Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0I032303.566ON38638620770.0
NCAS0E002703.566ON38838510581e-142
Kpol_380.73.566ON3853899781e-130
Smik_7.183.566ON3853879631e-128
KAFR0J028703.566ON3843829591e-127
ZYRO0E09504g3.566ON3773819501e-126
Skud_7.243.566ON3913879451e-125
KNAG0I002403.566ON3913839211e-122
YGL243W (TAD1)3.566ON4003879211e-121
SAKL0F00836g3.566ON3833899181e-121
KLTH0G00748g3.566ON3853899141e-121
Kwal_47.192633.566ON3833879101e-120
TDEL0D063403.566ON4023898911e-117
TBLA0E002303.566ON3943948641e-113
Ecym_25963.566ON3873848631e-113
AFR267W3.566ON3853828391e-109
TPHA0G036403.566ON3963888311e-108
Suva_7.183.566ON3853898271e-107
CAGL0H07733g3.566ON3853818221e-107
KLLA0A00759g3.566ON3803877687e-99
KAFR0G01900na 1ON42684731.7
TDEL0G020901.170ON68790722.0
ZYRO0C02640g3.46ON40056695.3
Smik_4.7951.37ON48374695.3
AGL156W8.359ON910101686.6
KAFR0A055704.315ON1223111679.3
Kpol_1058.458.90ON3892266610.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0I03230
         (386 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {O...   804   0.0  
NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566...   412   e-142
Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON} ...   381   e-130
Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)   375   e-128
KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {...   374   e-127
ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {...   370   e-126
Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)   368   e-125
KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566...   359   e-122
YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}  TAD1tRNA-spe...   359   e-121
SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar ...   358   e-121
KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar ...   356   e-121
Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]...   355   e-120
TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa] ...   347   e-117
TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566...   337   e-113
Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {O...   337   e-113
AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic ho...   327   e-109
TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {O...   324   e-108
Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)   323   e-107
CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} simila...   321   e-107
KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar ...   300   7e-99
KAFR0G01900 Chr7 (403294..404574) [1281 bp, 426 aa] {ON}               33   1.7  
TDEL0G02090 Chr7 complement(408090..410153) [2064 bp, 687 aa] {O...    32   2.0  
ZYRO0C02640g Chr3 complement(209471..210673) [1203 bp, 400 aa] {...    31   5.3  
Smik_4.795 Chr4 complement(1394372..1395823) [1452 bp, 483 aa] {...    31   5.3  
AGL156W Chr7 (403828..406560) [2733 bp, 910 aa] {ON} Syntenic ho...    31   6.6  
KAFR0A05570 Chr1 (1112905..1116576) [3672 bp, 1223 aa] {ON} Anc_...    30   9.3  
Kpol_1058.45 s1058 (125362..126531) [1170 bp, 389 aa] {ON} (1253...    30   10.0 

>NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {ON}
           Anc_3.566 YGL243W
          Length = 386

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/386 (100%), Positives = 386/386 (100%)

Query: 1   MAQEHQLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDTNDLRVISLA 60
           MAQEHQLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDTNDLRVISLA
Sbjct: 1   MAQEHQLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDTNDLRVISLA 60

Query: 61  TGVKALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEETDLVIHSKDSEY 120
           TGVKALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEETDLVIHSKDSEY
Sbjct: 61  TGVKALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEETDLVIHSKDSEY 120

Query: 121 YSFKSNLKIALYISQLPCGDISMRMLKERDIAPEELAIKDEDSIQYINQDNKTILRGRLN 180
           YSFKSNLKIALYISQLPCGDISMRMLKERDIAPEELAIKDEDSIQYINQDNKTILRGRLN
Sbjct: 121 YSFKSNLKIALYISQLPCGDISMRMLKERDIAPEELAIKDEDSIQYINQDNKTILRGRLN 180

Query: 181 FNKKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVPGMT 240
           FNKKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVPGMT
Sbjct: 181 FNKKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVPGMT 240

Query: 241 TEMKEDIDLCFNKQFERCVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIGQGNS 300
           TEMKEDIDLCFNKQFERCVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIGQGNS
Sbjct: 241 TEMKEDIDLCFNKQFERCVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIGQGNS 300

Query: 301 IEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQSQHER 360
           IEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQSQHER
Sbjct: 301 IEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQSQHER 360

Query: 361 RKLIDYTRSKMSPDGWISTQEDDCLP 386
           RKLIDYTRSKMSPDGWISTQEDDCLP
Sbjct: 361 RKLIDYTRSKMSPDGWISTQEDDCLP 386

>NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566
           YGL243W
          Length = 388

 Score =  412 bits (1058), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 202/385 (52%), Positives = 278/385 (72%), Gaps = 2/385 (0%)

Query: 1   MAQEHQLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDTNDLRVISLA 60
           M  E  L DR+A ++Q++Y+ LK SSKPV RSNG+KEWTV A  + ++++T +L++ISL+
Sbjct: 1   MGGEVLLPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTGNLKMISLS 60

Query: 61  TGVKALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQL-KNGEETDLVIHSKDSE 119
           TGVKALP+KEL RSGGKM+HD HAEI+ALRGFNTV+L+ I  + +N  ++DL+  S  + 
Sbjct: 61  TGVKALPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQSDLLEISDANG 120

Query: 120 YYSFKSNLKIALYISQLPCGDISMRMLKERDIAPEELA-IKDEDSIQYINQDNKTILRGR 178
            Y  ++  K+ LYIS+LPCGD SMR L         L  I D D  QYI+ +  TILRGR
Sbjct: 121 KYHLRAKWKLILYISRLPCGDASMRTLSNSSPTSSSLKSIDDSDEFQYIDPNIPTILRGR 180

Query: 179 LNFNKKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVPG 238
           LNF++ G VRTKPGRLDS  T SKSCSDKLC++Q TSILNC+T+ LL+ PV++DY+++P 
Sbjct: 181 LNFSRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQ 240

Query: 239 MTTEMKEDIDLCFNKQFERCVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIGQG 298
           +  + K D+ L F  + +        + YL+T+ +F + +N   +EPS++ +IK+F+ QG
Sbjct: 241 LNYDNKNDLLLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQG 300

Query: 299 NSIEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQSQH 358
            +IE+ +LNGVKNGSYTK NKPLRKNCE++VSR++QW I+K I P YS  SYL+FK+SQ 
Sbjct: 301 ETIEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRSQT 360

Query: 359 ERRKLIDYTRSKMSPDGWISTQEDD 383
            R +LI YT   +S +GW+ TQ DD
Sbjct: 361 ARLELIKYTNEILSSEGWLPTQPDD 385

>Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON}
           complement(11933..13090) [1158 nt, 386 aa]
          Length = 385

 Score =  381 bits (978), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 189/389 (48%), Positives = 274/389 (70%), Gaps = 11/389 (2%)

Query: 3   QEHQLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDTNDLRVISLATG 62
           +E  L D+I++++ ++Y  LKSSSKP  RSN +KEWTV A IVAI+ D N++  I+++TG
Sbjct: 2   KEKSLGDKISNIIFEEYSKLKSSSKPTTRSNNVKEWTVLAAIVAISNDENEIIPITISTG 61

Query: 63  VKALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEETDLVIHSKDSEYYS 122
           VKA PN ELERS GK+LHD H+EI++LR FNT +LQ + ++  G+++  ++ +K    Y+
Sbjct: 62  VKATPNDELERSSGKILHDCHSEILSLRAFNTYLLQSVQRVSEGDKSKFILPAKADGKYN 121

Query: 123 FKSNLKIALYISQLPCGDISMRMLKERDIAPEE--LAIKDEDSIQYINQDNKTILRGRLN 180
           +  N KIALYIS+LPCGD SM  L E D+   E    I+D D+ Q+I+   KT++RGRLN
Sbjct: 122 WNENYKIALYISKLPCGDASMDTLNE-DLEDNEQNFTIEDNDAYQFIDPKIKTVIRGRLN 180

Query: 181 FNKKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVPGMT 240
           ++KK  VRTKPGR DS +T SKSCSDKLCMKQ  SILN L + L E P++L Y+I+P   
Sbjct: 181 YSKKNVVRTKPGRYDSNVTLSKSCSDKLCMKQAKSILNSLNWDLFENPIFLAYVIIPT-- 238

Query: 241 TEMKEDIDLCFNKQF-ERCVGTRHEV---CYLSTSKEFKDTRNTSDQEPSAIGAIKVFIG 296
             +K+++ L  NK+F ER  G    +    +L+  ++F D +     EP+ + +IK+ + 
Sbjct: 239 --LKDELLLKLNKEFPERLRGIGIPIMPLTFLTCVEKFIDDKTEIKTEPALVSSIKILLP 296

Query: 297 QGNSIEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQS 356
           + + IEQ+I+NGV+NGSYTKKNKPL+KNC++ +S++SQWQ+FK ++ +    SY+++K+S
Sbjct: 297 REHQIEQSIVNGVRNGSYTKKNKPLKKNCQSDISKYSQWQLFKTLKEEQLAKSYIEYKKS 356

Query: 357 QHERRKLIDYTRSKMSPDGWISTQEDDCL 385
           Q  R  L D  +SK+SPDGWIST +DDC 
Sbjct: 357 QTLREDLKDIIKSKLSPDGWISTFQDDCF 385

>Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  375 bits (963), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 189/387 (48%), Positives = 259/387 (66%), Gaps = 8/387 (2%)

Query: 1   MAQEHQLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAIN--TDTNDLRVIS 58
           M  E +L DRI+  +  +Y  LK   +PV R  G+KEWTV AGIVAIN   DTN++ V+S
Sbjct: 1   MLSEDELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLS 60

Query: 59  LATGVKALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEETDLVIHSKDS 118
           +ATGVKA+P+ EL RSGGK+LHD HAEI+ALRG NTV+L  I +      +D +  + ++
Sbjct: 61  MATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANGSDFIQSNDET 120

Query: 119 E-YYSFKSNLKIALYISQLPCGDISMRMLKERDIAPEELA-IKDEDSIQYINQDNKTILR 176
              +  K N ++ALYIS+LPCGD S+  L +      +   I+D+D  QY+N   KTILR
Sbjct: 121 PPRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILR 180

Query: 177 GRLNFNKKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIV 236
           G LNFN+K  VRTKPGR DS +T SKSCSDKL MK+ +SILN L ++L  QPV+L Y+++
Sbjct: 181 GNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVI 240

Query: 237 PGMTTEMKEDIDLCFNKQFERCVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIG 296
           PG+  E+K  +   F+   +R     HE  ++S +  F D +   +  PS + +IK+F+ 
Sbjct: 241 PGLENEVKHVLKQSFH---DRLPNANHETIFMSCNTSFYDDKAGEEDVPSLMCSIKLFMN 297

Query: 297 QGNSIEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQS 356
              + E+ ILNGVKNG YTK +KPLRK+C++LVSRF+QW++FK+I P+Y  MSYL FK S
Sbjct: 298 DHTN-EEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKSS 356

Query: 357 QHERRKLIDYTRSKMSPDGWISTQEDD 383
           Q  R +LI   +  +SPDGWI T+ DD
Sbjct: 357 QKRRTRLIIAIKDILSPDGWIPTKIDD 383

>KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {ON}
           Anc_3.566 YGL243W
          Length = 384

 Score =  374 bits (959), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 185/382 (48%), Positives = 260/382 (68%), Gaps = 5/382 (1%)

Query: 7   LADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAIN--TDTNDLRVISLATGVK 64
           L D IA L+ ++YD LK+SSKPV RSNG KEWTV A +VAIN   D  DL++I+++TGVK
Sbjct: 5   LGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTGVK 64

Query: 65  ALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEETDLVIHSKDSEYYSFK 124
           A+PN  L+RS G++LHD HAEI+ALRGFN V+L+ +  LKN E +  +  S     + +K
Sbjct: 65  AMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLDKSAQGGKFRWK 124

Query: 125 SNLKIALYISQLPCGDISMRMLKERDIAPEELAIKDEDSIQYINQDNKTILRGRLNFNKK 184
           S  K+ALY+S+LPCGD SM  L+  D +  ++ + ++D +QYI+     ILRGR+NF +K
Sbjct: 125 SKWKLALYVSRLPCGDASMDHLE--DASELDIEMSEDDRLQYIDPGKSKILRGRMNFKRK 182

Query: 185 GYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVPGMTTEMK 244
           G VRTKPGRLDS +T SKSCSDKLC+KQ TS LN LT++L+E PVYL Y+++P +    K
Sbjct: 183 GAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELNDTDK 242

Query: 245 EDIDLCFNKQFERCVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIGQGNSIEQT 304
           + +  CF+ +    +       +L+    F D + +  Q PSA   IKVF  Q ++IEQ 
Sbjct: 243 KALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQEHTIEQA 302

Query: 305 ILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQ-MSYLDFKQSQHERRKL 363
           ILNGVKNG YTK +KPLR+ CE+++SR+SQW ++K ++      +SYL FK  Q +RR L
Sbjct: 303 ILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQEQRRDL 362

Query: 364 IDYTRSKMSPDGWISTQEDDCL 385
           ++  +  +S   WI+T +DDC+
Sbjct: 363 VENAKICLSHGSWIATLKDDCI 384

>ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {ON}
           similar to uniprot|P53065 Saccharomyces cerevisiae
           YGL243W TAD1 tRNA-specific adenosine deaminase
           deaminates adenosine-37 to inosine in tRNA-Ala
          Length = 377

 Score =  370 bits (950), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 185/381 (48%), Positives = 259/381 (67%), Gaps = 13/381 (3%)

Query: 7   LADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDTNDLRVISLATGVKAL 66
           L +RIA  + + Y  L SS KP  RSNG+KEWTV AGIVAI+   +DLR+IS+ATGVKAL
Sbjct: 6   LGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSDLRLISIATGVKAL 65

Query: 67  PNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEET--DLVIHSKDSEYYSFK 124
           P+  L RSGGKM+HD HAEI+ALR FN VIL QI  L +  +   DLV  + + + + FK
Sbjct: 66  PDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQLFHFK 125

Query: 125 SNLKIALYISQLPCGDISMRMLKERDIAPEELAIKDEDSIQYINQDNKTILRGRLNFNKK 184
            N ++A+YIS LPCGD SM +L + +   E   ++D+D IQ+++    +I+RGR N++++
Sbjct: 126 DNWELAIYISTLPCGDASMDLLCQDESIIE---MQDDDPIQFVDPAVTSIVRGRFNYSRR 182

Query: 185 GYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVPGMTTEMK 244
             VRTKPGR DSQ+T  KSCSDKLC +Q  SILNC+T++LL +PVYL Y++ P  T    
Sbjct: 183 QVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPNTT---- 238

Query: 245 EDIDLCFNKQFERC-VGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIGQGNSIEQ 303
              DL     ++R  V     +  L  S +F+  +++S++EPSA+ +IK++    +++EQ
Sbjct: 239 ---DLLHQSFYDRIKVLPNVPLKVLQCSYQFEHDKHSSEEEPSAMSSIKLYSTPESTVEQ 295

Query: 304 TILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQSQHERRKL 363
            +LNG+KNG YTK NKPLR+NCE  VSR++QWQ+FK + P+++  +YL FK +  +R  L
Sbjct: 296 ALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQDRNAL 355

Query: 364 IDYTRSKMSPDGWISTQEDDC 384
           I   R  +SP GWIST  DDC
Sbjct: 356 IQDCRKLLSPKGWISTSRDDC 376

>Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)
          Length = 391

 Score =  368 bits (945), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 187/387 (48%), Positives = 266/387 (68%), Gaps = 8/387 (2%)

Query: 1   MAQEHQLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTD--TNDLRVIS 58
           M+ +++LA+ I++ +  +Y  LKS  KP  R  GIKEWT+ AG+V IN     N++ V+S
Sbjct: 7   MSSKNELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLS 66

Query: 59  LATGVKALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEETDLVIHSKDS 118
           +ATGVKALP+ EL+RSGGK+LHD HAEI+ALRG NTV+L+ I        +D +  + + 
Sbjct: 67  VATGVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANGSDFIESNNEI 126

Query: 119 EY-YSFKSNLKIALYISQLPCGDISMRMLKERDIAPEE-LAIKDEDSIQYINQDNKTILR 176
              ++ K + ++ALYIS+LPCGD SM  L +     E+ + I+D D+ QY++   KTILR
Sbjct: 127 PIRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTILR 186

Query: 177 GRLNFNKKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIV 236
           GRLNF+KK  VRTKPGR DS +T SKSCSDKL MKQ +SILN L ++L EQPVYL Y+++
Sbjct: 187 GRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIVI 246

Query: 237 PGMTTEMKEDIDLCFNKQFERCVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIG 296
           P +  + K  ++  F+ +   C G  H+V +L+    F D R   +  PS++ +IK+F+ 
Sbjct: 247 PDIEDKTKHILERSFHNRLP-CDG--HKVEFLNCHTPFYDDRTDENDIPSSMCSIKLFVN 303

Query: 297 QGNSIEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQS 356
             +S E+ I NG+KNG YTK +KPLRK+C++ VSRF+QW++F++I PK+  MSYL FK  
Sbjct: 304 D-SSTEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFKSQ 362

Query: 357 QHERRKLIDYTRSKMSPDGWISTQEDD 383
           Q ER +LI   ++ +SPDGWIST+ DD
Sbjct: 363 QKERNRLITTAKNALSPDGWISTRIDD 389

>KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566
           YGL243W
          Length = 391

 Score =  359 bits (921), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 178/383 (46%), Positives = 258/383 (67%), Gaps = 6/383 (1%)

Query: 7   LADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDTN-DLRVISLATGVKA 65
           L + IADL+  +YD L +SSKP  RSNG KEWT+ +G+VA+       LR+ISL TGVKA
Sbjct: 5   LGNEIADLVYSEYDRLSTSSKPAVRSNGTKEWTILSGLVAVPLHPGPQLRLISLTTGVKA 64

Query: 66  LPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEETDLVIHS-KDSEYYSFK 124
            PN++LERS G++LHD HAEI+ALRGFN V+L+Q+   +N +  DL++   +D+  +   
Sbjct: 65  TPNQDLERSQGRVLHDCHAEILALRGFNYVLLRQMQAARNNDRCDLILPGIQDTNKFRLN 124

Query: 125 SNLKIALYISQLPCGDISMRMLKERD-IAPEELAIKDEDSIQYINQDNKTILRGRLNFNK 183
              ++AL+IS+LPCGD SM  L+E+  +  +   I D+D +QYI+ +N+++LRGR N+ K
Sbjct: 125 PEYQLALFISRLPCGDGSMNSLQEQGGLGQDTNGIDDDDPVQYIDPNNRSLLRGRFNYAK 184

Query: 184 KGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVPGMTTEM 243
           KG VRTKPGR+DS++T SKSCSDKLC  Q TSILN  T+ L+E+ VY+DY+IVP ++   
Sbjct: 185 KGCVRTKPGRMDSKITYSKSCSDKLCCHQATSILNACTWPLIEEAVYIDYLIVPNISASD 244

Query: 244 KEDIDLCFNKQFERCVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIGQGNSIEQ 303
           +  ++ CF  +        H++  LS  + F D +   D++PS+I  +K++I +G ++EQ
Sbjct: 245 RNALERCFTTRLSSATFPVHKMQILSCGQSFADDQQDEDEQPSSISCVKLYITEGETLEQ 304

Query: 304 TILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQ--MSYLDFKQSQHERR 361
            +L+G++NG +TK +KPLR NCET VSR SQW++F  + P+ S    SY DFK     R 
Sbjct: 305 AVLSGIRNGFFTKVSKPLRNNCETAVSRLSQWRLFCTLNPEASNKYTSYRDFKSKLVPRA 364

Query: 362 KLIDYTRSKMS-PDGWISTQEDD 383
           +LI  TRS ++    WI T  DD
Sbjct: 365 ELITRTRSLLTNGQPWIPTCSDD 387

>YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}
           TAD1tRNA-specific adenosine deaminase, deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 400

 Score =  359 bits (921), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 181/387 (46%), Positives = 261/387 (67%), Gaps = 9/387 (2%)

Query: 1   MAQEHQLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTD--TNDLRVIS 58
           M  E +L + I+  +  +Y  LKS+ +P+ R +GI+EWT+ AG+ AIN D   N + ++S
Sbjct: 17  MPSEDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILS 76

Query: 59  LATGVKALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEETDLVIHSKDS 118
           +ATGVKALP+ EL+RS GK+LHD HAEI+ALRG NTV+L +I Q  N    D  I   D 
Sbjct: 77  IATGVKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRI-QNYNPSSGDKFIQHNDE 135

Query: 119 --EYYSFKSNLKIALYISQLPCGDISMRMLKERDIAPEELAIKDEDSIQYINQDNKTILR 176
               ++ K N ++ALYIS+LPCGD SM  L +     + + I+D D  QY+++  KTILR
Sbjct: 136 IPARFNLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDSDEFQYVDRSVKTILR 195

Query: 177 GRLNFNKKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIV 236
           GRLNFN++  VRTKPGR DS +T SKSCSDKL MKQ +S+LNCL ++L E+PV+L Y+++
Sbjct: 196 GRLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVI 255

Query: 237 PGMTTEMKEDIDLCFNKQFERCVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIG 296
           P +  E K  ++  F+    R     +E+ +L+  K F D +   +  P  + ++K+F+ 
Sbjct: 256 PNLEDETKHHLEQSFHT---RLPNLDNEIKFLNCLKPFYDDKLDEEDVPGLMCSVKLFMD 312

Query: 297 QGNSIEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQS 356
              S E+ ILNGV+NG YTK +KPLRK+C++ VSRF+QW++FK+I P+Y  +SYL+FK  
Sbjct: 313 DF-STEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEFKSR 371

Query: 357 QHERRKLIDYTRSKMSPDGWISTQEDD 383
           Q +R +LI   ++ +SPDGWI T+ DD
Sbjct: 372 QKKRSQLIIAIKNILSPDGWIPTRTDD 398

>SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 383

 Score =  358 bits (918), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 184/389 (47%), Positives = 253/389 (65%), Gaps = 11/389 (2%)

Query: 1   MAQEHQLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDTNDLRVISLA 60
           M+ E  +    + L+ + Y  LK   KP  RSNGIKEWTV AGI+AIN   N +R++SL 
Sbjct: 1   MSYEEFVEQGSSKLINEAYARLKPICKPTVRSNGIKEWTVLAGIIAINERKNTMRLVSLG 60

Query: 61  TGVKALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNG--EETDLVIHSKDS 118
           TGVKA PN+EL+RS GK++HD HAEI+ALRGFNTV+L Q+ +L  G  E  DLV  + D 
Sbjct: 61  TGVKATPNEELKRSKGKIVHDCHAEILALRGFNTVLLMQVSELTQGKHERVDLVEKAVDG 120

Query: 119 EYYSFKSNLKIALYISQLPCGDISMRMLKERDIAPEELAIKDEDSIQYINQDNKTILRGR 178
             +    +   ALYIS+LPCGD SM  L+E D+      I++ D+ QY+ Q+N T+LRGR
Sbjct: 121 LSFKVPDHWSFALYISKLPCGDSSMDTLEEEDL--NSFNIENTDACQYLEQNNHTLLRGR 178

Query: 179 LNFNKKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVPG 238
            N+ KKG+VRTKPGR DS++T SKSCSDKL ++Q TS+LN + ++L + P+YL Y+I+P 
Sbjct: 179 FNYQKKGFVRTKPGRKDSKITLSKSCSDKLSIRQVTSMLNSINWELFDTPIYLKYIIIPN 238

Query: 239 MTTEMKEDIDLCFNKQFERCVG--TRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFI- 295
               + E   +   + FER     + + + +LS S+ F D + T DQ+PS++ +I + + 
Sbjct: 239 ----LDEHALVGLERSFERLCNHPSFNALRFLSGSQTFCDDKITQDQQPSSMSSISLNVH 294

Query: 296 GQGNSIEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQ 355
             G   ++ ILNGVKNG Y K  KPLRKNCE++VSR SQWQ++  I       +YL FK 
Sbjct: 295 NNGEEFQEAILNGVKNGFYVKNKKPLRKNCESIVSRLSQWQLYNTISSNTEHETYLQFKS 354

Query: 356 SQHERRKLIDYTRSKMSPDGWISTQEDDC 384
           +Q ER  L +  +  +SPDGWI T  DDC
Sbjct: 355 TQVERNILKNEAKLCLSPDGWIPTGVDDC 383

>KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 385

 Score =  356 bits (914), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 185/389 (47%), Positives = 255/389 (65%), Gaps = 10/389 (2%)

Query: 1   MAQEHQLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDTNDLRVISLA 60
           M    ++AD+IA+L  + Y  LK S+KP  RSNG KEW V A +VAIN    DLR++SLA
Sbjct: 1   MEVNEEVADKIAELASEYYRKLKPSAKPTVRSNGTKEWNVLACVVAINRANEDLRLVSLA 60

Query: 61  TGVKALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEE---TDLVIHSKD 117
           TGVKA PN++L+RS G++LHD HAEI+ALRGFN V+L+QI  LK+ +     DLV  S D
Sbjct: 61  TGVKAAPNEDLKRSNGRILHDCHAEILALRGFNAVLLKQIQLLKDSQSHPVPDLVSSSSD 120

Query: 118 -SEYYSFKSNLKIALYISQLPCGDISMRMLKERDIAPEELAIKDEDSIQYINQDNKTILR 176
            S  Y        ALYIS+ PCGD SM +L +       ++  D+D  QY++ +NKTI+R
Sbjct: 121 NSGIYRLNEEWSFALYISRAPCGDASMGLLYDEGC----ISFTDDDRCQYVDDNNKTIIR 176

Query: 177 GRLNFNKKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIV 236
           GR N+ KKGYVRTKPGR DS++T SKSC+DKLC KQ  SILN LT+ LLE PV+L+Y+++
Sbjct: 177 GRFNYAKKGYVRTKPGRKDSKVTLSKSCTDKLCSKQVLSILNSLTWDLLEAPVFLEYIVI 236

Query: 237 PGMTTEMKEDIDLCFNKQFERCVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIG 296
           P +    + D +  F+ + +  V    +V  LS S+ F D +   +Q PS + +I + I 
Sbjct: 237 PQLPRVAEADFERAFDTRIKDSVPM-EKVQILSCSQRFDDDKTYENQPPSLMSSILLNII 295

Query: 297 QGN-SIEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQ 355
           +G  + +Q+ILNGVK G++ K   PL+KNCET+VSR SQW +FK+I+      +Y +FK 
Sbjct: 296 EGQVTQQQSILNGVKCGAFVKPPNPLKKNCETVVSRASQWSLFKQIKGGVDSQTYREFKS 355

Query: 356 SQHERRKLIDYTRSKMSPDGWISTQEDDC 384
            Q +R  L +  R  +S DGW+ T+ DDC
Sbjct: 356 QQTDRNALKERIRLALSKDGWVGTESDDC 384

>Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]
           {ON} YGL243W (TAD1) - tRNA-specific adenosine deaminase
           1 (TAD1); Tad1p/scADAT1 [contig 344] FULL
          Length = 383

 Score =  355 bits (910), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 183/387 (47%), Positives = 250/387 (64%), Gaps = 10/387 (2%)

Query: 1   MAQEHQLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDTNDLRVISLA 60
           M Q H LAD+I+DL    Y+ LK S+KPV RSNG+KEW V A ++AI  D   LR++SLA
Sbjct: 1   MDQPHDLADKISDLAFSYYEKLKPSAKPVIRSNGVKEWNVLACVIAIGPDQG-LRLVSLA 59

Query: 61  TGVKALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQL---KNGEETDLVIHSKD 117
           TGVK+ PN EL+RS G++LHD HAEI+ALRGFN V+L+QI  L   K     DLV  S D
Sbjct: 60  TGVKSTPNDELKRSNGRILHDCHAEILALRGFNMVLLKQIQMLVDPKAAVVPDLVSPSSD 119

Query: 118 SE-YYSFKSNLKIALYISQLPCGDISMRMLKERDIAPEELAIKDEDSIQYINQDNKTILR 176
            +  +    +   ALYIS++PCGD SM +L+       ++   ++ S QY+N  N+TILR
Sbjct: 120 EDGKFKLGDDWSFALYISRIPCGDASMDLLQSE----SDMEFSEDTSCQYVNPCNRTILR 175

Query: 177 GRLNFNKKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIV 236
           GR N+NK+GYVRTKPGR DS LT SKSCSDKLC +Q  SILN +T+ L+E P++L Y++V
Sbjct: 176 GRFNYNKRGYVRTKPGRKDSSLTLSKSCSDKLCYRQVMSILNAMTWDLMESPIFLKYIVV 235

Query: 237 PGMTTEMKEDIDLCFNKQFERCVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIG 296
           P ++   +   +  F  +     G +  V  L   K+F D +   +Q PS++  I +   
Sbjct: 236 PKVSNTARRGFESAFKDRLREFPGIK-SVELLECPKQFPDDKFELNQVPSSVSGILLNTN 294

Query: 297 QGNSIEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQS 356
            G   +Q+ILNGVK+G+Y ++ KPLRKNCET++SR +QW +FK+++    + SY  FK  
Sbjct: 295 DGQPEQQSILNGVKSGAYVREPKPLRKNCETMISRLAQWTLFKKVKDYSDKKSYQAFKGE 354

Query: 357 QHERRKLIDYTRSKMSPDGWISTQEDD 383
           Q  R  L +  RS +S DGWIST  DD
Sbjct: 355 QVARNVLKNKVRSSLSSDGWISTGPDD 381

>TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa]
           {ON} Anc_3.566 YGL243W
          Length = 402

 Score =  347 bits (891), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 188/389 (48%), Positives = 260/389 (66%), Gaps = 13/389 (3%)

Query: 6   QLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDTND--LRVISLATGV 63
           +L DRIA L + +Y  L S+ KPV RSNG KEWTV +GIVAI+  + D  LR++S+ TGV
Sbjct: 9   RLGDRIAKLFEDEYLKLSSACKPVIRSNGSKEWTVLSGIVAIDHLSVDKKLRLVSIGTGV 68

Query: 64  KALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGE--ETDLVIHSKDSEYY 121
           KALP+  LERS G+M+HD HAEI+ALRGFNTV+L+ +  +   +  ETDL I    +   
Sbjct: 69  KALPDATLERSHGRMVHDCHAEILALRGFNTVLLEHMNYMVTEQCGETDL-IERTTAGVC 127

Query: 122 SFKSNLKIALYISQLPCGDISMRMLKERDIA----PEELAIKDEDSIQYINQDNKTILRG 177
             KS  K+ALYIS LPCGD SM+ L+  +       +EL  ++   IQ+I+Q  ++ILRG
Sbjct: 128 ILKSKWKLALYISTLPCGDASMKDLQTYNNTDTNRKQELTFEENTEIQWIDQKIRSILRG 187

Query: 178 RLNFNKKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVP 237
           R N+++ G VRTKPGR DSQ+T SKSCSDKLC+KQ TSILN LT+ L+ QPV+LDY+++P
Sbjct: 188 RFNYDRLGVVRTKPGRYDSQITFSKSCSDKLCIKQVTSILNSLTWSLMAQPVFLDYLVIP 247

Query: 238 GMTTEMKEDIDLCFNKQFERCVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIG- 296
            +  +  + +   F  +  R      E+  L  +  F D +++  +EPS++ ++K+F+  
Sbjct: 248 NLAVDRCQGVHHSFQDRLGRLPQKSLEL--LECNVPFFDNKSSKSEEPSSMSSVKLFLDL 305

Query: 297 -QGNSIEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQ 355
            +    EQ ILNG+KNG YTK NKPLRKNCE+ VSR +QW+I+  I P   Q +YL+FK 
Sbjct: 306 PERKCTEQAILNGLKNGFYTKGNKPLRKNCESAVSRLAQWKIYVNIRPDAKQQTYLEFKA 365

Query: 356 SQHERRKLIDYTRSKMSPDGWISTQEDDC 384
              ER ++I   +  +SPDGWIST+ DDC
Sbjct: 366 GLSERNRIIQEVKKVLSPDGWISTRNDDC 394

>TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566
           YGL243W
          Length = 394

 Score =  337 bits (864), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 180/394 (45%), Positives = 262/394 (66%), Gaps = 14/394 (3%)

Query: 4   EHQLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAI-NTDTNDLRVISLATG 62
           + +L D+IA LL ++Y+ LK S+KP+ +SNGIKEWT+ +GIVA+ N DTN ++VISLATG
Sbjct: 3   KRELGDKIAALLFREYNKLKKSNKPIKKSNGIKEWTIISGIVAVSNKDTNIIKVISLATG 62

Query: 63  VKALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQI--YQLKNGEETDLVIHSKDSE- 119
           VKA P+ EL+RS G ++HD HAEI+A+RGFNT +L++I   ++ +    DL+   ++S+ 
Sbjct: 63  VKATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSKC 122

Query: 120 -YYSFKSNLKIALYISQLPCGDISMRMLKERDIAPEELA-IKDEDSIQYINQDNKTILRG 177
             YS+     + LYIS+LPCGD SM   +E  +    L   ++ D  QY++   +TILRG
Sbjct: 123 KKYSWNDEYDLGLYISKLPCGDSSME--EENSLESNSLIQFQENDLTQYVDPTIRTILRG 180

Query: 178 RLNFNKKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVP 237
           R+N+NK G VRTKPGR+DS++T SKSCSDK+C+KQ  S+LN L  +LLE P+Y+ Y++ P
Sbjct: 181 RINYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVLSLLNSLNTELLESPIYIKYLVCP 240

Query: 238 GMTTE----MKEDIDLCFNKQFERCVGTR-HEVCYLSTSKEFKDTRNTSDQEPSAIGAIK 292
            +  +    +K+  +   N + E     R H + ++ +S +F+D +    QEPS    +K
Sbjct: 241 DIKPQNLILLKKSFNRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVVK 300

Query: 293 VFIGQGN-SIEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYL 351
           +F       +EQ+I+NGVK G+YTKK+KPL KN  T+VSR  QW IFK I P++ Q SYL
Sbjct: 301 IFNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYSYL 360

Query: 352 DFKQSQHERRKLIDYTRSKMSPDGWISTQEDDCL 385
            FK+ Q +R +  +  R  +S DGWIST  DD +
Sbjct: 361 TFKRFQTDRIETRNRIRKCLSQDGWISTFNDDII 394

>Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {ON}
           similar to Ashbya gossypii AFR267W
          Length = 387

 Score =  337 bits (863), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 185/384 (48%), Positives = 243/384 (63%), Gaps = 9/384 (2%)

Query: 7   LADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDTNDLRVISLATGVKAL 66
           LA+ +++L+ ++YD+LK S+KP  +SNGIKEWTV AGIVAI+ +TN+LR+IS+ATGVKAL
Sbjct: 8   LAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTNELRLISVATGVKAL 67

Query: 67  PNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQL-KNGEET-DLVIHSKDSEYYSFK 124
           PN+ELERS G+MLHD HAEI+ALR FN V+L+Q+  L  N  ET DLV     +  Y  +
Sbjct: 68  PNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHPYRMR 127

Query: 125 SNLKIALYISQLPCGDISMRMLKERDIAPEELAIKDEDSIQYINQDNKTILRGRLNFNKK 184
              KIALYIS+ PCGD SM +L E D    + +   +D  QYIN   +T LRGR N++ K
Sbjct: 128 KRWKIALYISRPPCGDCSMDILGEDDTNYMQFSF--DDCCQYINPGIRTTLRGRFNYDCK 185

Query: 185 GYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVPGMTTEMK 244
           G  RTKPGR DS++T SKSCSDKL  KQ  SILN   ++LLE PV+L Y+++P    E  
Sbjct: 186 GVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQHHREKA 245

Query: 245 EDIDLCFNKQFERCVGTR--HEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIGQGN-SI 301
            D   C      R +G    H +  +  SK+F   +    Q P  I  + + I      I
Sbjct: 246 SDG--CLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIKPMEMDI 303

Query: 302 EQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQSQHERR 361
           E+ ILNGV NG Y K  +PLRKNCE+++SR S W +F ++    +  SYLDFK  Q  R 
Sbjct: 304 EEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQTSRN 363

Query: 362 KLIDYTRSKMSPDGWISTQEDDCL 385
           +L +  R  +S DGWI T  DDC 
Sbjct: 364 QLKEQVRLHLSSDGWIPTSADDCF 387

>AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL243W (TAD1)
          Length = 385

 Score =  327 bits (839), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 165/382 (43%), Positives = 239/382 (62%), Gaps = 9/382 (2%)

Query: 6   QLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDTNDLRVISLATGVKA 65
           +LA+ I   + ++Y   K SSKP  RSNG  EWTV AG+V ++  T + R++S ATGVKA
Sbjct: 5   KLAEAICAQVIRQYGNFKPSSKPARRSNGSHEWTVLAGVVLVDRQTAECRLVSAATGVKA 64

Query: 66  LPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGE--ETDLVIHSKDSEYYSF 123
           LP+KELERS G+M+HD HAEI+ALRGFN V+LQQ   + +G   E DLV  +K  + +  
Sbjct: 65  LPDKELERSHGRMVHDSHAEILALRGFNAVLLQQAKLVTDGRSAECDLVEQAKTQDRFRL 124

Query: 124 KSNLKIALYISQLPCGDISMRMLKERDIAPEELAIKDEDSIQYINQDNKTILRGRLNFNK 183
            S  + ALYIS+ PCGD SM M  +     +E+    +D IQY+ + N T+LRGR N+++
Sbjct: 125 ASRWQAALYISKAPCGDCSMDMADDDA---DEMTFSPDDPIQYVAEHNYTMLRGRFNYSR 181

Query: 184 KGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVPGMTTEM 243
           KG  RTKPGR DSQ+T SKSCSDKL  K   S+L+ +T++L E+PV+LDY+++P   T  
Sbjct: 182 KGVARTKPGRADSQITLSKSCSDKLASKTVMSLLSSMTWELFEEPVFLDYLVLP--HTIA 239

Query: 244 KEDIDLCFNKQFERCVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIGQGNSIEQ 303
               + CF ++     GT H    L     F   R    Q P+   ++ + I     +EQ
Sbjct: 240 TAGFERCFAERLAGLEGT-HMPRLLCCHTAFPGDRAAPQQPPALTASVYLNITAKKHVEQ 298

Query: 304 TILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQSQHERRKL 363
            +LNGV+NG+Y +  + L  + ET+VSR + W++F ++  +   +SY  FK+ QH R +L
Sbjct: 299 ALLNGVRNGAYVRPPRALAAHAETIVSRAALWRVFMQLH-QAPPLSYAAFKRQQHARNRL 357

Query: 364 IDYTRSKMSPDGWISTQEDDCL 385
             + R ++SPDGW +T+ DDC+
Sbjct: 358 KRHVRHRLSPDGWPTTRVDDCI 379

>TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {ON}
           Anc_3.566 YGL243W
          Length = 396

 Score =  324 bits (831), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 166/388 (42%), Positives = 250/388 (64%), Gaps = 11/388 (2%)

Query: 4   EHQLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDTNDLRVISLATGV 63
           ++ +A++++  +  +Y  L+ SSKPV +SN + EWTV AGI+AIN +T +   I++ TGV
Sbjct: 13  DNYIAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETGEFETIAITTGV 72

Query: 64  KALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEETDLVIHSKDSEYYSF 123
           KA P+ +L+RS GK++HD HAEI+ALR FN  +L  I ++ N + T   +    +  Y +
Sbjct: 73  KATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSKFVQVTKTNSYEW 132

Query: 124 KSNLKIALYISQLPCGDISM-RMLKERDIAPEELAIKDEDSIQYINQDNKTILRGRLNFN 182
                +ALYIS+LPCGD SM  ++K  D A  E  I D++ +QYI+  NKT +RGRLN+ 
Sbjct: 133 NKKWDLALYISKLPCGDASMDDLMKVGDTA--EFEITDDNPLQYIDPKNKTTIRGRLNYK 190

Query: 183 KKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVPGMTTE 242
           K+  +RTKPGR DS++T SKSC+DKLCMKQ   IL+     L++ P++L Y+I+P ++  
Sbjct: 191 KRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPRISG- 249

Query: 243 MKEDI-DLCFNKQFERCVGTRHEVCYLSTSKEFKDTRN--TSDQEPSAIGAIKVFIGQGN 299
            KE I    F  +         E  ++S    F D  +  T  +EP+ + +IK+F+    
Sbjct: 250 -KESILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFMDNNR 308

Query: 300 SIEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQM---SYLDFKQS 356
            +EQ+I+NGVKNG Y+K  KPLRKNCE ++SR+S+W + K+IE   +++   SYL+FK +
Sbjct: 309 VMEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLEFKST 368

Query: 357 QHERRKLIDYTRSKMSPDGWISTQEDDC 384
             +R  L    RS +SPDGWI+T++DDC
Sbjct: 369 LTKRMTLQQEVRSLLSPDGWITTKKDDC 396

>Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  323 bits (827), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 177/389 (45%), Positives = 257/389 (66%), Gaps = 12/389 (3%)

Query: 1   MAQEHQLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDT--NDLRVIS 58
           M  + +LA++I+  +  +Y  LK+  +PV R +GI+EWT+ AG+ AIN +   ++++V+S
Sbjct: 1   MPTKDELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLS 60

Query: 59  LATGVKALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQI--YQLKNGEETDLVIHSK 116
           +ATGVK+LP+ EL+RS GK+LHD HAEI+ALRG NTV L  I  + L NG+  DL+  + 
Sbjct: 61  IATGVKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGD--DLIESNN 118

Query: 117 D-SEYYSFKSNLKIALYISQLPCGDISMRMLKER-DIAPEELAIKDEDSIQYINQDNKTI 174
           +    +  K   ++ALYIS+LPCGD SM  L +      + L I D+D+ QY++ D KTI
Sbjct: 119 EIPPKFRLKDKWELALYISKLPCGDASMDFLNDNCRSDDDFLEIDDDDTFQYVDPDVKTI 178

Query: 175 LRGRLNFNKKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYM 234
           LRGRLNF KK  VRTKPGR DS +T SKSCSDKL M+Q +SILN L   L  QPV+L Y+
Sbjct: 179 LRGRLNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQSSSILNSLNSALFAQPVFLRYI 238

Query: 235 IVPGMTTEMKEDIDLCFNKQFERCVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVF 294
           ++P +  + +  ++  F+ +   C    H   +L+    F D +   +  PS + + K+F
Sbjct: 239 VIPNLDEKTRHTLEQSFHNRLPFC---SHRFEFLNCHTPFYDDKKDENSVPSLMCSTKLF 295

Query: 295 IGQGNSIEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFK 354
           +   +++E+ ILNG+KNG YTK  KPLRK+CE+ +SRF+QW++F +I+P+Y   SYL FK
Sbjct: 296 MND-STVEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQFK 354

Query: 355 QSQHERRKLIDYTRSKMSPDGWISTQEDD 383
             Q ER +LI   +  +SPDGWI T+ DD
Sbjct: 355 AQQTERNQLITLIKGALSPDGWIPTKTDD 383

>CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} similar
           to uniprot|P53065 Saccharomyces cerevisiae YGL243w TAD1
          Length = 385

 Score =  321 bits (822), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 165/381 (43%), Positives = 254/381 (66%), Gaps = 9/381 (2%)

Query: 10  RIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDTNDLRVISLATGVKALPNK 69
           +I +L+  +Y+ L +  +PV RSNG KE T+ A ++A +T T+   ++++ TGVK+ PN 
Sbjct: 10  KITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSILTITTGVKSTPND 69

Query: 70  ELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEETDLVIHSKDSEYYSFKSNLKI 129
           EL RS GK+LHD HAEI+ALRGFN ++L+ I +   G E++L+ ++ +   + + + L++
Sbjct: 70  ELARSKGKILHDCHAEILALRGFNRLLLEHIKRSMEGIESNLIHNTPNG--FEWNNELEL 127

Query: 130 ALYISQLPCGDISMRMLKERDIAPE-ELAIKDEDSIQYINQDNKTILRGRLNFNKKGYVR 188
            L+IS+LPCG++SM +L+E     E  L  +++D+ QYI  + KTILRGR NFNK+ YVR
Sbjct: 128 TLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRCNFNKRNYVR 187

Query: 189 TKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVPGMTTEMKEDID 248
           TKPGR+DS+ T SKSCSDKL ++  TS+LN LT  ++  P+Y+   ++P + +   E+++
Sbjct: 188 TKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNINSHQIEEMN 247

Query: 249 LCFNKQFERCVGTRHEVCYLSTSK-EFKDTRNTSDQEPSAIGAIKVFIGQGNSIEQTILN 307
           L FN+  +     R    Y+ TS  +F D   + +  PS++ A+K+     +  E+ ILN
Sbjct: 248 LYFNRPMDLHSSARR--LYIHTSHYKFGDDL-SPETPPSSMSALKILFNDNDIQEEQILN 304

Query: 308 GVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQSQ-HERRKLIDY 366
           GVKNG YTK +KPLRKNCE+ VSR+S W +F  +  ++  ++YL+FK+    ER +LI  
Sbjct: 305 GVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKRRYCAERAELIRS 364

Query: 367 TRSKMSPDGWISTQEDDC-LP 386
            +S +S DGW+ST EDDC LP
Sbjct: 365 IKSSLSSDGWLSTAEDDCQLP 385

>KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 380

 Score =  300 bits (768), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 161/387 (41%), Positives = 234/387 (60%), Gaps = 18/387 (4%)

Query: 7   LADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDTNDLRVISLATGVKAL 66
           +ADRIA  +   YD L  S KP  RSNG+ EWTV +GIVA +   +    ISL TGVKA 
Sbjct: 4   IADRIAASVISAYDKLPKSGKPGIRSNGVTEWTVLSGIVAFDELNDRYEPISLGTGVKAT 63

Query: 67  PNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEETDLVIHSKDSEYYSFKSN 126
           PN+EL+RS G+++HD HAE++ LR FN ++L++I  L+NG+++ L+  S D   Y  K  
Sbjct: 64  PNEELQRSNGQIVHDCHAEVICLRAFNALLLKEICDLQNGQKSFLIEKSADG--YKVKDV 121

Query: 127 LKIALYISQLPCGDISMRMLKERDIAPEELAIKDEDSI---QYINQDNKTILRGRLNFNK 183
            K A+YIS++PCGD SM +L+  D +  E   +  +     QY++ +  TI+RGR N+  
Sbjct: 122 WKFAMYISRIPCGDASMNLLEAEDKSECENCQQVGNIFINGQYVHPEIDTIIRGRANYKL 181

Query: 184 KGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVPGMTTEM 243
           +  VRTKPGR DS++T SKSCSDKL MKQ  SI N LT+ LL+ PVYL+++++P      
Sbjct: 182 RKVVRTKPGRADSKITLSKSCSDKLTMKQMISICNALTWSLLQSPVYLEWIVLPKQYQYE 241

Query: 244 KEDIDLCF-----NKQFERCVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIGQG 298
           +  ++  F     N+QF           +L  ++ F   R    Q+PS    + ++ G  
Sbjct: 242 QVQLEDTFWLRLKNQQF-------LPFKFLFCNETFSADRTNLSQQPSLSSCVSLY-GSN 293

Query: 299 NSIEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQSQH 358
            ++ + ILNGVKNG Y K  KPLRK C++++SR +QW  FK+I+   S   Y  FK S  
Sbjct: 294 EAVSEVILNGVKNGFYVKGKKPLRKGCQSIISRCAQWSAFKKIKAMPSDTDYYGFKSSVV 353

Query: 359 ERRKLIDYTRSKMSPDGWISTQEDDCL 385
           +R  +I   ++ +S  GWIST  D+C+
Sbjct: 354 DRNHIISKAKATLSASGWISTCRDNCI 380

>KAFR0G01900 Chr7 (403294..404574) [1281 bp, 426 aa] {ON} 
          Length = 426

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 42/84 (50%), Gaps = 4/84 (4%)

Query: 97  LQQIYQLKNGEETDLVIHSKDSEYYSFKSNLKIALYISQLPCGDISMRMLKERDIAPEEL 156
           + +I  L +G +T +++ S++     FK  +K+  +I Q   G  +        + P +L
Sbjct: 104 VSKISYLGSGYDTTVLVMSQNGSLGWFKDGIKVPFHIVQEMMGPATSYSAIHSHVRPGDL 163

Query: 157 AIKDEDSIQYINQDNKTILRGRLN 180
           A+ D      ++ DN+TI++ + N
Sbjct: 164 AVSDFS----LSFDNETIVKSQSN 183

>TDEL0G02090 Chr7 complement(408090..410153) [2064 bp, 687 aa] {ON}
           Anc_1.170 YJL168C
          Length = 687

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 45/90 (50%), Gaps = 18/90 (20%)

Query: 300 SIEQTILNGVKNGSYTK-------KNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLD 352
           ++ +T  NG+ +    K       K KPL + CE L+++++ ++ +K I+ K       D
Sbjct: 385 ALPKTTKNGITSSQIDKEILRLQDKQKPLAEECEKLLAKWNDFETYKRIDKK-------D 437

Query: 353 FKQSQHERRKLIDYTRSKMSPDGWISTQED 382
            K++ + +   +D  R ++ P GW    E+
Sbjct: 438 IKEASNRK---VDLRRIRLPP-GWEVVHEN 463

>ZYRO0C02640g Chr3 complement(209471..210673) [1203 bp, 400 aa] {ON}
           similar to uniprot|Q12383 Saccharomyces cerevisiae
           YOL125W Hypothetical ORF
          Length = 400

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 31/56 (55%)

Query: 61  TGVKALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEETDLVIHSK 116
           TG+  +  +EL R   +++ +G A+ +  +GFN  +++ + Q  + E   LV+  K
Sbjct: 345 TGLPVVKREELGRMARRIIDEGRAQWIRDKGFNVRLVKYVEQDISLENVALVVEPK 400

>Smik_4.795 Chr4 complement(1394372..1395823) [1452 bp, 483 aa] {ON}
           YDR514C (REAL)
          Length = 483

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 298 GNSIEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSY-LDFKQS 356
           GN    T+L  +K G Y  + +    + ET+  R  +W   ++ EPK   MSY L    +
Sbjct: 382 GNDAYYTLLLILKLGDYNFRRQIGADDLETMGHRIREWFKREKDEPKVVPMSYVLSVMNA 441

Query: 357 QHERRKLIDYTRSK 370
            +   K+ID  R K
Sbjct: 442 NNSNSKVIDKGRKK 455

>AGL156W Chr7 (403828..406560) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR148W (PEP3)
          Length = 910

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 43/101 (42%), Gaps = 14/101 (13%)

Query: 23  KSSSKPVARSNGIKEWTVFAGIVAINTDTNDLRVISLATGVKALPNKELERSGGKM---- 78
           K+S       N    W   AGIV  NT T+      + +  K L N EL  S   +    
Sbjct: 212 KTSGTRFTAHNSTFAWVTQAGIVFGNTKTS-----PVLSSAKLLLNIELPPSNSHIKDIK 266

Query: 79  LHDGHAEIVALRGFNTVILQQIYQLKNGEETDLVIHSKDSE 119
           L D H  ++ LRG   ++   I QL N      VI SK++E
Sbjct: 267 LTDYH--LILLRGSEVIV---INQLNNNIVFQEVIFSKENE 302

>KAFR0A05570 Chr1 (1112905..1116576) [3672 bp, 1223 aa] {ON}
           Anc_4.315 YLR436C
          Length = 1223

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 23/111 (20%), Positives = 54/111 (48%), Gaps = 17/111 (15%)

Query: 198 LTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDY-MIVPGMTTE----MKEDIDL--C 250
            TK+ S    + + ++ S  +   F L+ Q  Y+D+ +I   +T E    +  +++L   
Sbjct: 66  FTKNASLEQLISIYKFPSNTSFTEFNLIFQQFYMDFNLISKTLTVETFNTLVSNVELKKI 125

Query: 251 FNKQFER-------CVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVF 294
            N  F+        C+    ++ +++ S +FKD+ + + Q  + IG++++ 
Sbjct: 126 INSNFQNYKNLIRFCIW---QIIFITNSLDFKDSNSLNVQLETVIGSVRIL 173

>Kpol_1058.45 s1058 (125362..126531) [1170 bp, 389 aa] {ON}
           (125362..126531) [1170 nt, 390 aa]
          Length = 389

 Score = 30.0 bits (66), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 94/226 (41%), Gaps = 52/226 (23%)

Query: 110 DLVIH-SKDSEYYSFKSNLKIALYISQLPCGDISMRMLKERDIAPEELAIKDED------ 162
           DLVIH   DS  +    N+K +  I      DI  ++LK   +  +++ +KDE+      
Sbjct: 51  DLVIHLVFDSVTFKPFMNVKYSKKIDN-EADDIQGKLLKF--LPKDDIIVKDEEKWVDAF 107

Query: 163 -----SIQYINQDNKTILRGRLNFNKKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSIL 217
                S +++N + K    G  +     +V  K G  D  + K           Q   I 
Sbjct: 108 EEEQKSYKFLNDEFKI---GEYSIGDDEFVVYKAGIKDKFINK---------FHQRIQIF 155

Query: 218 NCLTFQLLEQPVYLDYMIVPGMTTEMKEDIDLCFNKQFERCVG--TRHEVCYLSTSKEFK 275
           + L   L+E   Y+D        ++   ++ L FNK+ ++CVG  T ++       KEF 
Sbjct: 156 SLL---LIEAASYID-------DSDPNWELVLSFNKKTKQCVGFVTVYKYWKYEGFKEFD 205

Query: 276 DTRNTSDQEPSAIGAIKVFI--------GQGNSIEQTILNGVKNGS 313
           +  N+  +     G I  F+        G G+++ Q+I N  KN S
Sbjct: 206 NDDNSHYR-----GKISQFLVFPPYQGKGHGSNLYQSIYNTWKNDS 246

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,589,584
Number of extensions: 1912524
Number of successful extensions: 5591
Number of sequences better than 10.0: 33
Number of HSP's gapped: 5703
Number of HSP's successfully gapped: 33
Length of query: 386
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 275
Effective length of database: 40,753,473
Effective search space: 11207205075
Effective search space used: 11207205075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)