-TRXXXXXXXXXXXXXXX 191
                    K TRSS R  H+TGHSD            R++K  R               
Sbjct: 140 -----QQEAKPTRSSGRTAHSTGHSDLKASKLSQLKRQRDKKLNRQRSDDEYEEDEEEEE 194

Query: 192 XXXXXNY-KHXXXXXXXXXXXXXXXYNPYATRKSYDMDKDE----VEWAEEQTDREAELD 246
                 Y                  YNP A +  YD  ++E    V+WAE+  DR +EL 
Sbjct: 195 EDDYNGYGDDLNEDAEYQEDEDEEDYNPLAIKSKYDELEEEEDDDVKWAED-NDRVSELA 253

Query: 247 DFNKVKVGRSFIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYR 306
           DFNK+++GRSF+AK+CFYPGF+DL+ GCYGRVNVG D+R+G + YRMVKIEKVFL+ PY 
Sbjct: 254 DFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLYRMVKIEKVFLQKPYN 313

Query: 307 MGDFFTNQYLGVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKS 366
           MG F+TNQY GVTQG DRKV QMN FSDG FT  E++RY R+LE +++++PS H+L  KS
Sbjct: 314 MGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLETANISRPSAHILSNKS 373

Query: 367 KEIQAFVSEPLTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAK 426
           KEI +F++EPLT K+TD IVRNRM+FNKKLSGTNAVLEKTVL+ KL+YARE+NNERDVAK
Sbjct: 374 KEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSKLQYARESNNERDVAK 433

Query: 427 YSSQLRNLEKRMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKEDHG---L 483
           YS+QLRN EKRM+ YEKHHEND  G  KLGALTSKNRKVNM K +N +H KKED     +
Sbjct: 434 YSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTKNYDHGKKEDSAGPTV 493

Query: 484 DSKSDPFSRLKTRTKIYYQEVXXXXXXXXXXXXXXXXXXLQENKALNEHKEKELLLARFK 543
           DSKSDPFSRLKTRTKIYYQEV                  +++NK  +E KEKELLLA+F+
Sbjct: 494 DSKSDPFSRLKTRTKIYYQEV--QKEENEKAKALAQQKEIEKNKEADERKEKELLLAQFR 551

Query: 544 RLGGLENLIQNLDINVTFDI 563
           RLGGLEN+I    INV FDI
Sbjct: 552 RLGGLENMISK--INVNFDI 569

>KAFR0J02880 Chr10 complement(547671..549338) [1668 bp, 555 aa] {ON}
           Anc_3.567 YGL244W
          Length = 555

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/487 (56%), Positives = 346/487 (71%), Gaps = 12/487 (2%)

Query: 77  PFPLENKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKXXXXXXX 136
           PFPLE KYK+E+DR++LESLPEMERET+L++RSQ MRKY+ER+ F++R +N+K       
Sbjct: 79  PFPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLKRQKERNE 138

Query: 137 XXXXGKKTRSSTRATHATGHSDXXXXXXXXXXXXRERKTRXXXXXXXXXXXXXXXXXXXX 196
                 KTRSS RATHATGH+D            RE+K +                    
Sbjct: 139 DDE-ALKTRSSGRATHATGHTDLKASKLSQLKKQREKKNKSRQYSDYEEEEEEDEEEFED 197

Query: 197 NYKHXXXXXXXXXXXXXXXYNPYATRKSYDMDKDEVEWAEEQTDREAELDDFNKVKVGRS 256
            Y+                      + +Y  ++DE     E TDR+ EL+DFNK+++GRS
Sbjct: 198 EYREGSEYEEEEDYNPYER------KTAYKDEEDEEVEWAEDTDRDTELNDFNKLRIGRS 251

Query: 257 FIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDFFTNQYL 316
           F+AK+CFYP F +++KGCYGRVNVG D+RTG +SYRMVKIE++FL+ PY MG FFTNQY 
Sbjct: 252 FVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQKPYSMGKFFTNQYF 311

Query: 317 GVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQAFVSEP 376
           GVTQG DRKV QM+ FSDGL T  E++RY R+LE+SH+ KP+++ L+ KSKE+ +FVSEP
Sbjct: 312 GVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSKSKELVSFVSEP 371

Query: 377 LTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQLRNLEK 436
           LT K+T+ IVRNRM+FNKKLSGTNAVLEKTVLK+KL+YARE NNERDVAKYS+QLRN EK
Sbjct: 372 LTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVAKYSAQLRNFEK 431

Query: 437 RMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKEDHGLDSKSDPFSRLKTR 496
           RM++YEKHHENDQ G  KLGALTSKN+KVNMDK+RNAEH+KKED  +D KSDPFSRLKTR
Sbjct: 432 RMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKEDLPID-KSDPFSRLKTR 490

Query: 497 TKIYYQEVXXXXXXXXXXXXXXXXXXLQENKALNEHKEKELLLARFKRLGGLENLIQNLD 556
           TKIYYQE+                  ++EN+   + KEKELLLA+F+RLGGLE +I  L 
Sbjct: 491 TKIYYQEI--QKEENERAKALAQQKKMEENEEATKRKEKELLLAQFRRLGGLEKMISGL- 547

Query: 557 INVTFDI 563
            N+ FD+
Sbjct: 548 -NIEFDL 553

>Kpol_507.10 s507 (57107..58492) [1386 bp, 461 aa] {ON}
           (57107..58492) [1386 nt, 462 aa]
          Length = 461

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/466 (57%), Positives = 333/466 (71%), Gaps = 8/466 (1%)

Query: 99  MERETLLFERSQVMRKYQERKLFRERQRNIKXXXXXXXXXXXGKKTRSSTRATHATGHSD 158
           MERETLLFERSQ+M+KYQ+RKLFRERQRN+K           GKKTR+STR+T ATGHSD
Sbjct: 1   MERETLLFERSQLMQKYQDRKLFRERQRNLKRQQRNNTSAQEGKKTRTSTRSTQATGHSD 60

Query: 159 XXXXXXXXXXXXRER-KTRXXXXXXXXXXXXXXXXXXXXNYKHXXXXXXXXXXXXXXXYN 217
                       RE+ K R                     YK+                 
Sbjct: 61  VKASKLSQLKRQREKNKNRQYSESEGEYEEEEDEDDYDTGYKYDGSEYEEDDEEEYD--- 117

Query: 218 PYATRKSY--DMDKDEVEWAEEQTDREAELDDFNKVKVGRSFIAKYCFYPGFSDLLKGCY 275
           PY+ +  Y  + ++++V+WAEE T+RE+++DDFNK+K+GRSF+A+YCF+P F++++KGCY
Sbjct: 118 PYSRKPRYREEEEEEDVKWAEESTNRESQVDDFNKIKIGRSFVARYCFHPDFNEIVKGCY 177

Query: 276 GRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDFFTNQYLGVTQGHDRKVLQMNIFSDG 335
           GRVNVG DRRT  ++YRMVKIEKVFL+ PY MG FFTNQY GVTQG DRKV QMN FSDG
Sbjct: 178 GRVNVGVDRRTNQTAYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDG 237

Query: 336 LFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQAFVSEPLTAKMTDAIVRNRMMFNKK 395
             T  EFDRY R+L+ S+ +KPS++ L  K KEI  FVSEP+T K+TD IVRNRM+FNKK
Sbjct: 238 PITIEEFDRYQRSLDASNASKPSVYSLTQKLKEINEFVSEPMTDKLTDEIVRNRMVFNKK 297

Query: 396 LSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQLRNLEKRMSVYEKHHENDQLGMNKL 455
           LSGTNAVLEKTVL+ KL+YA+ENNNERD+AKYS+QLRNLEKR+S YEKHHENDQ G  KL
Sbjct: 298 LSGTNAVLEKTVLRGKLQYAKENNNERDIAKYSTQLRNLEKRLSTYEKHHENDQAGARKL 357

Query: 456 GALTSKNRKVNMDKIRNAEHIKKEDHGLDSKSDPFSRLKTRTKIYYQEVXXXXXXXXXXX 515
           GALTSKNRKVNMDK +N EH+K+ED   DSK+DPFSRLKTRTKIYYQEV           
Sbjct: 358 GALTSKNRKVNMDKAKNVEHVKEEDINFDSKADPFSRLKTRTKIYYQEV--QKEENEKAK 415

Query: 516 XXXXXXXLQENKALNEHKEKELLLARFKRLGGLENLIQNLDINVTF 561
                  L+E++     KE+ELLLA+F+RLGGLE++I ++DI ++ 
Sbjct: 416 ELAQQKKLEEDREAIAKKERELLLAKFRRLGGLESIISSIDIELSI 461

>TPHA0A06000 Chr1 complement(1356928..1358577) [1650 bp, 549 aa]
           {ON} Anc_3.567 YGL244W
          Length = 549

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/486 (55%), Positives = 340/486 (69%), Gaps = 16/486 (3%)

Query: 77  PFPLENKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKXXXXXXX 136
           PFPLE KY+DE DR++LESLPEMERETLLFERSQ+M+KY++R LFRERQR +K       
Sbjct: 75  PFPLEGKYRDERDRDYLESLPEMERETLLFERSQLMQKYKDRMLFRERQRTLKRQRESSE 134

Query: 137 XXXXGKKTRSSTRATHATGHSDXXXXXXXXXXXXRERKTRXXXXXXXXXXXXXXXXXXXX 196
                +K RSSTR++  TGHSD            RERK                      
Sbjct: 135 ----NRKVRSSTRSSKVTGHSDVKSSKLSQLKKQRERKNNHHYSDEDDEDEYEEEE---- 186

Query: 197 NYKHXXXXXXXXXXXXXXXYNPYATRKSY--DMDKDEVEWAEEQTDREAELDDFNKVKVG 254
                              Y+PY  + +Y  + ++++V+WA++ TDRE+ ++DFNK+K+G
Sbjct: 187 --NIYEDKYEEGSEYEDESYDPYKRKSTYAEESEEEDVKWADD-TDRESNVNDFNKIKIG 243

Query: 255 RSFIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDFFTNQ 314
           RSF+AKYCFYPGF+D++K CYGRVNVG ++ T    YRMVKIEKVFL+ PY MG+FFTNQ
Sbjct: 244 RSFVAKYCFYPGFNDIVKDCYGRVNVGVNKNTNQVMYRMVKIEKVFLQKPYSMGNFFTNQ 303

Query: 315 YLGVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQAFVS 374
           Y GVTQG DRKV QM  FSDG  T  E++RY RALE+S+LT PS + L  K KE+  FV+
Sbjct: 304 YFGVTQGKDRKVFQMKFFSDGAITQDEYERYVRALESSNLTIPSTYALSNKFKEVDEFVN 363

Query: 375 EPLTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQLRNL 434
           EP+T K+TD +VRNRM+FNKKLSGTNAVLEKTVL++KL +A++NN+ERD+AKYSSQLRNL
Sbjct: 364 EPMTVKLTDEVVRNRMIFNKKLSGTNAVLEKTVLREKLNFAKQNNSERDIAKYSSQLRNL 423

Query: 435 EKRMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKE-DHGLDSKSDPFSRL 493
           EKR+  YEKHHENDQ G  KLG LTSKNRK+NMDKI+  E++K++ D   D K+DPFSRL
Sbjct: 424 EKRLMTYEKHHENDQQGAKKLGKLTSKNRKLNMDKIKYGENVKEDRDESFDIKTDPFSRL 483

Query: 494 KTRTKIYYQEVXXXXXXXXXXXXXXXXXXLQENKALNEHKEKELLLARFKRLGGLENLIQ 553
           KTRTK+YYQE+                  +QENK   E KE+ELLLA+F+RLGGLE+++ 
Sbjct: 484 KTRTKVYYQEI--QEEENEKAKELARQKKMQENKEAIEQKERELLLAKFRRLGGLESIVH 541

Query: 554 NLDINV 559
           NLDIN+
Sbjct: 542 NLDINI 547

>CAGL0H07711g Chr8 (752900..754600) [1701 bp, 566 aa] {ON} highly
           similar to uniprot|P53064 Saccharomyces cerevisiae
           YGL244w RTF1
          Length = 566

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/550 (53%), Positives = 366/550 (66%), Gaps = 19/550 (3%)

Query: 26  TTSGKRAKNHDQVGSKRKKIXXXXXXXXXXXXXYNPYGGNQ-----SEEEEIDEPNPFPL 80
           TT+ KR K       K+++I             YNP  G +      +EEE +E NPFPL
Sbjct: 24  TTTNKRTKGSSNSQVKKRRIEVDSEDEEDD---YNPDDGYEPVDVSDKEEEEEEENPFPL 80

Query: 81  ENKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKXXXXXXXXXXX 140
           E KYKD  DR+HLESLPEMERET+LFERSQVMRKYQERKLFRER RN+K           
Sbjct: 81  EGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLKQQKIQAGED-- 138

Query: 141 GKKTRSSTRATHATGHSDXXXXXXXXXXXXRERKT--RXXXXXXXXXXXXXXXXXXXXNY 198
            +KTRSS R+T ATGHSD            RERK+  R                    + 
Sbjct: 139 SQKTRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGDEDEFKDD 198

Query: 199 KHXXXXXXXXXXXXXXXYNPYATRKSY----DMDKDEVEWAEEQTDREAELDDFNKVKVG 254
                            Y+PYA +  Y    D ++DE     EQ DR+AE+ DFNK+++G
Sbjct: 199 FIEEDSDYKENDDDEEGYDPYARKSKYAQDNDEEEDEEVEWAEQLDRDAEVQDFNKIRIG 258

Query: 255 RSFIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDFFTNQ 314
           RSF+AKYCFYPGF++L++GCYGRVNVG D+RTG ++YRMVKIEKVFL+ PY MG FFTNQ
Sbjct: 259 RSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYNMGKFFTNQ 318

Query: 315 YLGVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQAFVS 374
           Y GVTQG DRKV QMN FSDG F   EF+RY +AL++S++ KPS + ++ K KEI  F+S
Sbjct: 319 YFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKFKEISEFIS 378

Query: 375 EPLTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQLRNL 434
           +PLT K+TD IVRNRM+ NKKLSGTNAVLEKT+LKDKLRYA+EN NE D+AKYS QLRN 
Sbjct: 379 QPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAKYSKQLRNF 438

Query: 435 EKRMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKK-EDHGLDSKSDPFSRL 493
           EKRM++YEKHHENDQ  + KL  LTSKNRK+NM++IRNAE IKK ED   DSKSDPFSRL
Sbjct: 439 EKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVNFDSKSDPFSRL 498

Query: 494 KTRTKIYYQEVXXXXXXXXXXXXXXXXXXLQENKALNEHKEKELLLARFKRLGGLENLIQ 553
           KTRTK+YYQE+                  L+ ++   + KEK+L+LA F+RLGGL+ +I 
Sbjct: 499 KTRTKVYYQEI--QKEENEKAKEEAAQEQLKIDEETKKEKEKQLMLAEFRRLGGLQKIIG 556

Query: 554 NLDINVTFDI 563
           ++++++  DI
Sbjct: 557 SINVDIKLDI 566

>KLTH0G00726g Chr7 (49910..51595) [1686 bp, 561 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II- associated Paf1
           complex directly or indirectly regulates DNA-binding
           properties of Spt15p (TATA box-binding protein) and
           relative activities of different TATA elements
          Length = 561

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/490 (56%), Positives = 343/490 (70%), Gaps = 12/490 (2%)

Query: 75  PNPFPLENKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKXXXXX 134
           PNPFPLE KYK+E+DR +LESLPEMERET+LFERSQ M+KYQER++ +ER +NI+     
Sbjct: 83  PNPFPLEGKYKNEEDRSYLESLPEMERETMLFERSQTMQKYQERRVLKERAKNIRDQQQK 142

Query: 135 XXXXXXGKKTRSSTRATHATGHSDXXXXXXXXXXXXRERKTRXXXXXXXXXXXXXXXXXX 194
                 GKKTRSSTR+T  TGHSD            R +K +                  
Sbjct: 143 RQLQQEGKKTRSSTRSTRTTGHSDLKESRLSELKKQRAKK-KGTYEYSEEEEEEGQNEED 201

Query: 195 XXNYKHXXXXXXXXXXXXXXXYNPYATRKSYDMDKDEVEWAE-EQTDREAELDDFNKVKV 253
              Y+                Y P   +K    D++E++WAE E  DRE EL DFN++K+
Sbjct: 202 EYGYQDQEDESEDD-------YEP-MYKKGKTEDEEELKWAEDEDLDREPELGDFNRIKI 253

Query: 254 GRSFIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDFFTN 313
           GRSF+AK+CFYP F+D++KGCYGRVNVG D+R+G + YRMVKIEKVFL+ PY MG FFTN
Sbjct: 254 GRSFVAKFCFYPEFNDMIKGCYGRVNVGVDKRSGQTLYRMVKIEKVFLQKPYNMGKFFTN 313

Query: 314 QYLGVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQAFV 373
           QY GVTQG +RKV QMN FSDG  T  EF+RY R+LE S + KPS++++  KS EI +FV
Sbjct: 314 QYFGVTQGKNRKVFQMNFFSDGAITQPEFERYLRSLETSEINKPSLYIINNKSNEINSFV 373

Query: 374 SEPLTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQLRN 433
           S+P+T+K+TD +VRNRM+FNKKLSGTNAVLEKT+LKDKL+YA+E+ +ERDVAKYSSQLRN
Sbjct: 374 SQPVTSKLTDELVRNRMIFNKKLSGTNAVLEKTILKDKLQYAKESGSERDVAKYSSQLRN 433

Query: 434 LEKRMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKEDHGLDSKSDPFSRL 493
           LEKR+S YEKHHENDQ G  KLGALTSKNR+VN+DK +N E  KKED   D+K+DPFSRL
Sbjct: 434 LEKRLSSYEKHHENDQAGSKKLGALTSKNRRVNLDKGKNVEVTKKEDTPFDAKTDPFSRL 493

Query: 494 KTRTKIYYQEVXXXXXXXXXXXXXXXXXXLQENKALNEHKEKELLLARFKRLGGLENLIQ 553
           KTRTKIYYQE+                  LQ++      KE++LLLA+FK LGGLE++I 
Sbjct: 494 KTRTKIYYQEI--QREENEKAKELARQEQLQKDDLNLVEKERKLLLAKFKNLGGLEDIIS 551

Query: 554 NLDINVTFDI 563
           N+D  V+ D+
Sbjct: 552 NMDFQVSLDV 561

>AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL244W (RTF1)
          Length = 562

 Score =  520 bits (1339), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 282/556 (50%), Positives = 356/556 (64%), Gaps = 39/556 (7%)

Query: 26  TTSGKRAKNHDQVGSKRKKIXXXXXXXXXXXXX------------YNP---YG---GNQS 67
            TS KR+K HD  GSK++++                         YNP   YG   G+++
Sbjct: 26  VTSQKRSK-HDSSGSKKRRVMDEESGDDEDNDNDAGDEEDEDEDDYNPGTEYGFDEGHEA 84

Query: 68  EEEEIDEPNPFPLENKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRN 127
            E+E++E NP+PL  KY+D+ DREH+E++PEMERETLLFERSQ M+KYQERK+ RER +N
Sbjct: 85  SEDEVEEENPYPLLGKYRDDADREHIENMPEMERETLLFERSQEMQKYQERKVLRERAKN 144

Query: 128 IKXXXXXXXXXXXGKKTRSSTRATHATGHSDXXXXXXXXXXXXRERKTRXXXXXXXXXXX 187
           I+           G   RSS R+T  TGHSD              RK R           
Sbjct: 145 IRAQQQRRQQKD-GSALRSSGRSTRTTGHSDLRDSKLSEL-----RKQRAKKSGNYDYSA 198

Query: 188 XXXXXXXXXNYKHXXXXXXXXXXXXXXXYNPYATRKSYDMDKDEVEWAEEQTDREAELDD 247
                    +Y                 Y+P+  R+ Y  + DEV+WAE+  DR+AELDD
Sbjct: 199 GEDDSDHSDDY---------VDSDNEDDYDPHDGRQLYREEADEVKWAEDDLDRDAELDD 249

Query: 248 FNKVKVGRSFIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRM 307
           FNK+KVGRSF+AK+CFYP F+  ++GCYGRVN+G D+ TG + YRMVKIEKVFL+ PY M
Sbjct: 250 FNKIKVGRSFVAKFCFYPEFNQRVQGCYGRVNIGVDKHTGQAMYRMVKIEKVFLQKPYNM 309

Query: 308 GDFFTNQYLGVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSK 367
           G FFTNQY GVTQG DRKV QMN FSDG     E++RY   +    + KPS++ L  K+K
Sbjct: 310 GKFFTNQYFGVTQGKDRKVFQMNFFSDGPILQPEYERYLNQIAKHDINKPSLYTLNNKAK 369

Query: 368 EIQAFVSEPLTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKY 427
           ++  FVS+P+T K+TD IVRNRM FNKKL+GTNAVLEKTVL+DKL+YAR+ NNE+D+AKY
Sbjct: 370 DLTNFVSQPMTPKLTDQIVRNRMQFNKKLTGTNAVLEKTVLRDKLQYARDTNNEKDIAKY 429

Query: 428 SSQLRNLEKRMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKEDHG-LDSK 486
           SSQL+NLEKRMS YEKHHENDQ G+ KL ALTSKNRKVN+DKIR+ E++KKED   L+ K
Sbjct: 430 SSQLKNLEKRMSSYEKHHENDQTGIRKLDALTSKNRKVNLDKIRHVENVKKEDSATLNVK 489

Query: 487 SDPFSRLKTRTKIYYQEVXXXXXXXXXXXXXXXXXXLQENKALNEHKEKELLLARFKRLG 546
           +DPFSRLKTRTKIYYQE+                   +E K    H  K+ LLA+F+RLG
Sbjct: 490 TDPFSRLKTRTKIYYQEIQQEENEKAQELAKQKQQQDKEEK----HDRKQQLLAKFRRLG 545

Query: 547 GLENLIQNLDINVTFD 562
           GLE+ +  LD  +  D
Sbjct: 546 GLEDALSKLDFRIKLD 561

>TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567
           YGL244W
          Length = 570

 Score =  513 bits (1322), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 288/555 (51%), Positives = 345/555 (62%), Gaps = 26/555 (4%)

Query: 26  TTSGKRAKNHDQVGSKRKKIXXXXXXXXXXXXXYNPY---GGNQSEEEEID----EPNPF 78
            +S KRA+N+D   SKR+KI             YNP      NQS    +D    EPNPF
Sbjct: 25  VSSKKRARNNDS-SSKRRKIEVDNEDEEEEDD-YNPVFNEDNNQSTYNTMDGEREEPNPF 82

Query: 79  PLENKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKXXXXXXXXX 138
           PLE KYKDEDDRE +ES+PEMERETLLFERSQ+M+KYQERK+FRER R  K         
Sbjct: 83  PLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERSR--KQMSLNNNSN 140

Query: 139 XXGKKTRSSTRATHATGHSDXXXXXXXXXXXXRERKTRXXXX-XXXXXXXXXXXXXXXXN 197
             G+KTR+STR TH TG SD            RER+ +                      
Sbjct: 141 LTGQKTRTSTRVTHTTGLSDAKSSKLSQLKRQRERRNKGQSNYSDEDEYEDEYEDDLEQE 200

Query: 198 YKHXXXXXXXXXXXXXXXY--------NPYATRKSYDMDKDEVEWAEEQTDREAELDDFN 249
           YK                           Y  R S + D D+V+WAE+  DRE+ + DFN
Sbjct: 201 YKSSGSDYDENEAAEEEEDDYDLYGSKTKYNHRGSEEDDDDDVKWAED-IDRESNVQDFN 259

Query: 250 KVKVGRSFIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFL-KGPYRMG 308
           K+K+GRSF  K+CFYP F+D++K CY +VNV  DR   +  YRMVKIEKVFL K P+ MG
Sbjct: 260 KIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRHKPV--YRMVKIEKVFLDKRPHDMG 317

Query: 309 DFFTNQYLGVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKE 368
            FFTNQ  GVTQG++RKV  M  FSD   T AEFDRY R LE+ H+T+PS++ +  K KE
Sbjct: 318 KFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPSVYAINNKFKE 377

Query: 369 IQAFVSEPLTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYS 428
           I AF +EPLT K+TD IVRNRM FNKKLSGTNAVLEKTVL+ KL++A+E  NERDV KYS
Sbjct: 378 ITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKETGNERDVTKYS 437

Query: 429 SQLRNLEKRMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKEDHGLDSKSD 488
           +QLRNLEKR+S+YEKHHENDQ G  KLG LTS+NRK+NMDK RN EH K E  G D+K+D
Sbjct: 438 AQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEHKKVELAGFDAKAD 497

Query: 489 PFSRLKTRTKIYYQEVXXXXXXXXXXXXXXXXXXLQENKALNEHKEKELLLARFKRLGGL 548
           PFSRLKTRTKIYYQE+                  L+E+       EKE LLA FK LGGL
Sbjct: 498 PFSRLKTRTKIYYQEI--QKEENEKAQELAHKKQLEEDAEAKAQSEKEQLLAEFKCLGGL 555

Query: 549 ENLIQNLDINVTFDI 563
           E ++ +L+    FDI
Sbjct: 556 EKMVGSLNFKFDFDI 570

>Ecym_2597 Chr2 complement(1160898..1162586) [1689 bp, 562 aa] {ON}
           similar to Ashbya gossypii AFR266W
          Length = 562

 Score =  510 bits (1313), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 263/503 (52%), Positives = 338/503 (67%), Gaps = 19/503 (3%)

Query: 59  YNPYGGNQSEEEEIDEPNPFPLENKYKDEDDREHLESLPEMERETLLFERSQVMRKYQER 118
           Y+  G +    +E +E NP+PLE KYKDE+DR  ++ +PEMERETLLFERSQ M+KYQER
Sbjct: 73  YDFEGNDDGSGDEQEERNPYPLEGKYKDEEDRNRIQDMPEMERETLLFERSQEMQKYQER 132

Query: 119 KLFRERQRNIKXXXXXXXXXXXGKKTRSSTRATHATGHSDXXXXXXXXXXXXRERKTRXX 178
           K+ R+R ++I+             K RSS R+T  TGHS+            R +K+   
Sbjct: 133 KVLRQRAKSIRAQQQQRQLQKDSTK-RSSGRSTRTTGHSELRTSKLSELRKQRAKKS--- 188

Query: 179 XXXXXXXXXXXXXXXXXXNYKHXXXXXXXXXXXXXXXYNPYATRKSYDMDKD-EVEWAEE 237
                             NY                 Y+P+   K    D D EV+WAEE
Sbjct: 189 -GNYDYSESEEDESDQSDNYAESDNDD----------YDPHHGHKDGFSDHDNEVKWAEE 237

Query: 238 QTDREAELDDFNKVKVGRSFIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIE 297
             DR+AEL+DFNKVK+GRSF+AK+CFYP F++ ++ CYGRVN+G D+ TG+  YRMVKIE
Sbjct: 238 DLDRDAELEDFNKVKIGRSFVAKFCFYPDFAERVQACYGRVNIGLDKHTGLPMYRMVKIE 297

Query: 298 KVFLKGPYRMGDFFTNQYLGVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKP 357
           +VFL+ PY MG FFTNQY GVTQG DRKV QMN FSDG  T  EF+RY   +    + KP
Sbjct: 298 RVFLQKPYSMGKFFTNQYFGVTQGKDRKVFQMNYFSDGPITQPEFERYLNQMAKYDMNKP 357

Query: 358 SIHVLRGKSKEIQAFVSEPLTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARE 417
           S++ L  K+KE+  FVS+P+T K+TD IVRNRM+FNKKL+GTNAVLEK+VLKDKL+YA++
Sbjct: 358 SLYTLNNKAKELFNFVSQPMTMKLTDQIVRNRMVFNKKLTGTNAVLEKSVLKDKLQYAKD 417

Query: 418 NNNERDVAKYSSQLRNLEKRMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIK 477
            NNE  VAKY++QL+NLEKRMS YEKHHENDQ G+ KLGALTSKNRKVNMDKIR AE+++
Sbjct: 418 TNNESAVAKYAAQLKNLEKRMSSYEKHHENDQTGIRKLGALTSKNRKVNMDKIRLAENVR 477

Query: 478 KEDHG-LDSKSDPFSRLKTRTKIYYQEVXXXXXXXXXXXXXXXXXXLQENKALNEHKEKE 536
           KED   +D+KSDPFSRLKTRTKIYYQE+                   +++K   E+KE++
Sbjct: 478 KEDSSNVDAKSDPFSRLKTRTKIYYQEIQQEENEKAMELAKQKHQ--EQDKETQENKERQ 535

Query: 537 LLLARFKRLGGLENLIQNLDINV 559
           LLLA+F+RLGGLE ++ ++   +
Sbjct: 536 LLLAKFRRLGGLEEIVSSIPFKI 558

>Kwal_47.19265 s47 complement(1162019..1163722) [1704 bp, 567 aa]
           {ON} YGL244W (RTF1) - Nuclear protein [contig 344] FULL
          Length = 567

 Score =  499 bits (1284), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 272/513 (53%), Positives = 340/513 (66%), Gaps = 16/513 (3%)

Query: 59  YNP----YG---GNQSEEEEIDEPNPFPLENKYKDEDDREHLESLPEMERETLLFERSQV 111
           YNP    YG   G + EE+E +E NPFPLE KYKDE DRE+LESLPEMERETLLF+RSQ 
Sbjct: 63  YNPERGIYGDASGAEDEEDEEEEENPFPLEGKYKDERDREYLESLPEMERETLLFDRSQE 122

Query: 112 MRKYQERKLFRERQRNIKXXXXXXXXXXXGKKTRSSTRATHATGHSDXXXXXXXXXXXXR 171
           M+KY+ER++ +ER RNI+             KTRSSTR+T  TGHSD            R
Sbjct: 123 MQKYRERRVLKERARNIRAQQQKRQLQQESTKTRSSTRSTRTTGHSDLKESRLSELKKQR 182

Query: 172 ERKTRXXXXXXXXXXXXXXXXXXXXNYKHXXXXXXXXXXXXXXXYNPYATRKSYDMDKDE 231
            +K+                                        Y P   +   D D +E
Sbjct: 183 AKKS------GTYDYSEDEDDGGRDEEDDYGYDDQDEEEESEDDYQPGYKKDKIDEDDEE 236

Query: 232 VEWAEEQ-TDREAELDDFNKVKVGRSFIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISS 290
           V+WAEE   DR+ EL DFNKVK+GRSF+AK+CFYP F+DL++GCYGRVNVG D+R   + 
Sbjct: 237 VKWAEEDDLDRDPELSDFNKVKIGRSFVAKFCFYPEFNDLIRGCYGRVNVGVDKRNNQTL 296

Query: 291 YRMVKIEKVFLKGPYRMGDFFTNQYLGVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALE 350
           YRMVKIE+VFL+ PY MG FFTNQY GVTQG DRKV QMN FSDG  T  EF+RY ++L+
Sbjct: 297 YRMVKIERVFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGAITQPEFERYMKSLD 356

Query: 351 NSHLTKPSIHVLRGKSKEIQAFVSEPLTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKD 410
            S +  PS++ L  KS EI  FVS+P+T K+TD +VRNRM+FNKKLSGTNAVLEKT+L+D
Sbjct: 357 ASGINPPSLYTLNNKSNEINGFVSQPVTPKLTDELVRNRMLFNKKLSGTNAVLEKTILRD 416

Query: 411 KLRYARENNNERDVAKYSSQLRNLEKRMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKI 470
           KL+YA+E  +ERDVAKYSSQLR+LE+R++ YEKHHENDQ G  KLGALTS+NR+ NMDK 
Sbjct: 417 KLQYAKETGSERDVAKYSSQLRSLERRLTSYEKHHENDQAGSKKLGALTSRNRRANMDKG 476

Query: 471 RNAEHIKKEDHGLDSKSDPFSRLKTRTKIYYQEVXXXXXXXXXXXXXXXXXXLQENKALN 530
           +N +  KKED   D+K+DPFSRLKTRTKIYYQE+                  L++  +  
Sbjct: 477 KNVDTTKKEDTPFDAKTDPFSRLKTRTKIYYQEI--QKEENEKAKELARIEQLEKGNSDL 534

Query: 531 EHKEKELLLARFKRLGGLENLIQNLDINVTFDI 563
             KE++LLLARFK LGGLE ++  +D  ++ ++
Sbjct: 535 AEKERKLLLARFKNLGGLEEVVSGIDFKLSIEV 567

>KLLA0A00737g Chr1 (72233..73981) [1749 bp, 582 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II-associated Paf1 complex
           directly or indirectly regulates DNA-binding properties
           of Spt15p (TATA box-binding protein) and relative
           activities of different TATA elements
          Length = 582

 Score =  473 bits (1217), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 248/499 (49%), Positives = 324/499 (64%), Gaps = 17/499 (3%)

Query: 77  PFPLENKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKXXXXXXX 136
           PFPLE KYKDE DRE LE LPEMERE++LFERSQ M+KYQERKL R+  ++IK       
Sbjct: 89  PFPLEGKYKDEKDREKLELLPEMERESILFERSQQMQKYQERKLLRQHAKSIKQQQQLQR 148

Query: 137 XXXXGKKTRSSTRATHATGHSDXXXXXXXXXXXXRERKT---------RXXXXXXXXXXX 187
                K TR+STR++  TGHSD            R +K+                     
Sbjct: 149 EG--SKSTRASTRSSRTTGHSDLKQSKLSELKKQRAKKSGNYEFSDNESEDDYRSEDDSR 206

Query: 188 XXXXXXXXXNYKHXXXXXXXXXXXXXXXYNPYATRKSYDMDKDEVEWAEEQT-DREAELD 246
                    + +                Y    TR     D  EVEWAE+   DRE+ LD
Sbjct: 207 GRRRRGDYDDEEEEESEYDEEEDDYDLGYEKSKTRGRERADIHEVEWAEDDNLDRESSLD 266

Query: 247 DFNKVKVGRSFIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYR 306
           D+NK+++GRSF+AK+CFYP F+ +++GCYGRVN+G D+ TG S YRMVKIE+VFL+ PY 
Sbjct: 267 DYNKIQIGRSFVAKFCFYPHFNKIVEGCYGRVNIGKDKHTGNSMYRMVKIERVFLQKPYN 326

Query: 307 MGDFFTNQYLGVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKS 366
           MG FFTNQY GVTQG DRK+ QM+ FSD   T  E++RY  +LE   +T+PS ++L  KS
Sbjct: 327 MGKFFTNQYFGVTQGKDRKIFQMSYFSDSPVTQPEYERYLLSLEKYDITQPSPYILNNKS 386

Query: 367 KEIQAFVSEPLTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAK 426
           K +  FV EPLT K+ D IVRNRM+FNKKLSGTNAV+EK VLK+KL++++++ +    +K
Sbjct: 387 KAVNEFVCEPLTPKLMDDIVRNRMVFNKKLSGTNAVMEKQVLKEKLQFSKQSGDIESESK 446

Query: 427 YSSQLRNLEKRMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKED--HGLD 484
           Y++QL+ LEKR+S YEKHHENDQ  +  LGALTSKNRK+N+D+IR+AE IK+E+  + +D
Sbjct: 447 YANQLKALEKRLSSYEKHHENDQNDIKTLGALTSKNRKLNIDRIRHAETIKREEGVNKVD 506

Query: 485 SKSDPFSRLKTRTKIYYQEVXXXXXXXXXXXXXXXXXXLQENKALNEHKEKELLLARFKR 544
           +KSDPFSRLKTRTKIYYQE+                  L+ ++   E K+KELLLA+F+R
Sbjct: 507 AKSDPFSRLKTRTKIYYQEI---QQEENEKAREEAKRQLEVDQEAEEQKKKELLLAKFRR 563

Query: 545 LGGLENLIQNLDINVTFDI 563
           LGGLE +I +LD+ +  DI
Sbjct: 564 LGGLEEIIGSLDLKLHIDI 582

>SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II-associated Paf1 complex
           directly or indirectly regulates DNA-binding properties
           of Spt15p (TATA box-binding protein) and relative
           activities of different TATA elements
          Length = 574

 Score =  434 bits (1117), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 207/333 (62%), Positives = 260/333 (78%), Gaps = 3/333 (0%)

Query: 232 VEWAE-EQTDREAELDDFNKVKVGRSFIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISS 290
           V+WAE E  DR+  L DFNKVK+GRSF+AK+CFYPGF++L++  YGRVNVG D+ TG ++
Sbjct: 244 VKWAETEDFDRDTGLADFNKVKIGRSFVAKFCFYPGFNELVQNSYGRVNVGIDKHTGQTA 303

Query: 291 YRMVKIEKVFLKGPYRMGDFFTNQYLGVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALE 350
           YRMVKIEKVFL+ PY MG FFTNQY GVTQG DRKV QMN FSDG  T  E++RY ++LE
Sbjct: 304 YRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGAITQVEYERYLKSLE 363

Query: 351 NSHLTKPSIHVLRGKSKEIQAFVSEPLTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKD 410
              + KPS++ L  KSKEI  FVS+P+T+K+TD IVRNRM+FNKKLSGTNAVLEKTVLK+
Sbjct: 364 KYGINKPSVYNLNNKSKEISEFVSQPMTSKLTDDIVRNRMVFNKKLSGTNAVLEKTVLKE 423

Query: 411 KLRYARENNNERDVAKYSSQLRNLEKRMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKI 470
           KL+YA+E +NERD+AKYSSQL+NLEKR+S YEKHHENDQ G+ KLG LTSKNRK+N+D+I
Sbjct: 424 KLQYAKETSNERDIAKYSSQLKNLEKRISSYEKHHENDQAGIKKLGVLTSKNRKLNIDRI 483

Query: 471 RNAEHIKKEDHGLDSKSDPFSRLKTRTKIYYQEVXXXXXXXXXXXXXXXXXXLQENKALN 530
           ++AE ++K+D   D+KSDPFSRLKTRTKIYY+EV                  L+E+K   
Sbjct: 484 KHAELVQKDDVNFDAKSDPFSRLKTRTKIYYKEV--QQQENEKAKEAARQKQLEEDKGTA 541

Query: 531 EHKEKELLLARFKRLGGLENLIQNLDINVTFDI 563
             KE ELLLA+F+ LGGLE +I  +D+ +  ++
Sbjct: 542 TRKENELLLAKFRSLGGLEEIIGGIDLQINVNL 574

>YNL254C Chr14 complement(168043..169248) [1206 bp, 401 aa] {ON}
           RTC4Protein of unknown function; null mutation
           suppresses cdc13-1 temperature sensitivity; (GFP)-fusion
           protein localizes to both the cytoplasm and the nucleus
          Length = 401

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 1/70 (1%)

Query: 336 LFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQAFVSEPLTAKMTDAIVRN-RMMFNK 394
           L T A FD+ +R+  NS +       LRGK KE +  VS PL   + +  + + +   N 
Sbjct: 74  LSTVATFDKLSRSFPNSEVQAAKNAALRGKEKEEEKVVSIPLIQNLKNEDIESIKCRNNN 133

Query: 395 KLSGTNAVLE 404
            L G   +LE
Sbjct: 134 LLDGKKLLLE 143

>SAKL0E02618g Chr5 complement(210003..210824) [822 bp, 273 aa] {ON}
           similar to uniprot|P28320 Saccharomyces cerevisiae
           YKL095W YJU2 Essential nuclear protein putative
           spliceosomal component involved in mRNA splicing based
           on computational analysis of large-scale protein-protein
           interaction data
          Length = 273

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 14/77 (18%)

Query: 417 ENNNERDVAKYSSQLRNLEKRMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHI 476
           EN  E D      +L  LEKR++ +++  E+D+    KL  L    RK N+DK++ AE +
Sbjct: 147 ENGQEED------KLAELEKRLAKFQQEQEDDE----KLEQL----RKYNVDKMKRAEEL 192

Query: 477 KKEDHGLDSKSDPFSRL 493
            K+D  L  K +    L
Sbjct: 193 FKKDEDLIQKQEEVDEL 209

>SAKL0E02684g Chr5 complement(214237..215058) [822 bp, 273 aa] {ON}
           similar to uniprot|P28320 Saccharomyces cerevisiae
           YKL095W YJU2 Essential nuclear protein putative
           spliceosomal component involved in mRNA splicing based
           on computational analysis of large-scale protein-protein
           interaction data
          Length = 273

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 14/77 (18%)

Query: 417 ENNNERDVAKYSSQLRNLEKRMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHI 476
           EN  E D      +L  LEKR++ +++  E+D+    KL  L    RK N+DK++ AE +
Sbjct: 147 ENGQEED------KLAELEKRLAKFQQEQEDDE----KLEQL----RKHNVDKMKRAEEL 192

Query: 477 KKEDHGLDSKSDPFSRL 493
            K+D  L  K +    L
Sbjct: 193 FKKDEDLIQKQEEVDEL 209

>Kpol_1054.58 s1054 (144394..145599) [1206 bp, 401 aa] {ON}
           (144394..145599) [1206 nt, 402 aa]
          Length = 401

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 7/75 (9%)

Query: 363 RGKSKE-----IQAFVSEPLT--AKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYA 415
           RGKS +     ++  +S+ LT   +  D +V+ R +  KK++    + E   L++KL Y 
Sbjct: 64  RGKSDDKVLSRLEELISDVLTEQTRQADELVKQRKLLEKKVAELKQMPESGSLREKLAYT 123

Query: 416 RENNNERDVAKYSSQ 430
            E N  R    Y  Q
Sbjct: 124 FEYNTARKFPAYIWQ 138

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,652,232
Number of extensions: 2081370
Number of successful extensions: 7553
Number of sequences better than 10.0: 63
Number of HSP's gapped: 7800
Number of HSP's successfully gapped: 77
Length of query: 563
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 448
Effective length of database: 40,294,809
Effective search space: 18052074432
Effective search space used: 18052074432
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)