Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0I027506.10ON66364927710.0
NCAS0D021906.10ON64564920230.0
KAFR0B065006.10ON63661418220.0
TPHA0M002006.10ON63461018050.0
CAGL0A01067g6.10ON64164717910.0
Kpol_1045.776.10ON65061517700.0
ZYRO0F00484g6.10ON64364917480.0
TBLA0G011106.10ON63863617140.0
SAKL0E00880g6.10ON63660917060.0
TDEL0G046106.10ON63361316930.0
ACR016W6.10ON64061716670.0
KLLA0D00836g6.10ON64061016650.0
KNAG0E027806.10ON65065216640.0
Kwal_56.223506.10ON65864716280.0
KLTH0C11528g6.10ON64265216130.0
Skud_16.146.10ON65262313900.0
YPL263C (KEL3)6.10ON65162113780.0
Suva_16.426.10ON65461913740.0
Smik_6.4716.10ON65161813621e-180
Kpol_1050.695.88ON10842571923e-14
Skud_8.2225.88ON11692591888e-14
Suva_15.3575.88ON11722591889e-14
YHR158C (KEL1)5.88ON11642601842e-13
Smik_8.2425.88ON11682591824e-13
ZYRO0B08228g5.88ON12932631719e-12
NCAS0F005205.88ON10862691621e-10
CAGL0I02090g5.88ON11362691602e-10
TDEL0G011205.88ON10092631565e-10
KNAG0K005605.88ON11042591549e-10
SAKL0H02618g5.88ON10852661522e-09
NDAI0D026005.88ON11672641476e-09
Kwal_14.10195.88ON9782641469e-09
KAFR0B043205.88ON9862761451e-08
KLTH0C01474g5.88ON10562641451e-08
KLLA0E15511g5.88ON9052701379e-08
TPHA0A051705.88ON10162671352e-07
YGR238C (KEL2)5.88ON8822551333e-07
ADL149W5.88ON12112991307e-07
Smik_16.685.88ON8942131281e-06
TPHA0H010805.88ON8282661262e-06
Ecym_20615.88ON13622671243e-06
Suva_7.5305.88ON8941921244e-06
Kpol_1010.625.88ON9732651226e-06
Skud_7.5725.88ON8832561201e-05
TBLA0C065305.88ON11722931201e-05
CAGL0F07997g5.88ON9362581172e-05
KAFR0C028908.157ON145194840.18
ZYRO0C03344g3.15ON658102830.24
KNAG0A011803.15ON67679790.67
Kpol_1049.157.9ON86576790.75
Kwal_55.207568.157ON157551780.92
TDEL0A003403.15ON677119771.1
KLLA0F18975g8.256ON120060761.8
ADR414C7.9ON78472742.5
KLLA0F00374g7.9ON79584734.0
TBLA0A043207.9ON83859724.3
KNAG0G013908.157ON1567104716.4
Ecym_50077.9ON83871707.6
Kpol_1043.528.751ON25089698.3
KNAG0E041807.9ON81928709.3
KAFR0C049107.9ON87863699.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0I02750
         (663 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {O...  1071   0.0  
NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {O...   783   0.0  
KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6...   706   0.0  
TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON...   699   0.0  
CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} simila...   694   0.0  
Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON} (1807...   686   0.0  
ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON...   677   0.0  
TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {O...   664   0.0  
SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON...   661   0.0  
TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.1...   656   0.0  
ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic ho...   646   0.0  
KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON...   645   0.0  
KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {O...   645   0.0  
Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON...   631   0.0  
KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} simila...   625   0.0  
Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}...   540   0.0  
YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}  K...   535   0.0  
Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}...   533   0.0  
Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C ...   529   e-180
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    79   3e-14
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    77   8e-14
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    77   9e-14
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    75   2e-13
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    75   4e-13
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    70   9e-12
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    67   1e-10
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    66   2e-10
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    65   5e-10
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    64   9e-10
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    63   2e-09
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    61   6e-09
Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C...    61   9e-09
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    60   1e-08
KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} simil...    60   1e-08
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    57   9e-08
TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]...    57   2e-07
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    56   3e-07
ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic h...    55   7e-07
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    54   1e-06
TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {O...    53   2e-06
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    52   3e-06
Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON...    52   4e-06
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    52   6e-06
Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON...    51   1e-05
TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]...    51   1e-05
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    50   2e-05
KAFR0C02890 Chr3 (570621..574976) [4356 bp, 1451 aa] {ON} Anc_8....    37   0.18 
ZYRO0C03344g Chr3 complement(259809..261785) [1977 bp, 658 aa] {...    37   0.24 
KNAG0A01180 Chr1 (9765..11795) [2031 bp, 676 aa] {ON} Anc_3.15 Y...    35   0.67 
Kpol_1049.15 s1049 complement(28625..31222) [2598 bp, 865 aa] {O...    35   0.75 
Kwal_55.20756 s55 (545793..550520) [4728 bp, 1575 aa] {ON} YGL19...    35   0.92 
TDEL0A00340 Chr1 (58839..60872) [2034 bp, 677 aa] {ON} Anc_3.15 ...    34   1.1  
KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa...    34   1.8  
ADR414C Chr4 complement(1450330..1452684) [2355 bp, 784 aa] {ON}...    33   2.5  
KLLA0F00374g Chr6 complement(20124..22511) [2388 bp, 795 aa] {ON...    33   4.0  
TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7...    32   4.3  
KNAG0G01390 Chr7 complement(313096..317799) [4704 bp, 1567 aa] {...    32   6.4  
Ecym_5007 Chr5 (13107..15623) [2517 bp, 838 aa] {ON} similar to ...    32   7.6  
Kpol_1043.52 s1043 (102664..103416) [753 bp, 250 aa] {ON} (10266...    31   8.3  
KNAG0E04180 Chr5 complement(833612..836071) [2460 bp, 819 aa] {O...    32   9.3  
KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9...    31   9.9  

>NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {ON}
           Anc_6.10 YPL263C
          Length = 663

 Score = 1071 bits (2771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/649 (81%), Positives = 530/649 (81%)

Query: 15  RAEQKLKKNQAKAEQKDKKKLSKNQNVXXXXXXXXIETVLANFKMEQEKFEKINVELLPQ 74
           RAEQKLKKNQAKAEQKDKKKLSKNQNV        IETVLANFKMEQEKFEKINVELLPQ
Sbjct: 15  RAEQKLKKNQAKAEQKDKKKLSKNQNVDGDDDDLDIETVLANFKMEQEKFEKINVELLPQ 74

Query: 75  GQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWR 134
           GQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWR
Sbjct: 75  GQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWR 134

Query: 135 KITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDI 194
           KITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDI
Sbjct: 135 KITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDI 194

Query: 195 KKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPL 254
           KKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPL
Sbjct: 195 KKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPL 254

Query: 255 PDPRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXXXXILNDCWYLKMKSDLSSIRWERRK 314
           PDPRSGHSWIPVEEGCILWGGYT              ILNDCWYLKMKSDLSSIRWERRK
Sbjct: 255 PDPRSGHSWIPVEEGCILWGGYTKVKSKLKSGQQKGKILNDCWYLKMKSDLSSIRWERRK 314

Query: 315 KLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESLFYNDLFSYNVETNRWFALNL 374
           KLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESLFYNDLFSYNVETNRWFALNL
Sbjct: 315 KLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESLFYNDLFSYNVETNRWFALNL 374

Query: 375 RKNQXXXXXXXXXXXXXXXXXXXXLQDLLNQIXXXXXXXXXXXXXXXXXXXXXXXXXXXX 434
           RKNQ                    LQDLLNQI                            
Sbjct: 375 RKNQKGNKSLKRSNNKNSKEKEKELQDLLNQILEKNNLKDEDDEDDEEVNENEDGSTTAS 434

Query: 435 XXXXXXXXXXXXXXXXXXGVTIMNQLPHPRYNVAMTVVDDLLFIYGGSWELGEKDYFINS 494
                             GVTIMNQLPHPRYNVAMTVVDDLLFIYGGSWELGEKDYFINS
Sbjct: 435 TAATSDDEDTERTTQEAEGVTIMNQLPHPRYNVAMTVVDDLLFIYGGSWELGEKDYFINS 494

Query: 495 FYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSXXXXXXXXXXXXXXXXXXXXIKDQKLV 554
           FYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDS                    IKDQKLV
Sbjct: 495 FYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSDEEDDEDDEEDDDEDDDEEEIKDQKLV 554

Query: 555 AXXXXXXXXXXXVQEMEIPDLRPWLPHPKPFESLRAFYIREGPAFLEWAISNNKHVRGKH 614
           A           VQEMEIPDLRPWLPHPKPFESLRAFYIREGPAFLEWAISNNKHVRGKH
Sbjct: 555 ADDEDEEEEEEDVQEMEIPDLRPWLPHPKPFESLRAFYIREGPAFLEWAISNNKHVRGKH 614

Query: 615 LKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGDVIEKDTSKGASKRR 663
           LKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGDVIEKDTSKGASKRR
Sbjct: 615 LKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGDVIEKDTSKGASKRR 663

>NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {ON}
           Anc_6.10
          Length = 645

 Score =  783 bits (2023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/649 (63%), Positives = 463/649 (71%), Gaps = 22/649 (3%)

Query: 17  EQKLKKNQAKAEQKDKKKLSKNQNVXXXXXXXXIETVLANFKMEQEKFEKINVELLPQGQ 76
           EQK KKNQ+KAEQKDKKK  K  N         I+ VLANFK++QE+FE +NVE + +  
Sbjct: 17  EQKAKKNQSKAEQKDKKKSKKF-NDDEDDDDMDIDQVLANFKLQQEQFEHVNVESISKP- 74

Query: 77  HNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWRKI 136
               + R NS MIT     N   KELL+FGGE+T+PET MTHFYN+L++Y+PD  QWRKI
Sbjct: 75  ----AQRLNSCMITTP---NHSKKELLIFGGEFTNPETSMTHFYNELITYSPDNGQWRKI 127

Query: 137 TSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDIKK 196
           TSQNSPMPRSSAAMC HPSGIA+LHGGEFSSPKQNTFYHYSDTW+LDT TKEWTK+D  K
Sbjct: 128 TSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTKMDSAK 187

Query: 197 SPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPLPD 256
            P  RSGHRI  WKNYF+L GGFKD+G++ T+YFND WCFDI  YKW Q+EFP NHP+PD
Sbjct: 188 GPPGRSGHRITIWKNYFILSGGFKDLGHS-TSYFNDCWCFDITTYKWKQIEFPPNHPIPD 246

Query: 257 PRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXXXXILNDCWYLKMKSDLSSIRWERRKKL 316
            RSGHSWIP EEGCILWGGY               ILNDCWYLKMKSDLS +RWERRKK 
Sbjct: 247 ARSGHSWIPTEEGCILWGGYC--KVKAGKGLQKGKILNDCWYLKMKSDLSQVRWERRKKQ 304

Query: 317 GFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESLFYNDLFSYNVETNRWFALNLRK 376
           GFQPSPRVGCSMAYHKGRGILFGGVYDF+ETEESLES+FYNDLFSYNVE+NRWF+L+LRK
Sbjct: 305 GFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSYNVESNRWFSLSLRK 364

Query: 377 NQXXXXXXXXXXXXXXXXXXXXLQDLLNQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 436
            Q                    LQDLLNQI                              
Sbjct: 365 AQKFKKVAKSSNNKSSKEKEKELQDLLNQILEKNNLKDDDDDDEISTGTETETETAANSD 424

Query: 437 XXXXXXXXXXXXXXXXGVTIMNQLPHPRYNVAMTVVDDLLFIYGGSWELGEKDYFINSFY 496
                            VT+M+QLPHPR+N A TVVDD LFIYGG WE+GEKDY I+S Y
Sbjct: 425 DEDNKEHSKSAQ-----VTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGEKDYAIDSLY 479

Query: 497 SIDLNRIDGVTCYWEDLKEIEKAKELGEQDSXXXXXXXXXXXXXXXXXXXXIKDQKLVA- 555
           SIDLN++DGV+CYWEDL+EIEKAKE+GEQDS                     +D+KLVA 
Sbjct: 480 SIDLNKLDGVSCYWEDLQEIEKAKEIGEQDSDEDEEEEDDEEDDDEEEI---EDKKLVAE 536

Query: 556 -XXXXXXXXXXXVQEMEIPDLRPWLPHPKPFESLRAFYIREGPAFLEWAISNNKHVRGKH 614
                        +EMEIPDLRPWLPHPKPFESLRAFYIREG AFLEWAISNNKHVRGKH
Sbjct: 537 EDDEEEEEEEEEFEEMEIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISNNKHVRGKH 596

Query: 615 LKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGDVIEKDTSKGASKRR 663
           LKKKSF+LCEDRWWERRDQ+RIEEDKLEELGVVG+VIEKDTS   SKRR
Sbjct: 597 LKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKRR 645

>KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6.10
           YPL263C
          Length = 636

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/614 (57%), Positives = 413/614 (67%), Gaps = 25/614 (4%)

Query: 50  IETVLANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEY 109
           IE +L NFK EQE +EKIN+E + +      S R+N S+I++ +      KELL+FGGE+
Sbjct: 48  IEEILENFKKEQENYEKINIESVEKP-----SIRNNGSIISSTTK-----KELLLFGGEH 97

Query: 110 TSPETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPK 169
           TS E   T FYNDL +++PD  QW++ITSQNSPMPRSSAAM  HPSGIA+L+GGEFSSPK
Sbjct: 98  TSKELQTTKFYNDLYTFSPDNNQWKRITSQNSPMPRSSAAMAAHPSGIALLNGGEFSSPK 157

Query: 170 QNTFYHYSDTWILDTSTKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNY 229
           Q+TFYHYSDTWILD +TKEWTK++ K  PV RSGHRI  WKNYF+LFGGFKD+G++ T Y
Sbjct: 158 QSTFYHYSDTWILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHS-TTY 216

Query: 230 FNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXX 289
           +NDVW FDI  YKW QVEFPKNH LPD RSGHS IP  EGCI++GGY             
Sbjct: 217 YNDVWLFDITTYKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYC--KIKAKKGLQK 274

Query: 290 XXILNDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEE 349
             +L+ CW LKMK+D+ +IRWERR+K GFQPSPRVGCSMAYHKGRGILFGGVYDFDETEE
Sbjct: 275 GKLLSGCWNLKMKADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEE 334

Query: 350 SLESLFYNDLFSYNVETNRWFALNLRKNQXXXXXXXXXXXXXXXXXXXXLQDLLNQIXXX 409
           SLES+FYNDLF+YN+E+NRWF + L+K                      LQDLLNQI   
Sbjct: 335 SLESIFYNDLFTYNIESNRWFNVTLKKRSNATKTISSTKNKSSKEKERELQDLLNQILEK 394

Query: 410 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVTIMNQLPHPRYNVAM 469
                                                       +  + QLPHPR+N   
Sbjct: 395 NNLKPDDEEEEESSDIFGSDDEDDEEQKNKID------------IKTVTQLPHPRFNATT 442

Query: 470 TVVDDLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSXX 529
           TV+DD+L+IYGG+WE GE DY I+SFYSIDLN++DGV  YWEDL EIE AKELGEQ S  
Sbjct: 443 TVIDDMLYIYGGAWEFGEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKELGEQGSED 502

Query: 530 XXXXXXXXXXXXXXXXXXIKDQKLVAXXXXXXXXXXXVQEMEIPDLRPWLPHPKPFESLR 589
                                                  EMEIPD RPWLPHPK FESLR
Sbjct: 503 EDEDDFEEDEEDGEEEVEDTKLIAEDVEDEKEEEEEEYPEMEIPDPRPWLPHPKAFESLR 562

Query: 590 AFYIREGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGD 649
           AFY+REGPAFLEWAISNN+H RGK LK+KSFELC+DRWWERRDQI IEEDKLEE+GVVGD
Sbjct: 563 AFYLREGPAFLEWAISNNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGD 622

Query: 650 VIEKDTSKGASKRR 663
           V+E+DTSK  SKRR
Sbjct: 623 VVERDTSKAVSKRR 636

>TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON}
           Anc_6.10 YPL263C
          Length = 634

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/610 (58%), Positives = 412/610 (67%), Gaps = 27/610 (4%)

Query: 53  VLANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSP 112
           VLANFK EQE+FE+INVE +     +  + R NS MI A   H KK  ELL+FGGE TS 
Sbjct: 52  VLANFKKEQEQFEQINVESV-----DKPTRRINSCMI-ANPNHGKK--ELLLFGGENTSQ 103

Query: 113 ETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNT 172
           E G+THFYNDL ++TPD   W+KITSQNSPMPRSSAAM  HPSGIA+LHGGEFSSPKQNT
Sbjct: 104 EQGVTHFYNDLYTFTPDNDLWKKITSQNSPMPRSSAAMAAHPSGIALLHGGEFSSPKQNT 163

Query: 173 FYHYSDTWILDTSTKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFND 232
           FYHYSDTW+LD +T+EWTKV+ K  P ARSGHRI  WKNYF+L GGF+D+G+  T+Y ND
Sbjct: 164 FYHYSDTWLLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGST-TSYLND 222

Query: 233 VWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXXXXI 292
            W FDI +YKW Q+EFP NHP+PD RSGHS IP +EG +LWGGY               I
Sbjct: 223 SWLFDITSYKWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYC--KVKAGKGLQKGKI 280

Query: 293 LNDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLE 352
           L DCWYLKMK+D S++RWERRKK GFQPSPRVGCSM +HKGRGILFGGVYDF+ETEESL+
Sbjct: 281 LGDCWYLKMKADPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLD 340

Query: 353 SLFYNDLFSYNVETNRWFALNLRKNQXXXXXXXXXXXXXXXXXXXXLQDLLNQIXXXXXX 412
           S+FYNDLFSY +E+NRW+AL LR  +                    LQ++LN+I      
Sbjct: 341 SIFYNDLFSYQIESNRWYALQLRSQR---KKVVRLNNKSSKEKELELQNILNEILEKANL 397

Query: 413 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVTIMNQLPHPRYNVAMTVV 472
                                                      + NQLPH R+N + TVV
Sbjct: 398 KDDDEDANELSNGLGSDSDSDDESEKVSKKE----------YIVRNQLPHHRFNASTTVV 447

Query: 473 DDLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSXXXXX 532
           DD LFIYGG WELGEKDY I+S YSIDLN++DGVT YWE+L +IEKAKELG  +S     
Sbjct: 448 DDTLFIYGGVWELGEKDYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKELGAINSDEEDE 507

Query: 533 XXXXXXXXXXXXXXXIKDQKLVAXXXXXXXXXXXVQEMEIPDLRPWLPHPKPFESLRAFY 592
                            DQKLVA             +MEIPD RPWLPHPK FESLR FY
Sbjct: 508 EDEDDEDDDEEETV---DQKLVAEEEEEEEEIEDADDMEIPDPRPWLPHPKAFESLRNFY 564

Query: 593 IREGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGDVIE 652
           +R G +FLEWAISNNKH RGKHLK KSFELC+DRWWERRDQ+RIEEDKLEELG VG+VIE
Sbjct: 565 VRTGASFLEWAISNNKHTRGKHLKTKSFELCQDRWWERRDQVRIEEDKLEELGGVGEVIE 624

Query: 653 KDTSKGASKR 662
           KDT+K   +R
Sbjct: 625 KDTTKSTKRR 634

>CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263c KEL3
          Length = 641

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/647 (55%), Positives = 431/647 (66%), Gaps = 21/647 (3%)

Query: 17  EQKLKKNQAKAEQKDKKKLSKNQNVXXXXXXXXIETVLANFKMEQEKFEKINVELLPQGQ 76
           EQKLKKNQAKAE KDKK+  K   +        IE VLANFK EQE+FEK+ V+ +    
Sbjct: 16  EQKLKKNQAKAESKDKKRAKK---LDEDDDDMDIEEVLANFKKEQEQFEKVAVDSV---- 68

Query: 77  HNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWRKI 136
            + ++ R N  M+   SA + K KEL++FGGE+T+P+T  T FYNDL ++TP+  QW++ 
Sbjct: 69  -DKVNKRLNPCMVGNPSASSSK-KELIVFGGEFTNPQTSTTTFYNDLHTFTPENNQWKRY 126

Query: 137 TSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDIKK 196
           TSQN+PMPRSSAAM  HPSGIA+LHGGEFSSPKQNTFYHYSDTWILD +TKEW KVD K 
Sbjct: 127 TSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWILDCNTKEWAKVDAKV 186

Query: 197 SPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPLPD 256
            P ARSGHRI  WKN+F+L GGF+D+G + T Y +D W FDI  YKW QVEFP NH +PD
Sbjct: 187 GPSARSGHRITVWKNFFILHGGFRDLGTS-TTYLSDCWLFDITTYKWKQVEFPSNHQVPD 245

Query: 257 PRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXXXXILNDCWYLKMKSDLSSIRWERRKKL 316
            RSGHS+IP  EG ILWGGY               IL+DCWYLKMKSD+S IRWERR+K 
Sbjct: 246 ARSGHSFIPTAEGAILWGGYC-KVKANKKGYQKGKILSDCWYLKMKSDISGIRWERRRKQ 304

Query: 317 GFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESLFYNDLFSYNVETNRWFALNLRK 376
           GFQPSPRVGCSMAYHKGRGILFGGVYDF+ETEESLES F+NDLFSY++E+NRW++L++R 
Sbjct: 305 GFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLFSYHIESNRWYSLSIRS 364

Query: 377 NQXXXXXXXXXXXXXXXXXXXXLQDLLNQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 436
            +                    L+ LL+ I                              
Sbjct: 365 RKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSDDDEDDEEINTALAKVDLED 424

Query: 437 XXXXXXXXXXXXXXXXGVTIMNQLPHPRYNVAMTVVDDLLFIYGGSWELGEKDYFINSFY 496
                             TI+ QLPHPR+N   TV+DD LFI+GG WELG+K++ I+S Y
Sbjct: 425 EEEEQLAVQH--------TILTQLPHPRFNATTTVIDDTLFIFGGIWELGDKEFMIDSLY 476

Query: 497 SIDLNRIDGVTCYWEDLKEIEKAKELGEQDSXXXXXXXXXXXXXXXXXXXXIKDQKLVAX 556
           SIDLN++DGVT YWEDLKEIE+AKELG +                       +  +    
Sbjct: 477 SIDLNKLDGVTMYWEDLKEIERAKELGVE-DSDFEDDDEDDDDEDDDEEDDNEKDEGDDE 535

Query: 557 XXXXXXXXXXVQEMEIPDLRPWLPHPKPFESLRAFYIREGPAFLEWAISNNKHVRGKHLK 616
                      +E+E PD RPWLPHPKPFE+LRAFYIREG AFLEWAISNNK+ +GKHLK
Sbjct: 536 ESEEEEEEEIEEELEYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAISNNKNAKGKHLK 595

Query: 617 KKSFELCEDRWWERRDQIRIEEDKLEELGVVGDVIEKDTSKGASKRR 663
           K SF+LC++RWWERRDQ+RIEEDKLEE+G VGD+IE+D S  +SKRR
Sbjct: 596 KHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKS-ASSKRR 641

>Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON}
           (180710..182662) [1953 nt, 651 aa]
          Length = 650

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/615 (57%), Positives = 401/615 (65%), Gaps = 20/615 (3%)

Query: 53  VLANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSP 112
           VLANFK EQE FE+IN+E + +      S R N  MI      N    EL++FGGE T+ 
Sbjct: 51  VLANFKKEQELFEQINIESVERP-----SRRINPCMIENP---NHGKSELILFGGESTNK 102

Query: 113 ETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNT 172
           +T  T F+NDL SYTP+  QWR+ TS+NSPMPRSSAAM  HPSG+A++HGGEFSSPKQNT
Sbjct: 103 DTSTTQFFNDLYSYTPENDQWRRYTSKNSPMPRSSAAMAAHPSGVALIHGGEFSSPKQNT 162

Query: 173 FYHYSDTWILDTSTKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFND 232
           FYHYSDTW+LD STKEWTKV+ K  P ARSGHRI  WKNYF+L GGF+D+G + T Y ND
Sbjct: 163 FYHYSDTWLLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTS-TTYLND 221

Query: 233 VWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXXXXI 292
            W FDI NYKW Q+EFP NHP+PD RSGHS+IP +EG +LWGGY               I
Sbjct: 222 CWLFDITNYKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYC--KVKAGKGLQKGKI 279

Query: 293 LNDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLE 352
           L DCWYLKMK+D ++IRWERRKK GFQPSPRVGCSM +HKGRGILFGGVYDF+ETEESL+
Sbjct: 280 LTDCWYLKMKADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLD 339

Query: 353 SLFYNDLFSYNVETNRWFALNLRKNQXXXXXXXXXXXXXXXXXXXXLQDLLNQIXXXXXX 412
           S+FYNDLFSY +E NRWFAL LR  +                    LQDLLNQI      
Sbjct: 340 SMFYNDLFSYQIEINRWFALQLRPQR---KKVVRLNNKSSKDKEKELQDLLNQILEKANL 396

Query: 413 XXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXGVTIMNQLPHPRYNVAMT 470
                                                        ++ QLPHPR+N  MT
Sbjct: 397 NDKDDKDQEDEDAKAIETELDRADHDTSDSDADDVEDAKEKKEYKVLTQLPHPRFNATMT 456

Query: 471 VVDDLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSXXX 530
           VV+D LFIYGG WELGEKDY I+SFYSIDLNR DGVT  WEDL EIE AKE G       
Sbjct: 457 VVNDTLFIYGGVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIV-DSDE 515

Query: 531 XXXXXXXXXXXXXXXXXIKDQKLVA---XXXXXXXXXXXVQEMEIPDLRPWLPHPKPFES 587
                            I DQKLVA              V EMEIPD  PWLPHPKPFES
Sbjct: 516 EDDEFGDSDDEDDGEEEIMDQKLVAEEEEEEEEEEEEEQVDEMEIPDPCPWLPHPKPFES 575

Query: 588 LRAFYIREGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLEELGVV 647
           LR FY+R G  FLEWAISNN+  RGKHLKKKSF+LC+DRWW+RRDQ+RIEEDK+EELG +
Sbjct: 576 LRVFYVRTGATFLEWAISNNRDARGKHLKKKSFDLCQDRWWQRRDQVRIEEDKMEELGGI 635

Query: 648 GDVIEKDTSKGASKR 662
           G+VIEKDTSK   +R
Sbjct: 636 GEVIEKDTSKSTKRR 650

>ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 643

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/649 (54%), Positives = 428/649 (65%), Gaps = 21/649 (3%)

Query: 15  RAEQKLKKNQAKAEQKDKKKLSKNQNVXXXXXXXXIETVLANFKMEQEKFEKINVELLPQ 74
           R EQKLKKNQ KAE KDKKK  K            +E VLA+FK EQE+FEK+ VE +  
Sbjct: 15  RGEQKLKKNQGKAELKDKKKAKKVLADDDEDDDMDLEEVLASFKKEQEQFEKVVVESV-- 72

Query: 75  GQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWR 134
              +  S R N  +++   AH KK  EL++FGGEYT+     THFYN+L ++TPD  QWR
Sbjct: 73  ---DKPSARINPCLVSNP-AHGKK--ELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWR 126

Query: 135 KITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDI 194
           KI+SQN+PMPRSSAAM  HPSGIA+LHGGEFSSPKQNTFYHYSDTW+LD +TKEWTK+D 
Sbjct: 127 KISSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQ 186

Query: 195 KKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPL 254
           K  P +RSGHR+  WKN+F+++GGF+D+G + T Y ND W FDI  +KWTQVEFP+NH +
Sbjct: 187 KNGPASRSGHRMTVWKNFFIMYGGFRDLGTS-TTYLNDCWLFDITTHKWTQVEFPRNHLI 245

Query: 255 PDPRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXXXXILNDCWYLKMKSDLSSIRWERRK 314
           PD RSGHS+IP +EG ILWGGY               IL DCWYLKM S  S+IRWERRK
Sbjct: 246 PDARSGHSFIPDQEGAILWGGYC--KVKAGKGLQKGKILTDCWYLKMNSTPSAIRWERRK 303

Query: 315 KLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESLFYNDLFSYNVETNRWFALNL 374
           K GFQPSPRVGCSM  HKGRG+LFGGVYDF+ETEESL+S FYNDLF++ ++TNRW++L+L
Sbjct: 304 KQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSL 363

Query: 375 RKNQXXXXXXXXXXXXXXXXXXXXLQDLLNQIXXXXXXXXXXXXXXXXXXXXXXXXXXXX 434
           R  +                    LQD LN+I                            
Sbjct: 364 RPQR---KKQVKISKSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQFEDENQ 420

Query: 435 XXXXXXXXXXXXXXXXXXGVTIMNQLPHPRYNVAMTVVDDLLFIYGGSWELGEKDYFINS 494
                               TI  QLPHPR+N ++ VV+D LFIYGG WELG+KDY I+S
Sbjct: 421 SGDEDEEESTKKQH------TISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDS 474

Query: 495 FYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSXXXXXXXXXXXXXXXXXXXXIKDQKL- 553
           FY IDLN++DGVT YWE+L EIEKAK+L EQ S                    ++DQ L 
Sbjct: 475 FYGIDLNKVDGVTVYWENLAEIEKAKKLAEQGSDEDEDDEDEEDEDEDDDEEEVRDQVLV 534

Query: 554 VAXXXXXXXXXXXVQEMEIPDLRPWLPHPKPFESLRAFYIREGPAFLEWAISNNKHVRGK 613
                         +EMEIPD RPWLPHPK FESLRAFY+R GP FLEWAISNN+  RGK
Sbjct: 535 AEEEDAEEDEEVEEEEMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARGK 594

Query: 614 HLKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGDVIEKDTSKGASKR 662
           HLK+KSF+LC+DRWWERRDQ+RIEEDK+EELG VGD++E++ ++   +R
Sbjct: 595 HLKQKSFDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643

>TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {ON}
           Anc_6.10 YPL263C
          Length = 638

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/636 (54%), Positives = 417/636 (65%), Gaps = 27/636 (4%)

Query: 29  QKDKKKLSKNQNVXXXXXXXXIETVLANFKMEQEKFEKINVELLPQGQHNHISPRSNSSM 88
           QKDKK LSK   +        IE +L NFK +QE+FEKIN+E + +      + R NS M
Sbjct: 29  QKDKK-LSKKNQLEEEDDDMAIEDILENFKKQQEQFEKINIETVSKP-----TKRINSCM 82

Query: 89  ITAASAHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSA 148
           I+    H K   EL++FGGE TS     T FYNDL +Y P+  QW+K TSQNSPMPRSS+
Sbjct: 83  ISNP-IHGKN--ELILFGGENTST---TTTFYNDLFTYNPENDQWKKYTSQNSPMPRSSS 136

Query: 149 AMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDIKKSPVARSGHRIVH 208
           AM  HP+GIA+LHGGEFSSPKQNTFYHYSDTW+LD +TKEW+KV+ K  P ARSGHR+  
Sbjct: 137 AMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVENKNGPSARSGHRMTV 196

Query: 209 WKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEE 268
           WKN+ +L GGF+D+G + T Y  D+W FD+  YKWTQVEFP NH +PD RSGHS IP ++
Sbjct: 197 WKNFIILHGGFRDLGTS-TTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARSGHSLIPTQD 255

Query: 269 GCILWGGYTXXXXXXXXXXXXXXILNDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSM 328
           G +LWGGY               IL+DCWYLKMKSD+S IRWERRKK GFQPSPRVGCSM
Sbjct: 256 GALLWGGYC--KVKAGKGLQKGKILSDCWYLKMKSDVSGIRWERRKKQGFQPSPRVGCSM 313

Query: 329 AYHKGRGILFGGVYDFDETEESLESLFYNDLFSYNVETNRWFALNLRKNQXXXXXXXXXX 388
            +HKGRGILFGGV+DF+ETEESL+SLFYNDLF+Y +E NRWF+L++R  +          
Sbjct: 314 VHHKGRGILFGGVFDFEETEESLDSLFYNDLFTYQIEINRWFSLSMRSQR---KKTIKIG 370

Query: 389 XXXXXXXXXXLQDLLNQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 448
                     LQD+LN I                                          
Sbjct: 371 PKTTKDKEKELQDILNSILKKNNLTDDDSEDPNAIEEELKINDDESNSEDESKDGQVTKQ 430

Query: 449 XXXXGVTIMNQLPHPRYNVAMTVVDDLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTC 508
                  +MNQLPH R+N    VV+D L+I+GGSWELGEKDY I+SFYSIDLN++DGVT 
Sbjct: 431 YE-----VMNQLPHVRFNATTAVVNDTLYIFGGSWELGEKDYSIDSFYSIDLNKLDGVTV 485

Query: 509 YWEDLKEIEKAKELGEQDSXXXXXXXXXXXXXXXXXXXXIKDQKLVA-XXXXXXXXXXXV 567
           YWED++EIE AKELGEQ S                    I DQKLVA             
Sbjct: 486 YWEDMEEIEAAKELGEQFS--DEEDEDDEEEDEDDGEEEIVDQKLVAEEDEEEEEIEADE 543

Query: 568 QEMEIPDLRPWLPHPKPFESLRAFYIREGPAFLEWAISNNKHVRGKHLKKKSFELCEDRW 627
            EMEIPD RPWLPHPKPFE+LRAFY+R G  FLEWAISNN+  +GKHLKKKSFEL EDRW
Sbjct: 544 DEMEIPDPRPWLPHPKPFETLRAFYVRTGATFLEWAISNNRDSKGKHLKKKSFELTEDRW 603

Query: 628 WERRDQIRIEEDKLEELGVVGDVIEKDTSKGASKRR 663
           WERRDQ+RIEEDK+EELG + +++E+DT++  +KRR
Sbjct: 604 WERRDQVRIEEDKMEELGGIENIVERDTTQ-VNKRR 638

>SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 636

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/609 (54%), Positives = 401/609 (65%), Gaps = 24/609 (3%)

Query: 54  LANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSPE 113
           LANFK EQEKFE++ V  +     +  + R NSSM+ A   H K+  ELL+FGGE T+  
Sbjct: 52  LANFKREQEKFEEVVVSTV-----DRPTRRINSSMV-ANPLHGKR--ELLLFGGENTNST 103

Query: 114 TGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTF 173
              T FYNDL +Y+ D  QWRKI+SQNSPMPRSSAA+  HPSG+ ++HGGEFSSPKQNTF
Sbjct: 104 NSTTAFYNDLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTF 163

Query: 174 YHYSDTWILDTSTKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDV 233
           YHYSDTW+LD +TKEWTK++ K  P ARSGHR+  WKNYF+L GGF+D+G   T Y +D 
Sbjct: 164 YHYSDTWLLDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLG-TMTTYLSDC 222

Query: 234 WCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXXXXIL 293
           W FDI  YKW QV+FP NHP+PD RSGHS +P  +G +LWGGY               IL
Sbjct: 223 WLFDITTYKWKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYC--KVKAGKGLQKGKIL 280

Query: 294 NDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLES 353
            DCWYLKMKSD+ +IRWERRKK GFQPSPRVGCSM +HKGRGILFGGV+DF+ETEESLES
Sbjct: 281 TDCWYLKMKSDIGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLES 340

Query: 354 LFYNDLFSYNVETNRWFALNLRKNQXXXXXXXXXXXXXXXXXXXXLQDLLNQIXXXXXXX 413
           +FYNDLF++ +ETNRW++ +LR  +                    L+D+LNQI       
Sbjct: 341 MFYNDLFTFQIETNRWYSASLRPQR----KAAKATSKNNRNKDKELEDILNQILEKANLN 396

Query: 414 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVTIMNQLPHPRYNVAMTVVD 473
                                                     I  QLPHPR+N +  VVD
Sbjct: 397 DDENEKETIGDVLKELDEEDSDSAEELNSEKKE-------YPIRIQLPHPRFNASTAVVD 449

Query: 474 DLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSXXXXXX 533
           D LFI+GG WE+GEKDY I+SFY+IDLNR+DG+  YWEDL++IE AKELG+++       
Sbjct: 450 DTLFIFGGVWEIGEKDYSIDSFYAIDLNRLDGIKIYWEDLRDIEMAKELGDEEE--DFED 507

Query: 534 XXXXXXXXXXXXXXIKDQKLVAXXXXXXXXXXXVQEMEIPDLRPWLPHPKPFESLRAFYI 593
                         I DQKLVA             E EIPD RPWLPHPKPFE+LR FY+
Sbjct: 508 NEEDDEEDDDDEEEITDQKLVAEDDDEEEEEEDEYEPEIPDPRPWLPHPKPFETLRGFYV 567

Query: 594 REGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGDVIEK 653
           R G  FLEWAIS+N+  RGKHLKKKSF+LC+DRWWERRDQ+RIEEDKLEELG +G+V+EK
Sbjct: 568 RTGADFLEWAISSNRDARGKHLKKKSFDLCQDRWWERRDQVRIEEDKLEELGGIGEVVEK 627

Query: 654 DTSKGASKR 662
           DTSK   +R
Sbjct: 628 DTSKSKKRR 636

>TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.10
           YPL263C
          Length = 633

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/613 (54%), Positives = 401/613 (65%), Gaps = 28/613 (4%)

Query: 50  IETVLANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEY 109
           IE VLANFK EQE+FEK+ VE + +      S R N SMI A   H K   EL+MFGGE+
Sbjct: 49  IEQVLANFKKEQEQFEKVVVENIERP-----SRRINPSMI-ANPIHGKS--ELIMFGGEH 100

Query: 110 TSPETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPK 169
           T   T  THF+NDL+ ++PD +QW++I+SQNSPMPRSSAAM  HPSG+A+LHGGEFSSPK
Sbjct: 101 TIQSTSTTHFFNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPK 160

Query: 170 QNTFYHYSDTWILDTSTKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNY 229
           QNTFYHYSDTW+LD +TKEWTK++ K  P ARSGHR+  WKN+ +L GGF+D+G + T Y
Sbjct: 161 QNTFYHYSDTWLLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTS-TTY 219

Query: 230 FNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXX 289
            ND W FDI  YKW QVEFP+NHP+PD RSGHS I  +EG ILWGGY             
Sbjct: 220 LNDCWLFDITTYKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYC--KVKAGKGLQK 277

Query: 290 XXILNDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEE 349
             IL DCWYLKM S+ S+IRW+R+K+ GFQPSPRVGCSM  HKGRG+LFGGVYDF+ETEE
Sbjct: 278 GKILTDCWYLKMSSNTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEE 337

Query: 350 SLESLFYNDLFSYNVETNRWFALNLRKNQXXXXXXXXXXXXXXXXXXXXLQDLLNQIXXX 409
           SLES FYND+F+Y +  NRW++L+LR  +                    L+DLLN+I   
Sbjct: 338 SLESNFYNDVFTYQINMNRWYSLSLRPQR---KKQVKLNNRSTKDQEKELEDLLNKILRN 394

Query: 410 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVTIMNQLPHPRYNVAM 469
                                                         IMN+LPHPR+N A 
Sbjct: 395 AQLDDQGEEEEIDAAEESTAVEEDSDESESLDKEH----------VIMNELPHPRFNAAT 444

Query: 470 TVVDDLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSXX 529
            VVDD LFI+GG WE GEKDY I+SFY IDLN+ DGVT YWEDL  +E AK+  + D   
Sbjct: 445 AVVDDTLFIFGGVWEFGEKDYSIDSFYGIDLNKADGVTVYWEDLTALENAKDEDDSDEDE 504

Query: 530 XXXXXXXXXXXXXXXXXXIKDQKLVAXXXXXXXXXXXVQEMEIPDLRPWLPHPKPFESLR 589
                               DQKLVA            +EMEIPD RPWLPHPK FESLR
Sbjct: 505 GEEDDDDEEDSEEEQV----DQKLVAEDEDEEEEEFEEEEMEIPDPRPWLPHPKAFESLR 560

Query: 590 AFYIREGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGD 649
           +FY+R G  FLEWAISNN+HV+GKHLK KSFE+CE RWWERRDQ+R+EEDKLEELG VG+
Sbjct: 561 SFYVRTGATFLEWAISNNRHVKGKHLKTKSFEICESRWWERRDQVRLEEDKLEELGGVGE 620

Query: 650 VIEKDTSKGASKR 662
           +IE+DT+K   +R
Sbjct: 621 IIERDTTKTKKRR 633

>ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL263C (KEL3)
          Length = 640

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/617 (52%), Positives = 401/617 (64%), Gaps = 28/617 (4%)

Query: 50  IETVLANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEY 109
           IE VLANFK +Q +FE +NVE + +        RS+SS++ A   HNK+  EL++FGGEY
Sbjct: 48  IEEVLANFKRQQAEFEAVNVETVERPHQ-----RSSSSLV-ANPLHNKR--ELILFGGEY 99

Query: 110 TSPETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPK 169
           T+  TGMTHFYNDL  Y+ DT QW+K TSQNSPMPRSSAA+  HPSG+ ++HGGEFSSPK
Sbjct: 100 TNQSTGMTHFYNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPK 159

Query: 170 QNTFYHYSDTWILDTSTKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNY 229
           QNTFYHYSDTW+ D +T EWTK++ K  P +RSGHR+  WKNY +L GGF+D+G + T Y
Sbjct: 160 QNTFYHYSDTWLFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTS-TTY 218

Query: 230 FNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXX 289
            ND W FDI  YKW Q++FP NHP+PD RSGHS +P  EG ILWGGY             
Sbjct: 219 LNDCWLFDITTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYC--KVKAGKGLQK 276

Query: 290 XXILNDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEE 349
             IL DCWYLKMKSD+++IRWERRKK GFQPS R GCSM +HKGRGILFGGVYD++ETEE
Sbjct: 277 GKILTDCWYLKMKSDVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEE 336

Query: 350 SLESLFYNDLFSYNVETNRWFALNLRKNQXXXXXXXXXXXXXXXXXXXXLQDLLNQIXXX 409
            L+SLFYNDLF+Y++ETNRW++++LR  +                    L+D+LN I   
Sbjct: 337 GLDSLFYNDLFTYHIETNRWYSVSLRAQR---HSKVKSAPKSNRDKDKELEDMLNAI--- 390

Query: 410 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVTIMNQLPHPRYNVAM 469
                                                         I+ +LPHPR+N + 
Sbjct: 391 -----LKKANLDDDDGDEDGKTIEEELNKLENDGITETEETKKSYPIVMKLPHPRFNAST 445

Query: 470 TVVDDLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSXX 529
            +VDD LFI+GG WE GEKDY I+SFYSID+N++DGV  YWED+  +E+AKELGE+D   
Sbjct: 446 AIVDDTLFIFGGVWEQGEKDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGEEDEDD 505

Query: 530 XXXXXXXXXXXXXXXXXXIKDQKLVAXXXXXXXXXXXVQEMEIPDLRPWLPHPKPFESLR 589
                               D+KLVA               EIPD RPWLPHPK FESLR
Sbjct: 506 AEDDEDDDSEDDDEEEH--SDRKLVAEEEEEEEEEDNEILPEIPDPRPWLPHPKAFESLR 563

Query: 590 AFYIREGPAFLEWAISNNKHVR----GKHLKKKSFELCEDRWWERRDQIRIEEDKLEELG 645
           AFY+R G +FLEWAI+N  + R    GKHLKK SF+LC++RWWERR+Q+RIEEDKLEELG
Sbjct: 564 AFYVRTGASFLEWAITNKHNTRSDAKGKHLKKHSFDLCQERWWERREQVRIEEDKLEELG 623

Query: 646 VVGDVIEKDTSKGASKR 662
            VG+VIEKD +K   +R
Sbjct: 624 GVGEVIEKDFTKPTKRR 640

>KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 640

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/610 (54%), Positives = 398/610 (65%), Gaps = 21/610 (3%)

Query: 54  LANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSPE 113
           LANFK EQE FEKINVE + +        R N  M     AH K+  EL+MFGGE T+ E
Sbjct: 51  LANFKREQENFEKINVENVDRPDQ-----RINPCMFVNP-AHGKR--ELMMFGGESTTQE 102

Query: 114 TGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTF 173
           TG THFYNDL  Y+ DT  W++ TSQNSPMPRSSAA+  HP+G+A++HGGEFSSPKQNTF
Sbjct: 103 TGTTHFYNDLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTF 162

Query: 174 YHYSDTWILDTSTKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDV 233
           YHYSD+W+ D S+KEWTKV+ K  P ARSGHR+  WKN+ +L GGF+D+G + T Y ND+
Sbjct: 163 YHYSDSWLFDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTS-TTYLNDL 221

Query: 234 WCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXXXXIL 293
           W FDI NYKW QVE P NHP+PD RSGHS I   EG +L+GGYT              IL
Sbjct: 222 WVFDITNYKWKQVELPANHPIPDARSGHSLISTAEGAVLYGGYT--KVKAGKGLQKGKIL 279

Query: 294 NDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLES 353
           +DCWYLKMKSDL SIRWERRKK G QPSPRVGCSM +HKGRG+LFGGVYDF+ETEESL S
Sbjct: 280 SDCWYLKMKSDLGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRS 339

Query: 354 LFYNDLFSYNVETNRWFALNLRKNQXXXXXXXXXXXXXXXXXXXXLQDLLNQIXXXXXXX 413
           +FYN+L++Y +E NRW+A++LR  +                    L+D+LNQI       
Sbjct: 340 IFYNELYTYQIENNRWYAMSLRPQR---KKKNFVQSKSNRNKDKELEDILNQI----LDK 392

Query: 414 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVTIMNQLPHPRYNVAMTVVD 473
                                                      M+ LPH R+N A  VVD
Sbjct: 393 ANLRDAEDDDESKVIEEQLNQLDLIDFDDDDESDKKSAKSYETMSTLPHARFNAATAVVD 452

Query: 474 DLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSXXXXXX 533
           D LFI+GG+ E+GEKDY I+SFYSID+N++DGV  YWE+LKE+E+A++LGEQDS      
Sbjct: 453 DTLFIFGGTVEIGEKDYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLGEQDS--DDEF 510

Query: 534 XXXXXXXXXXXXXXIKDQKL-VAXXXXXXXXXXXVQEMEIPDLRPWLPHPKPFESLRAFY 592
                         I D KL               +E EIPDLRPWLPHPK FE+LRAFY
Sbjct: 511 GDEDDDDEDDGEEEIVDSKLEAEDEEEEEEEEEVEEEYEIPDLRPWLPHPKAFETLRAFY 570

Query: 593 IREGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGDVIE 652
           +R GP FLE AIS+N+  +GKHLK KSFELC+DRWWERR+Q+RIEEDKLEELG V DVIE
Sbjct: 571 VRTGPTFLELAISSNRDSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIE 630

Query: 653 KDTSKGASKR 662
           KDTSK   +R
Sbjct: 631 KDTSKTQRRR 640

>KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {ON}
           Anc_6.10 YPL263C
          Length = 650

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/652 (50%), Positives = 408/652 (62%), Gaps = 20/652 (3%)

Query: 15  RAEQKLKKNQAKAEQKDKKKLSKNQNVXXXXXXXXIETVLANFKMEQEKFEKINVELLPQ 74
           R+E K KKN  KA  KD+K++ K            I+T+L NFK+EQE+FEK+ VEL+P 
Sbjct: 15  RSEAKSKKNLLKAASKDQKRVKKFGLDSDDEEDLDIDTILQNFKLEQEQFEKVVVELVP- 73

Query: 75  GQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWR 134
               H +PR+N+ ++T AS       ELL+FGGE T+ ET MT FYNDL  Y P   QW+
Sbjct: 74  ----HPTPRNNACLVTNASK-----PELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWK 124

Query: 135 KITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDI 194
           K TSQNSPMPRSSAAMC H SG+ IL GGEFSSPKQNTFYHY+DTW+LD +T+EW+K+D 
Sbjct: 125 KFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDF 184

Query: 195 KKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPL 254
           K  P ARSGHRI  WKNYF+LFGGFKD+ N  T+YFNDVW F+++++KWT+ E   N   
Sbjct: 185 KNGPSARSGHRITTWKNYFILFGGFKDL-NQGTSYFNDVWLFNVVDFKWTKWE-TTNKNQ 242

Query: 255 PDPRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXXXXILNDCWYLKMKSDLSSIRWERRK 314
           PDPRSGHSWI   EG I++GGY                L DCW LKM  +++ I+WERR 
Sbjct: 243 PDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVNEIKWERRA 302

Query: 315 KLGFQPSPRVGCSMAYHK-GRGILFGGVYDFDETEESLESLFYNDLFSYNVETNRWFALN 373
           K G QPSPRVGCSMA H+  RGILFGGVYD +ETEE L S++YNDL+SYN+E+NRW+ L 
Sbjct: 303 KKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNIESNRWYPLK 362

Query: 374 LRK--NQXXXXXXXXXXXXXXXXXXXXLQDLLNQIXXXXXXXXXXXXXXXXXXXXXXXXX 431
           LRK                        LQDLLN+I                         
Sbjct: 363 LRKVTQNSNANRNKSSNNTVSKEQEKELQDLLNKI-----LEQNDLKDEETNSYSGSNTP 417

Query: 432 XXXXXXXXXXXXXXXXXXXXXGVTIMNQLPHPRYNVAMTVVDDLLFIYGGSWELGEKDYF 491
                                 +  +NQLPH R+N   TV++D  +IYGG WE  + DY 
Sbjct: 418 HEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMWEFKDNDYT 477

Query: 492 INSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSXXXXXXXXXXXXXXXXXXXXIKDQ 551
           I+SFYSIDLN++DG+T Y+E+L+EIE+ K LG+  S                     +  
Sbjct: 478 IDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSEDDFEYEDDDDEDDGEAEPTNERL 537

Query: 552 KLVAXXXXXXXXXXXVQEMEIPDLRPWLPHPKPFESLRAFYIREGPAFLEWAISNNKHVR 611
           +              + EMEIPD RPWLPHPK FESLR FYIREGP FLEWAISNNKH +
Sbjct: 538 EAEDDDEEENEEDEGIDEMEIPDPRPWLPHPKAFESLREFYIREGPKFLEWAISNNKHAK 597

Query: 612 GKHLKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGDVIEKDTSKGASKRR 663
           GKHLK+KSFELC+DRWWERRDQI+IEEDKL+ELGV GD+IE+D     + RR
Sbjct: 598 GKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSPPTARR 649

>Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON}
           YPL263C (KEL3) - Kelch-repeat protein, similar to Kel1
           and Kel2 [contig 186] FULL
          Length = 658

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/647 (52%), Positives = 411/647 (63%), Gaps = 32/647 (4%)

Query: 17  EQKLKKNQAKAEQKDKKKLSKNQNVXXXXXXXXIETVLANFKMEQEKFEKINVELLPQGQ 76
           EQK KKN  K+E KDKK+ SK             E VLANFK EQE F+++ V  + +  
Sbjct: 43  EQKNKKNLEKSENKDKKR-SKKLGSEDDDDLDIDE-VLANFKKEQELFQEVLVTPVERP- 99

Query: 77  HNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWRKI 136
               S R NS M+ A   H K+  ELL+FGGE+T+    +T FYN+L +Y+ D+ QWRKI
Sbjct: 100 ----SQRINSCMV-ANPIHGKR--ELLIFGGEHTNSTNSLTAFYNELFTYSLDSDQWRKI 152

Query: 137 TSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDIKK 196
           TS+NSPMPRSSAA   H SG+A++HGGEFSSPKQNTFYHYSDTW+LD +TKEWTK++ K 
Sbjct: 153 TSRNSPMPRSSAAAAAHSSGVALIHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKMEQKN 212

Query: 197 SPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPLPD 256
            P ARSGHR+  WKN+F+L GGF+D+G + T Y ND+W FDI  YKW QVEFP NHP+PD
Sbjct: 213 GPSARSGHRMTIWKNFFILHGGFRDLGTS-TTYLNDLWIFDITTYKWKQVEFPPNHPIPD 271

Query: 257 PRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXXXXILNDCWYLKMKSDLSSIRWERRKKL 316
            RSGHS IP ++G +LWGGY                L DCWYLKMKSD+S+IRWERRKK 
Sbjct: 272 ARSGHSIIPTQDGAVLWGGYC--KVKAGKGLQKGKTLTDCWYLKMKSDVSAIRWERRKKQ 329

Query: 317 GFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESLFYNDLFSYNVETNRWFALNLRK 376
           GFQPSPRVGCSM +HKGRG+LFGGVYDF+ETEE L S F+NDLFSY VE NRW+++ +R 
Sbjct: 330 GFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSYQVEANRWYSVKMRP 389

Query: 377 NQXXXXXXXXXXXXXXXXXXXXLQDLLNQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 436
            +                    L D+L Q                               
Sbjct: 390 QKKKTVAISRNNRNKDEELENILNDILQQANLADDTDDDDNEIKRELQRIDEEEALENSR 449

Query: 437 XXXXXXXXXXXXXXXXGVTIMNQLPHPRYNVAMTVVDDLLFIYGGSWELGEKDYFINSFY 496
                              ++ QLPHPR+N    VVDD LFI+GG WE GE+D+ I+SFY
Sbjct: 450 KQ---------------YEVVGQLPHPRFNATTAVVDDFLFIFGGVWEFGERDFSIDSFY 494

Query: 497 SIDLNRIDGVTCYWEDLKEIEKAKELGEQDSXXXXXXXXXXXXXXXXXXXXIKDQKLVA- 555
           SIDLN++DGV  YWE+L E+EKAK LGE D                       DQKLVA 
Sbjct: 495 SIDLNKLDGVKVYWENLSELEKAKALGEDDEEEFDDDEDDDDDDEEEETA---DQKLVAE 551

Query: 556 XXXXXXXXXXXVQEMEIPDLRPWLPHPKPFESLRAFYIREGPAFLEWAISNNKHVRGKHL 615
                        E EIPDLRPWLPHPKPFE+LRAFYIR G  FL+WAISNN+  +GKHL
Sbjct: 552 DEEEEEEEEEEEDEPEIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAISNNRDAKGKHL 611

Query: 616 KKKSFELCEDRWWERRDQIRIEEDKLEELGVVGDVIEKDTSKGASKR 662
           KK+SF+LC+DRWWERR+QIRIEEDKLEELG V +V+E+D ++   +R
Sbjct: 612 KKQSFDLCQDRWWERREQIRIEEDKLEELGGVENVVERDPAQTMKRR 658

>KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263C KEL3
           Cytoplasmic protein of unknown function
          Length = 642

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/652 (50%), Positives = 407/652 (62%), Gaps = 32/652 (4%)

Query: 17  EQKLKKNQAKAEQKDKKKLSKNQNVXXXXXXXXIETVLANFKMEQEKFEKINVELLPQGQ 76
           E K KKN  KAE KDKK+ SK  N         I+ +L NF+ EQE F+++ V  + +  
Sbjct: 17  ELKNKKNLEKAEVKDKKR-SKKLN-SEDDDDLDIDEILENFRKEQELFQEVVVTPVKRP- 73

Query: 77  HNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWRKI 136
               SPRSN  M+   S H K+  ELL+FGGEYT+  +  T FYN+L +Y+ DT QW+KI
Sbjct: 74  ----SPRSNVCMVPNPS-HGKR--ELLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKI 126

Query: 137 TSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDIKK 196
           TS+N+PMPRSSAA   HPSG+ ++HGGEFSSPKQNTFYHYSD+W+LD S+KEWTK+D K 
Sbjct: 127 TSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQKN 186

Query: 197 SPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPLPD 256
            P ARSGHR+  WKN+FV+ GGF+D+G + T Y ND W FDI  YKW QVEFP NHP+PD
Sbjct: 187 GPSARSGHRMTVWKNFFVMHGGFRDLGTS-TTYLNDCWLFDITTYKWKQVEFPPNHPVPD 245

Query: 257 PRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXXXXILNDCWYLKMKSDLSSIRWERRKKL 316
            RSGHS IP +EG I+WGGY               IL DCWYL+MKSD++ IRWERRKK 
Sbjct: 246 ARSGHSLIPTQEGAIVWGGYC--KIKAKKGLQKGKILTDCWYLRMKSDITGIRWERRKKQ 303

Query: 317 GFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESLFYNDLFSYNVETNRWFALNLRK 376
           GFQPSPRVGCSMA+HKGRGILFGGVYD++ETEE L S F+NDL SY VE NRW+++ +R 
Sbjct: 304 GFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEANRWYSIKMRP 363

Query: 377 NQXXXXXXXXXXXXXXXXXXXXLQDLLNQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 436
            +                    L D+L +                               
Sbjct: 364 QKKKIVAASKSAKSKDDELVGILNDILQKANLADEENEENESDSEIEKELHRLDEEELLG 423

Query: 437 XXXXXXXXXXXXXXXXGVTIMNQLPHPRYNVAMTVVDDLLFIYGGSWELGEKDYFINSFY 496
                              ++ QLPH R+N A TVVDD LFI+GGSWE GE+D+ I+SFY
Sbjct: 424 HQQKQ------------YPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGERDFSIDSFY 471

Query: 497 SIDLNRIDGVTCYWEDLKEIEKAKELGEQDSXXXXXXXXXXXXXXXXXX------XXIKD 550
           SIDLNR DGV  +WEDL+EIEKAK+ G ++                           ++D
Sbjct: 472 SIDLNRTDGVRVFWEDLEEIEKAKDQGLEEDEEEEEEEDDDDEDDEEETLDEELIAEMED 531

Query: 551 QKLVAXXXXXXXXXXXVQEMEIPDLRPWLPHPKPFESLRAFYIREGPAFLEWAISNNKHV 610
            K                  EIPD RPWLPHPK FE+LRAFYIR G  FL+WAISNN+  
Sbjct: 532 DKQEEEEQEEEEEEEEAGP-EIPDPRPWLPHPKAFETLRAFYIRTGAEFLQWAISNNRSA 590

Query: 611 RGKHLKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGDVIEKDTSKGASKR 662
           +GKHLKK+SF+L +DRWWERR+Q+RIEEDKLEE+G V ++IE+D+S    +R
Sbjct: 591 KGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSHSTKRR 642

>Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}
           YPL263C (REAL)
          Length = 652

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/623 (45%), Positives = 371/623 (59%), Gaps = 30/623 (4%)

Query: 50  IETVLANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEY 109
           ++ +L++F  +Q + E +++  + +     +S R++  M  A   HNK+  EL +FGGE+
Sbjct: 51  LDEILSSFTKKQTELEHVDITAVER-----LSCRTHPLMF-ANPQHNKR--ELFIFGGEF 102

Query: 110 TSPETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPK 169
           T PET +THFYNDL SY+     W+K  S+N+P+PRSSAA+  HPSGIA+LHGGEFSSPK
Sbjct: 103 TDPETKLTHFYNDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPK 162

Query: 170 QNTFYHYSDTWILDTSTKEWTKVDI---KKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQ 226
           Q+ FYHYSDTW+ D + +++TK++      SP ARSGHRI+ WKNYF+LFGGF+D+GN Q
Sbjct: 163 QSKFYHYSDTWLFDCAERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQ 222

Query: 227 TNYFNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTXXXXXXXXX 286
           T+Y ND+WCFDI NYKWT++E    +  P+ RSGH +IP +   IL GGY          
Sbjct: 223 TSYLNDLWCFDISNYKWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKN 279

Query: 287 XXXXXILNDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSM-AYHKGRGILFGGVYDFD 345
                ILND W L +  D    +WE+ K    QPSPRVG S   + + + + FGGVYD  
Sbjct: 280 LMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQ 339

Query: 346 ETEESLESLFYNDLFSYNVETNRWFALNLR--KNQXXXXXXXXXXXXXXXXXXXXLQDLL 403
           ETEESLES+FYNDL+ +++E N+W  L ++  +                      LQDLL
Sbjct: 340 ETEESLESVFYNDLYMFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLL 399

Query: 404 NQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVTIMNQLPHP 463
           N I                                               +TI NQLPHP
Sbjct: 400 NSI-------LAKSNLNDDDDDDNTTTGSNSIDGDDEGEDDDSDLDNPENITISNQLPHP 452

Query: 464 RYNVAMTVVDDLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELG 523
           R+N A  VVDD LFIY G WELGEKDY INSFYSIDLN++DGV  YWEDL  IE+AK LG
Sbjct: 453 RFNAATCVVDDSLFIYSGVWELGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLG 512

Query: 524 EQDSXXXXXXXXXXXXXXXXXXXXIKDQKLVAXXXXXXXXXXXV---QEMEIPDLRPWLP 580
           ++DS                     +    +                 +MEIPD R WLP
Sbjct: 513 DRDSDEDDFEYEDDDDDDGEDNDEEEQDVALLEGDEDEEGENEDNGQAQMEIPDERSWLP 572

Query: 581 HPKPFESLRAFYIREGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIEEDK 640
           HPKPFE+LRAFY+REG  FL W+ISNNK ++GKHLK KSFE+CEDRWWERRDQ+ +EE++
Sbjct: 573 HPKPFETLRAFYLREGANFLTWSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEER 632

Query: 641 LEELGVVGDVIEKDTSKGASKRR 663
           LE+    G +IE+DT+   SKRR
Sbjct: 633 LED---TGGIIERDTTTKISKRR 652

>YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}
           KEL3Cytoplasmic protein of unknown function
          Length = 651

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/621 (46%), Positives = 366/621 (58%), Gaps = 27/621 (4%)

Query: 50  IETVLANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEY 109
           ++ +L++F  +Q + E +++  + +      S R++  M  A   HNK   EL +FGGE+
Sbjct: 51  LDEILSSFSKKQIELEHVDITSVEKP-----SCRTHPLMF-ANPQHNKH--ELFIFGGEF 102

Query: 110 TSPETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPK 169
           T PET +THFYNDL SY+     W+K  SQN+P+PRSSAA+  HPSGIA+LHGGEFSSPK
Sbjct: 103 TDPETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPK 162

Query: 170 QNTFYHYSDTWILDTSTKEWTKVDI---KKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQ 226
           Q+ FYHYSDTW+ D   +++TK++      SP ARSGHRI+ WKNYF+LFGGF+D+GN Q
Sbjct: 163 QSKFYHYSDTWLFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQ 222

Query: 227 TNYFNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTXXXXXXXXX 286
           T+Y ND+WCFDI  YKWT++E    +  PD RSGH +IP +   IL GGY          
Sbjct: 223 TSYLNDLWCFDISTYKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKN 279

Query: 287 XXXXXILNDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSM-AYHKGRGILFGGVYDFD 345
                ILND W L +  D    +WE+ K    QPSPRVG S   + + + + FGGVYD  
Sbjct: 280 LMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQ 339

Query: 346 ETEESLESLFYNDLFSYNVETNRWFALNLR--KNQXXXXXXXXXXXXXXXXXXXXLQDLL 403
           ETEESLES+FYNDL+ +++E N+W  L ++  +                      LQDLL
Sbjct: 340 ETEESLESVFYNDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLL 399

Query: 404 NQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVTIMNQLPHP 463
           N I                                               +TI NQLPHP
Sbjct: 400 NSI------LAKSNLNDDDDDNDDNSTTGPNSIDDDEDNEDDSDLDNQEDITISNQLPHP 453

Query: 464 RYNVAMTVVDDLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELG 523
           R+N A  VV D LFIY G WELGEKDY INSFYSIDLN++DGV  YWEDL  IE+AK LG
Sbjct: 454 RFNAATCVVGDSLFIYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLG 513

Query: 524 EQDSXXXXXXXXXXXXXXXXXXXXIKDQKLVAXXXXXXXXXXXVQ-EMEIPDLRPWLPHP 582
           ++DS                         L              Q +MEIPD R WLPHP
Sbjct: 514 DRDSDEDEFEYEDDEEDEDDGEEEQDAGPLEGDEDEESESDDDKQAQMEIPDERSWLPHP 573

Query: 583 KPFESLRAFYIREGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLE 642
           KPFE+LRAFY+REG  FL W+ISNN++++GK LK KSFELCEDRWWERRDQ+ +EE++LE
Sbjct: 574 KPFETLRAFYLREGANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLE 633

Query: 643 ELGVVGDVIEKDTSKGASKRR 663
           +    G +IE+DT+   SKRR
Sbjct: 634 D---TGGIIERDTTTKPSKRR 651

>Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}
           YPL263C (REAL)
          Length = 654

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/619 (45%), Positives = 366/619 (59%), Gaps = 26/619 (4%)

Query: 53  VLANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSP 112
           +L++F  +Q + E +++  + +     + P     ++ A   HNK   EL +FGGE+T P
Sbjct: 54  ILSSFTKKQTELEHVDITAVERPSC-RVHP-----LMFANPQHNKH--ELFIFGGEFTDP 105

Query: 113 ETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNT 172
           ET +THFYNDL SY+     W+K  SQN+P+PRSS A+  H SGIA+LHGGEFSSPKQ+ 
Sbjct: 106 ETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSK 165

Query: 173 FYHYSDTWILDTSTKEWTKVDI---KKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNY 229
           FYHYSDTW+ D   K++TK++      SP ARSGHRI+ WKNYF+LFGGF+D+G+ QT+Y
Sbjct: 166 FYHYSDTWLFDCHEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSY 225

Query: 230 FNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXX 289
            ND+WCFDI NYKWT++E    +  PD RSGH ++P +   IL GGY             
Sbjct: 226 LNDLWCFDISNYKWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMK 282

Query: 290 XXILNDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSM-AYHKGRGILFGGVYDFDETE 348
             ILND W L +  D    +WE+ K    QPSPRVG S   + + + + FGGVYD  ETE
Sbjct: 283 GKILNDSWKLTLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETE 342

Query: 349 ESLESLFYNDLFSYNVETNRWFALNLR--KNQXXXXXXXXXXXXXXXXXXXXLQDLLNQI 406
           ESL+S+FYNDL+ +++E N+W  L ++  ++                     LQDLLN I
Sbjct: 343 ESLDSIFYNDLYMFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSI 402

Query: 407 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVTIMNQLPHPRYN 466
                                                          +TI NQLPHPR+N
Sbjct: 403 ----LAKSNLNDEEDDNDDSTATTTGANSSNDEGDDEDDSDFENQENITISNQLPHPRFN 458

Query: 467 VAMTVVDDLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQD 526
            A  VVDD LFIY G WELGEKDY INSFYSIDLN++DGV  YWEDL  +E+AK LG++D
Sbjct: 459 AATCVVDDSLFIYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGDRD 518

Query: 527 SXXXXXXXXXXXXXXXXXXXXIKDQKLVAXXXXXXXXXXXV--QEMEIPDLRPWLPHPKP 584
           S                     +D +L+                +MEIPD R WLPHPKP
Sbjct: 519 SDEEEFEYEDEDDDEDDDEEEPQDTRLLEDDDDEESEEEDDGQAQMEIPDERSWLPHPKP 578

Query: 585 FESLRAFYIREGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLEEL 644
           FE+LRAFY+REG  FL W+ISNN++++GK LK KSFELCEDRWWERRDQ+ +EE++LE+ 
Sbjct: 579 FETLRAFYLREGANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLED- 637

Query: 645 GVVGDVIEKDTSKGASKRR 663
              G +IE+D +   SKRR
Sbjct: 638 --TGGIIERDATAKPSKRR 654

>Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C
           (REAL)
          Length = 651

 Score =  529 bits (1362), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 282/618 (45%), Positives = 363/618 (58%), Gaps = 27/618 (4%)

Query: 53  VLANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSP 112
           +L++F  +Q + E +++  + +      S R++  M  A   HNK   EL +FGGE+T  
Sbjct: 54  ILSSFTKKQTELEHVDITAVERP-----SCRTHPLMF-ANPQHNKH--ELFIFGGEFTDS 105

Query: 113 ETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNT 172
           ET +THFYNDL SY+     W+K  SQN+P+PRSSAA+  HPSGIA+LHGGEFSSPKQ+ 
Sbjct: 106 ETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSK 165

Query: 173 FYHYSDTWILDTSTKEWTKVDI---KKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNY 229
           FYHYSDTW+ D   +++ K++      SP ARSGHRI+ WKNYF+LFGGF+D+GN QT+Y
Sbjct: 166 FYHYSDTWLFDCVERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSY 225

Query: 230 FNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXX 289
            ND+WCFDI NYKW+++E    +  PD RSGH +IP +   IL GGY             
Sbjct: 226 LNDLWCFDISNYKWSKIE---TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMK 282

Query: 290 XXILNDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSM-AYHKGRGILFGGVYDFDETE 348
             ILND W L +  D    +WE+ K    QPSPRVG S   + + + + FGGVYD  ETE
Sbjct: 283 GKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETE 342

Query: 349 ESLESLFYNDLFSYNVETNRWFALNLRKNQXXXXXX--XXXXXXXXXXXXXXLQDLLNQI 406
           ESLES+FYNDL+ +++E N+W  L ++  +                      LQDLLN I
Sbjct: 343 ESLESVFYNDLYMFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSI 402

Query: 407 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVTIMNQLPHPRYN 466
                                                          +TI NQLPHPR+N
Sbjct: 403 ------LAKSNLNDDDDENDDYTATGSNSIDGDEDEEDDSDLDNQEDITISNQLPHPRFN 456

Query: 467 VAMTVVDDLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQD 526
            A  VV D LFIY G WELGEKDY INSFYSIDLN++DGV  YWE+L  IE+AK LG++D
Sbjct: 457 AATCVVGDSLFIYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGDRD 516

Query: 527 SXXXXXXXXXXXXXXXXXXXXIKDQKLVAXXXXXXXXXXXVQ-EMEIPDLRPWLPHPKPF 585
           S                         L +            Q +MEIPD R WLPHPKPF
Sbjct: 517 SDEEEFEYEDEEDDEDQSEEEQDAGLLESDEDEESDDEDDGQAQMEIPDERSWLPHPKPF 576

Query: 586 ESLRAFYIREGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLEELG 645
           E+LRAFY+REG  FL W+ISNN++++GK LK KSFELCEDRWWERRDQ+ +EE++LE+  
Sbjct: 577 ETLRAFYLREGANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLED-- 634

Query: 646 VVGDVIEKDTSKGASKRR 663
             G +IE+D +   SKRR
Sbjct: 635 -TGGIIERDVTTKPSKRR 651

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]
           {ON} complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 104/257 (40%), Gaps = 45/257 (17%)

Query: 126 YTPDTQQWRKITSQNSPMPR---SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWIL 182
           YTP    W +I  QNSP PR    S+A     + I IL G    S        Y DTWI+
Sbjct: 136 YTP----WNRIKLQNSPFPRYRHVSSAYATASNNIYILGGLHDQSV-------YGDTWII 184

Query: 183 ----DTSTKEWTKVDI-KKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFD 237
               D +      VDI + +P  R GH      N F++FGG     N +    +D++ F+
Sbjct: 185 SCNPDATQFSSKSVDIGENTPPPRVGHAATLCGNAFIVFGGDTHKVNKEGLMDDDIYLFN 244

Query: 238 ILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXXXXILNDCW 297
           I +YKWT +  P   P P  R GH        CIL                     ND  
Sbjct: 245 INSYKWT-IPNPIG-PRPLGRYGHKI------CILATSTVKTKLYLFGGQFDDTYFNDLA 296

Query: 298 YLKMKSDLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLE 352
                 DLSS R     WE  K  GF P P    +M  +     ++GG     +T++ L 
Sbjct: 297 VF----DLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVTYGSDLWIYGG-----DTQQGL- 346

Query: 353 SLFYNDLFSYNVETNRW 369
               ND+F ++  TN W
Sbjct: 347 ---INDIFKFSPNTNTW 360

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 67/142 (47%), Gaps = 21/142 (14%)

Query: 82  PRSNSSMITAASAHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWRKI-TSQN 140
           P +N +M+T        G +L ++GG+    + G+    ND+  ++P+T  W K+ T+  
Sbjct: 322 PLTNHTMVTY-------GSDLWIYGGDT---QQGL---INDIFKFSPNTNTWTKVETTGT 368

Query: 141 SPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDIKKSPV- 199
            P P    A   + + + ++ G + +    N+ Y ++     D S+K +T  D K   + 
Sbjct: 369 KPPPMQEHAAVVYKNIMCVVGGKDENDMYLNSVYLFN----FD-SSKWYTFPDFKSGIIQ 423

Query: 200 ARSGHRIVHWKN-YFVLFGGFK 220
            RSGH +    N   ++ GG K
Sbjct: 424 GRSGHSVTLLNNDKLLIMGGDK 445

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
           YHR158C (REAL)
          Length = 1169

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 112/259 (43%), Gaps = 53/259 (20%)

Query: 133 WRKITSQNSPMPR---SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWIL---DTST 186
           W +I  QNSP PR    ++A     + I ++ G    S        Y DTWIL   D +T
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTALDNAT 165

Query: 187 K-EWTKVDIKK-SPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWT 244
           K   T +DI + +P  R GH  V   N FV+FGG     N +    +D++  +I +YKWT
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 245 QVEFPKNHPLPDPRSGH-----SWIPVEEGCILWGGYTXXXXXXXXXXXXXXILNDCWYL 299
            V  P   P P  R GH     +   ++    ++GG                  +D ++ 
Sbjct: 226 -VPAPVG-PRPLGRYGHKISIIATTQMKTKLYVFGGQ----------------FDDTYFN 267

Query: 300 KMKS-DLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLES 353
            +   DLSS R     WE  K   F P P    +M  +  +  +FGG        ++L+ 
Sbjct: 268 DLAVYDLSSFRRPDSHWEFLKPKAFTPPPITNFTMISYDSKLWVFGG--------DTLQG 319

Query: 354 LFYNDLFSYNVETNRWFAL 372
           L  ND+F Y+   N WF +
Sbjct: 320 LI-NDVFMYDPAINDWFII 337

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519
           bp, 1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 74/259 (28%), Positives = 113/259 (43%), Gaps = 53/259 (20%)

Query: 133 WRKITSQNSPMPR---SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWIL---DTST 186
           W +I  QNSP PR    ++A     + I ++ G    S        Y DTWIL   D +T
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYATDKNQIYVIGGLHDQSV-------YGDTWILSAFDDAT 165

Query: 187 K-EWTKVDIKK-SPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWT 244
           K   T +DI + +P  R GH  V   N FV+FGG     N +    +D++  ++ +YKWT
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNREGLMDDDIYLLNVNSYKWT 225

Query: 245 QVEFPKNHPLPDPRSGH-----SWIPVEEGCILWGGYTXXXXXXXXXXXXXXILNDCWYL 299
            V  P   P P  R GH     +   ++    ++GG                  +D ++ 
Sbjct: 226 -VPAPVG-PRPLGRYGHKISIIATTQMKTKLYVFGGQ----------------FDDTYFN 267

Query: 300 KMKS-DLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLES 353
            +   DLSS R     W+  K + F P P    +M  +  +  +FGG        ++L+ 
Sbjct: 268 DLAVYDLSSFRRPDSHWDFLKPMTFTPPPMTNFTMISYDSKLWVFGG--------DTLQG 319

Query: 354 LFYNDLFSYNVETNRWFAL 372
           L  ND+F Y+   N WF +
Sbjct: 320 LI-NDVFMYDPAKNDWFTI 337

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
           KEL1Protein required for proper cell fusion and cell
           morphology; functions in a complex with Kel2p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 1164

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 75/260 (28%), Positives = 113/260 (43%), Gaps = 53/260 (20%)

Query: 133 WRKITSQNSPMPR---SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWIL---DTST 186
           W +I  QNSP PR    ++A     + I ++ G    S        Y DTWIL   D +T
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 187 K-EWTKVDIKK-SPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWT 244
           +   T +DI + +P  R GH  V   N FV+FGG     N +    +D++  +I +YKWT
Sbjct: 166 RFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 245 QVEFPKNHPLPDPRSGH-----SWIPVEEGCILWGGYTXXXXXXXXXXXXXXILNDCWYL 299
            V  P   P P  R GH     +   ++    ++GG                  +D ++ 
Sbjct: 226 -VPAPVG-PRPLGRYGHKISIIATTQMKTKLYVFGGQ----------------FDDTYFN 267

Query: 300 KMKS-DLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLES 353
            +   DLSS R     WE  K   F P P    +M  +  +  +FGG        ++L+ 
Sbjct: 268 DLAVYDLSSFRRPDSHWEFLKPRTFTPPPITNFTMISYDSKLWVFGG--------DTLQG 319

Query: 354 LFYNDLFSYNVETNRWFALN 373
           L  ND+F Y+   N WF ++
Sbjct: 320 LV-NDVFMYDPAINDWFIID 338

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
           YHR158C (REAL)
          Length = 1168

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 78/259 (30%), Positives = 112/259 (43%), Gaps = 53/259 (20%)

Query: 133 WRKITSQNSPMPR---SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWIL---DTST 186
           W +I  Q+SP PR    S+A     + I ++ G    S        Y DTWIL   D +T
Sbjct: 113 WNRIKLQDSPFPRYRHVSSAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 187 K-EWTKVDIKK-SPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWT 244
           K   T +DI + +P  R GH  V   N FV+FGG     N +    +D++  +I +YKWT
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 245 QVEFPKNHPLPDPRSGH--SWIPVEE---GCILWGGYTXXXXXXXXXXXXXXILNDCWYL 299
            V  P   P P  R GH  S I   +      ++GG                  +D ++ 
Sbjct: 226 -VPAPVG-PRPLGRYGHKISIIATNQMKTKLYVFGGQ----------------FDDTYFN 267

Query: 300 KMKS-DLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLES 353
            +   DLSS R     WE  K   F P P    +M  +  +  +FGG        ++L+ 
Sbjct: 268 DLAVYDLSSFRRPDSHWEFLKPKTFSPPPITNFTMISYDSKLWVFGG--------DTLQG 319

Query: 354 LFYNDLFSYNVETNRWFAL 372
           L  ND+F Y+   N WF +
Sbjct: 320 LV-NDVFMYDPALNDWFII 337

>ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} similar
           to uniprot|Q75AR9 Ashbya gossypii ADL149W ADL149Wp and
           some similarites with YHR158C uniprot|P38853
           Saccharomyces cerevisiae YHR158C KEL1 Protein required
           for proper cell fusion and cell morphology functions in
           a complex with Kel2p to negatively regulate mitotic exit
           interacts with Tem1p and Lte1p localizes to regions of
           polarized growth potential Cdc28p substrate
          Length = 1293

 Score = 70.5 bits (171), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 72/263 (27%), Positives = 112/263 (42%), Gaps = 57/263 (21%)

Query: 126 YTPDTQQWRKITSQNSPMPR---SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWIL 182
           YTP    W ++  QNSP PR    +++ C   + + ++ G    S        Y DTWI+
Sbjct: 138 YTP----WNRVKLQNSPFPRYRHVASSNCSEDNSLYVIGGLHDQS-------VYGDTWII 186

Query: 183 DTSTK----EWTKVDIKKS-PVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFD 237
            T+      +   V+I ++ P  R GH      N FVLFGG     N++    +D++ F+
Sbjct: 187 STNDNGTQFQSKTVEISETTPPPRVGHAATLCGNAFVLFGGDTHKVNSEGLMDDDLYLFN 246

Query: 238 ILNYKWTQVEFPKNHPLPDPRSGH-----SWIPVEEGCILWGGYTXXXXXXXXXXXXXXI 292
           + +YKWT +  P   P P  R GH     +   ++    L+GG                 
Sbjct: 247 VNSYKWT-IPHPIG-PRPLGRYGHKISIMAANQMKTKLYLFGGQ---------------- 288

Query: 293 LNDCWYLKMKS-DLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDE 346
            +D ++  +   DLSS R     WE  K   F P P    +M  +     +FGG      
Sbjct: 289 FDDTYFNDLAVFDLSSFRRPDSHWEFLKPTTFSPPPLTNHTMISYDNHLWVFGG------ 342

Query: 347 TEESLESLFYNDLFSYNVETNRW 369
             ++L+ L  N +F Y+V  N W
Sbjct: 343 --DTLQGLI-NQVFKYDVANNDW 362

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/247 (23%), Positives = 101/247 (40%), Gaps = 45/247 (18%)

Query: 138 SQNSPMPR--SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWT-KVDI 194
           S+ +P PR   +A +C       +L GG+             D ++ + ++ +WT    I
Sbjct: 203 SETTPPPRVGHAATLC---GNAFVLFGGDTHKVNSEGLMD-DDLYLFNVNSYKWTIPHPI 258

Query: 195 KKSPVARSGHRIV-----HWKNYFVLFGG-FKDIGNNQTNYFNDVWCFDILNYKWTQV-- 246
              P+ R GH+I        K    LFGG F D       YFND+  FD+ +++      
Sbjct: 259 GPRPLGRYGHKISIMAANQMKTKLYLFGGQFDDT------YFNDLAVFDLSSFRRPDSHW 312

Query: 247 EFPKNHPL-PDPRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXXXXILNDCWYLKMKSDL 305
           EF K     P P + H+ I  +    ++GG T              ++N  +    K D+
Sbjct: 313 EFLKPTTFSPPPLTNHTMISYDNHLWVFGGDT-----------LQGLINQVF----KYDV 357

Query: 306 SSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESLFYNDLFSYNVE 365
           ++  W   +  G +P P    +   +K   ++ GG  + D         + N ++  N++
Sbjct: 358 ANNDWSIAETTGTKPPPMQEHAAVVYKHVMVVVGGKDEHD--------TYLNSVYFLNLK 409

Query: 366 TNRWFAL 372
           T+ WF L
Sbjct: 410 THEWFKL 416

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
           YGR238C
          Length = 1086

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 78/269 (28%), Positives = 114/269 (42%), Gaps = 54/269 (20%)

Query: 125 SYTPDTQQ-WRKITSQNSPMPR---SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTW 180
           SYT +++  W +I  QNSP PR    ++++    + + ++ G    S        Y DTW
Sbjct: 122 SYTENSKTIWNRIKLQNSPFPRYRHVASSVISDTNQVYVIGGLHDQS-------VYGDTW 174

Query: 181 IL-----DTSTKEWTK-VDIKKS-PVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDV 233
           +L      TST   ++ VDI ++ P  R GH      N FV+FGG     N      +D+
Sbjct: 175 VLTCEDPQTSTMFSSRTVDITETTPPPRVGHASTLCGNAFVIFGGDTHKKNEMGEMDDDI 234

Query: 234 WCFDILNYKWTQVEFPKNHPLPDPRSGH--SWIP---VEEGCILWGGYTXXXXXXXXXXX 288
           + F+I +YKWT +  P   P P  R GH  S I    ++    L+GG             
Sbjct: 235 YLFNINSYKWT-IPHPIG-PRPKGRYGHKISIIARKQMQTKLYLFGG-----------QF 281

Query: 289 XXXILNDCWYLKMKSDLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYD 343
                ND        DLSS R     WE  K   F P P    +M  +  +  +FGG   
Sbjct: 282 DDNYFNDLVVF----DLSSFRRDDSHWEFIKPRSFIPPPITNHTMVSYDFKLWVFGG--- 334

Query: 344 FDETEESLESLFYNDLFSYNVETNRWFAL 372
                ++LE L  N +F Y+   N W  +
Sbjct: 335 -----DTLEGLL-NQVFMYDPAVNDWCVV 357

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 57/249 (22%), Positives = 101/249 (40%), Gaps = 43/249 (17%)

Query: 138 SQNSPMPR--SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWT-KVDI 194
           ++ +P PR   ++ +C    G A +  G  +  K        D ++ + ++ +WT    I
Sbjct: 195 TETTPPPRVGHASTLC----GNAFVIFGGDTHKKNEMGEMDDDIYLFNINSYKWTIPHPI 250

Query: 195 KKSPVARSGHRIV-----HWKNYFVLFGG-FKDIGNNQTNYFNDVWCFDILNYKWTQV-- 246
              P  R GH+I        +    LFGG F D      NYFND+  FD+ +++      
Sbjct: 251 GPRPKGRYGHKISIIARKQMQTKLYLFGGQFDD------NYFNDLVVFDLSSFRRDDSHW 304

Query: 247 EFPKNHP-LPDPRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXXXXILNDCW-YLKMKSD 304
           EF K    +P P + H+ +  +    ++GG T              +LN  + Y    +D
Sbjct: 305 EFIKPRSFIPPPITNHTMVSYDFKLWVFGGDT-----------LEGLLNQVFMYDPAVND 353

Query: 305 LSSIRWE-RRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESLFYNDLFSYN 363
              +    +   L   P P    +   +KG   + GG  + D         + ND++  N
Sbjct: 354 WCVVETTCQDDDLENMPPPMQEHATLIYKGLMCIVGGKDEQDH--------YLNDVYFLN 405

Query: 364 VETNRWFAL 372
           +++ +WF L
Sbjct: 406 LKSLKWFRL 414

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa]
           {ON} some similarities with uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1 involved in cell fusion and
           morphology
          Length = 1136

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/269 (26%), Positives = 108/269 (40%), Gaps = 55/269 (20%)

Query: 123 LLSYTPDTQQWRKITSQNSPMPR---SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDT 179
           +L   PD   W +I   NSP PR    S++       I ++ G    S        Y DT
Sbjct: 137 ILPSEPDYTPWGRIRLSNSPFPRYRHVSSSHITDQGKIYVIGGLHDQSV-------YGDT 189

Query: 180 WILDTS---------TKEWTKVDIKKS-PVARSGHRIVHWKNYFVLFGGFKDIGNNQTNY 229
           WIL  S         + + T ++I +S P  R GH      N FV+FGG     N+    
Sbjct: 190 WILTASDIDKTGAINSFKSTTIEITESTPPPRVGHASTLCGNAFVVFGGDTHKVNSDGLM 249

Query: 230 FNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPV---EEGCILWGGYTXXXXXXXXX 286
            +D++  +I +YKWT  +     PL   R GH  + +   +    L+GG           
Sbjct: 250 DDDLYLLNINSYKWTIPKPVGQRPL--GRYGHKIVTISAEQTKLYLFGGQ---------- 297

Query: 287 XXXXXILNDCWYLKMKS-DLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGILFGG 340
                  +D ++  +   DLSS R     W   K  GF P P    +M  ++ +  +FGG
Sbjct: 298 ------FDDTYFGDLAVFDLSSFRRPDSHWVFLKPSGFNPPPLTNHTMVTYQDKIWVFGG 351

Query: 341 VYDFDETEESLESLFYNDLFSYNVETNRW 369
                   ++LE    N ++ Y+   N W
Sbjct: 352 --------DTLEEGLINRVYLYSPTNNSW 372

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 77/189 (40%), Gaps = 17/189 (8%)

Query: 89  ITAASAHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWRKITSQN-SPMPRSS 147
           I   SA   K   L +FGG++     G    + DL S+      W  +     +P P ++
Sbjct: 281 IVTISAEQTK---LYLFGGQFDDTYFGDLAVF-DLSSFRRPDSHWVFLKPSGFNPPPLTN 336

Query: 148 AAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDIKKS-PVARSGHRI 206
             M  +   I +  G        N  Y YS T         W  V+     P     H  
Sbjct: 337 HTMVTYQDKIWVFGGDTLEEGLINRVYLYSPT------NNSWEIVETTGDIPPPMQEHAA 390

Query: 207 VHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPV 266
           + +K+   + GG KD    + NY N ++  ++ + KW ++ F KN+ +P  RSGHS   +
Sbjct: 391 IVYKDLMCVVGG-KDA---EDNYLNTLYFLNLQSLKWFKLPFYKNN-IPQGRSGHSVTLL 445

Query: 267 EEGCILWGG 275
           +   IL  G
Sbjct: 446 KNDQILIMG 454

>TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5.88
           YGR238C
          Length = 1009

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 73/263 (27%), Positives = 116/263 (44%), Gaps = 57/263 (21%)

Query: 126 YTPDTQQWRKITSQNSPMPR---SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWIL 182
           YTP    W ++  Q+SP PR    +++     + I ++ G    S        Y DTWI+
Sbjct: 91  YTP----WNRVKLQDSPFPRYRHVASSYVSDDNRIYVIGGLHDESV-------YGDTWII 139

Query: 183 ---DTSTKEWTK-VDIKK-SPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFD 237
              D+ T+  +K VDI + +P  R GH      N FV+FGG     N++    +D++ F+
Sbjct: 140 NVDDSGTQFSSKTVDISEFTPPPRVGHAATLCGNAFVIFGGDTHKVNSEGLMDDDLYLFN 199

Query: 238 ILNYKWTQVEFPKNHPLPDPRSGH--SWIPVEE---GCILWGGYTXXXXXXXXXXXXXXI 292
           I ++KWT +  P   P P  R GH  S I   +      L+GG                 
Sbjct: 200 INSFKWT-IPHPVG-PRPLGRYGHKISIIATNQMKTKLYLFGGQ---------------- 241

Query: 293 LNDCWYLKMKS-DLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDE 346
            +D ++  +   DLSS R     WE  K   F P P    +M  +  +  +FGG      
Sbjct: 242 FDDTFFNDLAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVSYDHKLWIFGG------ 295

Query: 347 TEESLESLFYNDLFSYNVETNRW 369
             ++++ L  N +F Y++ +N W
Sbjct: 296 --DTMQGLI-NKVFVYDIMSNDW 315

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 76/194 (39%), Gaps = 36/194 (18%)

Query: 160 LHGGEFSSPKQNTFYHYSDTWILDTST-----KEWTKVDIKK-SPVARSGHRIVHWKNYF 213
           L GG+F     +TF++  D  + D S+       W  +  K   P   + H +V + +  
Sbjct: 237 LFGGQFD----DTFFN--DLAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVSYDHKL 290

Query: 214 VLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILW 273
            +FGG     +      N V+ +DI++  W+ VE       P P   H+ +  ++   + 
Sbjct: 291 WIFGG-----DTMQGLINKVFVYDIMSNDWSLVE--TTGARPPPLQEHAALIYKDLMCVV 343

Query: 274 GGYTXXXXXXXXXXXXXXILNDCWYLKMKSDLSSIRWERRK--KLGFQPSPRVGCSMAYH 331
           GG                 LN  ++L +K    S RW +    K G  P  R G S+   
Sbjct: 344 GG----------KDEQDIYLNSIYFLNLK----SCRWFKFPVFKAGI-PQGRSGHSITLL 388

Query: 332 KGRGILFGGVYDFD 345
           K   IL  G   FD
Sbjct: 389 KNNKILIMGGDKFD 402

>KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1104

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 108/259 (41%), Gaps = 53/259 (20%)

Query: 133 WRKITSQNSPMPR---SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWI---LDTST 186
           W +I  ++SP PR    +++       + ++ G    S        + D WI   L+  T
Sbjct: 197 WNRIKLKDSPFPRYRHVTSSYATEDDRVFVIGGLHDQS-------VFGDVWIIKSLENGT 249

Query: 187 K-EWTKVDI-KKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWT 244
           K   T +DI + +P  R GH      N FV+FGG     N      +D++ F+I +YKWT
Sbjct: 250 KFTSTTIDITENTPPPRVGHAATLCGNAFVVFGGDTHKVNKDGLMDDDLYLFNINSYKWT 309

Query: 245 QVEFPKNHPLPDPRSGH-----SWIPVEEGCILWGGYTXXXXXXXXXXXXXXILNDCWYL 299
            +  P   P P  R GH     +  P++    L+GG                  +D ++ 
Sbjct: 310 -IPNPIG-PRPLGRYGHKVSIIATTPMKTKLYLFGGQ----------------FDDTYFN 351

Query: 300 KMKS-DLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLES 353
            +   DLS  R     WE  K   F P P    +M  ++ +  +FGG        ++L+ 
Sbjct: 352 NLAVFDLSQFRRPDSHWEFLKPKSFMPPPLTNHTMVSYQNKLWIFGG--------DTLQG 403

Query: 354 LFYNDLFSYNVETNRWFAL 372
           L  N +F Y+ E N W  +
Sbjct: 404 LI-NKIFMYDPEVNDWTVV 421

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 78/190 (41%), Gaps = 35/190 (18%)

Query: 101 ELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWRKITSQ--------NSPMPRSSAAMCY 152
           +L +FGG++         ++N+L  +  D  Q+R+  S           P P ++  M  
Sbjct: 337 KLYLFGGQFDD------TYFNNLAVF--DLSQFRRPDSHWEFLKPKSFMPPPLTNHTMVS 388

Query: 153 HPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKV-------DIKKSPVARSGHR 205
           + + + I  GG+      N  + Y      D    +WT V       D +  P     H 
Sbjct: 389 YQNKLWIF-GGDTLQGLINKIFMY------DPEVNDWTVVETFPANNDQENFPPPMQEHA 441

Query: 206 IVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIP 265
            V + +  V+ GG KD    Q NY N V+   I   +W ++ F  +  +P  RSGHS   
Sbjct: 442 SVMYGDLMVVMGG-KD---EQDNYLNTVYFLKINTLEWYKLPF-LSVGIPQGRSGHSITL 496

Query: 266 VEEGCILWGG 275
           ++   +L  G
Sbjct: 497 LKGNKLLIMG 506

>SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1085

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 76/266 (28%), Positives = 110/266 (41%), Gaps = 57/266 (21%)

Query: 126 YTPDTQQWRKITSQNSPMPR---SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWIL 182
           Y+P    W +I   +SP PR    ++A     + + ++ G    S        Y DTWIL
Sbjct: 70  YSP----WNRIKLGSSPFPRYRHVASAYASEQNQVFVIGGLHDQSV-------YGDTWIL 118

Query: 183 DT---STKEWTK-VDIK-KSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFD 237
                +T+  +K VDI   +P  R GH      N FV+FGG     NN+    +DV+ F+
Sbjct: 119 TAHANNTRFTSKTVDISDTTPPPRVGHASTLCGNAFVIFGGDTHKVNNEGLMDDDVYLFN 178

Query: 238 ILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCI-----LWGGYTXXXXXXXXXXXXXXI 292
           I +YKWT +  P   P P  R GH    +    +     ++GG                 
Sbjct: 179 INSYKWT-IPHPVG-PRPLGRYGHKISVIATSQMKTKLYVFGG-----------QFDDTY 225

Query: 293 LND-CWYLKMKSDLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDE 346
            ND C Y     DLSS R     WE  K   F P P    +M  +  +  +FGG     +
Sbjct: 226 FNDLCVY-----DLSSFRRPDSHWEFLKPQSFVPPPLTNHTMVSYDYKLWIFGG-----D 275

Query: 347 TEESLESLFYNDLFSYNVETNRWFAL 372
           T + L     N++F Y+   N W  +
Sbjct: 276 TAQGL----INEVFMYDPTVNDWTVV 297

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 90/198 (45%), Gaps = 38/198 (19%)

Query: 73  PQGQHNH-ISPRSNSSMITAASAHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYT---- 127
           P G++ H IS  + S M T          +L +FGG++         ++NDL  Y     
Sbjct: 194 PLGRYGHKISVIATSQMKT----------KLYVFGGQFDD------TYFNDLCVYDLSSF 237

Query: 128 --PDTQQWRKITSQN-SPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDT 184
             PD+  W  +  Q+  P P ++  M  +   + I  GG+ +    N  + Y      D 
Sbjct: 238 RRPDSH-WEFLKPQSFVPPPLTNHTMVSYDYKLWIF-GGDTAQGLINEVFMY------DP 289

Query: 185 STKEWTKVDIKKS-PVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKW 243
           +  +WT V+   S P A   H  V +K+   + GG     + Q +Y NDV+  ++ ++KW
Sbjct: 290 TVNDWTVVETTGSKPPAIQEHAAVVYKDLMCVTGG----KDEQDSYSNDVYFLNLKSFKW 345

Query: 244 TQVEFPKNHPLPDPRSGH 261
            ++ F KN  +P  RSGH
Sbjct: 346 FKLPFFKNG-VPQGRSGH 362

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1167

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 72/264 (27%), Positives = 107/264 (40%), Gaps = 55/264 (20%)

Query: 130 TQQWRKITSQNSPMPR---SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILD--- 183
           T  W +I  QNSP PR    +++       I ++ G    S        Y DTWIL    
Sbjct: 157 TTIWNRIKLQNSPFPRYRHVASSYVSDDGKIYVIGGLHDQSV-------YGDTWILSYEN 209

Query: 184 ---TSTKEWTKVDIKK-SPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDIL 239
              ++T     VDI + +P  R GH      N FV+FGG     N   +  +D++ F+I 
Sbjct: 210 NGLSTTITSKTVDISENTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGSMDDDIYLFNIN 269

Query: 240 NYKWTQVEFPKNHPLPDPRSGH--SWIPVEE---GCILWGGYTXXXXXXXXXXXXXXILN 294
           +YKWT  +     PL   R GH  S I   +      L+GG                  +
Sbjct: 270 SYKWTIPKPVGQRPL--GRYGHKISIIATSQMKTKLYLFGGQ----------------FD 311

Query: 295 DCWYLKMKS-DLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETE 348
           D ++  +   DLSS R     WE  +   F P P    +M  +  +  +FGG        
Sbjct: 312 DTYFNDLVVFDLSSFRRPDSHWEFIRPKSFIPPPLTNHTMCSYDHKLWVFGG-------- 363

Query: 349 ESLESLFYNDLFSYNVETNRWFAL 372
           ++L+ L  N +F Y+   N W  +
Sbjct: 364 DTLQGL-TNQVFMYDPVDNDWCVV 386

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 92/218 (42%), Gaps = 44/218 (20%)

Query: 73  PQGQHNH-ISPRSNSSMITAASAHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYT---- 127
           P G++ H IS  + S M T          +L +FGG++         ++NDL+ +     
Sbjct: 283 PLGRYGHKISIIATSQMKT----------KLYLFGGQFDDT------YFNDLVVFDLSSF 326

Query: 128 --PDTQQWRKITSQN-SPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDT 184
             PD+  W  I  ++  P P ++  MC +   + +  GG+      N  + Y      D 
Sbjct: 327 RRPDSH-WEFIRPKSFIPPPLTNHTMCSYDHKLWVF-GGDTLQGLTNQVFMY------DP 378

Query: 185 STKEWTKV-------DIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFD 237
              +W  V       D+   P     H  V +K+   + GG KD  +N   Y NDV+  +
Sbjct: 379 VDNDWCVVETFANNNDVSNIPPPIQEHAAVLYKDLMCVIGG-KDESDN---YLNDVYFLN 434

Query: 238 ILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGG 275
           +   KW ++ F K   +P  RSGHS   ++   IL  G
Sbjct: 435 LKTLKWFKLPFYKEG-VPQGRSGHSVTLLKNDKILIMG 471

>Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C
           (KEL1) - involved in cell fusion and morphology;
           contains six Kelch repeats [contig 244] FULL
          Length = 978

 Score = 60.8 bits (146), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 70/264 (26%), Positives = 109/264 (41%), Gaps = 59/264 (22%)

Query: 126 YTPDTQQWRKITSQNSPMPR---SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWIL 182
           YTP    WR+I   NSP PR    ++A     + + ++ G    S        Y DTWI+
Sbjct: 73  YTP----WRRIKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS-------VYGDTWIV 121

Query: 183 DTSTKEWTKVDIK------KSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCF 236
            TS +   +   K       +P  R GH      N FV+FGG     N+     +DV+ F
Sbjct: 122 -TSHENGARFTSKTVEISDATPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLF 180

Query: 237 DILNYKWTQVEFPKNHPLPDPRSGH-----SWIPVEEGCILWGGYTXXXXXXXXXXXXXX 291
           +I +YKWT +  P   P P  R GH     +  P++    ++GG                
Sbjct: 181 NINSYKWT-IPNPVG-PRPLGRYGHKISIIAMSPMKTKLYVFGGQ--------------- 223

Query: 292 ILNDCWYLKMKS-DLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFD 345
             +D ++  +   DLSS R     W+      F P P    +M  +  +  +FGG     
Sbjct: 224 -FDDTYFNDLAVFDLSSFRRPDSSWQFITPNSFTPPPLTNHAMISYDYKLWVFGG----- 277

Query: 346 ETEESLESLFYNDLFSYNVETNRW 369
           +T + L     +D+F ++ + N W
Sbjct: 278 DTPQGL----IDDVFVFDPQVNDW 297

>KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {ON}
           Anc_5.88 YGR238C
          Length = 986

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/276 (26%), Positives = 109/276 (39%), Gaps = 64/276 (23%)

Query: 126 YTPDTQQ---------WRKITSQNSPMPR---SSAAMCYHPSGIAILHGGEFSSPKQNTF 173
           +TP TQ+         W +I   NSP PR    ++A       I ++ G    S      
Sbjct: 118 HTPTTQEPFVKRDQTVWNRIKLANSPFPRYRHVASAYATEDDKIYVIGGLHDQSV----- 172

Query: 174 YHYSDTWILDTSTKEWTK-----VDIK-KSPVARSGHRIVHWKNYFVLFGGFKDIGNNQT 227
             Y DTWIL TS    ++     VDI   +P  R GH      N F++FGG     N   
Sbjct: 173 --YGDTWIL-TSENNASRFISQTVDISDNTPPPRVGHAATLCGNAFIIFGGDTHKVNKDG 229

Query: 228 NYFNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEG-----CILWGGYTXXXXX 282
              +D++ F+I ++KWT +  P   P P  R GH    +          L+GG       
Sbjct: 230 LMDDDLYLFNINSHKWT-IPNPVG-PRPLGRYGHKISIIATANSKTRLYLFGGQ------ 281

Query: 283 XXXXXXXXXILNDCWYLKMKS-DLSSI-----RWERRKKLGFQPSPRVGCSMAYHKGRGI 336
                      +D ++  +   DLSS      RWE  K   F P P    +M  +  +  
Sbjct: 282 ----------FDDAYFNDLVVFDLSSFRRPDSRWEFVKPKSFVPPPLTNHTMVSYDNKLW 331

Query: 337 LFGGVYDFDETEESLESLFYNDLFSYNVETNRWFAL 372
           +FGG        ++L+ L  N +F Y+   N W  +
Sbjct: 332 VFGG--------DTLQGL-TNRVFMYDPMINDWTTI 358

>KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1056

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/264 (28%), Positives = 111/264 (42%), Gaps = 59/264 (22%)

Query: 126 YTPDTQQWRKITSQNSPMPR---SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWIL 182
           YTP    W ++   NSP PR    ++A     + + ++ G    S        Y DTWI+
Sbjct: 75  YTP----WSRVKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS-------VYGDTWII 123

Query: 183 ---DTSTKEWTK-VDIK-KSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFD 237
              D  +K  +K VDI   +P  R GH      N FV+FGG     N+     +DV+ F+
Sbjct: 124 SAHDNGSKFSSKTVDITDTTPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFN 183

Query: 238 ILNYKWTQVEFPKN-HPLPDPRSGH--SWIPVEE---GCILWGGYTXXXXXXXXXXXXXX 291
           I +YKWT    P+   P P  R GH  S I   +      ++GG                
Sbjct: 184 INSYKWT---IPRPVGPRPLGRYGHKISIIATSQMRTKLYVFGGQ--------------- 225

Query: 292 ILNDCWYLKMKS-DLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFD 345
             +D ++  +   DLSS R     W+  K   F P P    +M  +  +  +FGG     
Sbjct: 226 -FDDTYFNDLTVFDLSSFRRPDSHWQFIKPNTFTPPPLTNHTMISYDYKLWVFGG----- 279

Query: 346 ETEESLESLFYNDLFSYNVETNRW 369
           +T + L     ND+F ++ + N W
Sbjct: 280 DTPQGL----INDVFMFDPQINDW 299

 Score = 39.7 bits (91), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 83/205 (40%), Gaps = 39/205 (19%)

Query: 178 DTWILDTSTKEWT-KVDIKKSPVARSGHRIV-----HWKNYFVLFGG-FKDIGNNQTNYF 230
           D ++ + ++ +WT    +   P+ R GH+I        +    +FGG F D       YF
Sbjct: 178 DVYLFNINSYKWTIPRPVGPRPLGRYGHKISIIATSQMRTKLYVFGGQFDDT------YF 231

Query: 231 NDVWCFDILNYKWTQV--EFPK-NHPLPDPRSGHSWIPVEEGCILWGGYTXXXXXXXXXX 287
           ND+  FD+ +++      +F K N   P P + H+ I  +    ++GG T          
Sbjct: 232 NDLTVFDLSSFRRPDSHWQFIKPNTFTPPPLTNHTMISYDYKLWVFGGDT---------- 281

Query: 288 XXXXILNDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDET 347
               ++ND +      D     W+  +  G +P P    +   +     + GG  + D  
Sbjct: 282 -PQGLINDVFMF----DPQINDWKVMQTTGDKPPPLQEHAAVLYGDLMCVVGGKDEQD-- 334

Query: 348 EESLESLFYNDLFSYNVETNRWFAL 372
                 ++ N +F  N+ + +WF L
Sbjct: 335 ------VYSNSVFFLNLISLKWFKL 353

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 57.4 bits (137), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 72/270 (26%), Positives = 106/270 (39%), Gaps = 55/270 (20%)

Query: 126 YTPDTQQWRKITSQNSPMPR--SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILD 183
           +TP    W +I  + SP PR    A+     SG   + GG            Y DTWI+ 
Sbjct: 90  FTP----WNRIRLKQSPFPRYRHVASSYATDSGELFVIGGLHDQSV------YGDTWIIK 139

Query: 184 -----TSTKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDI 238
                TS K  T      +P  R GH      N FV+FGG     N+     +D++ F+I
Sbjct: 140 SLDNATSFKSITVPIADATPPPRVGHASTLCGNAFVIFGGDTHKVNDAGLMDDDIYLFNI 199

Query: 239 LNYKWTQVEFPKNHPLPDPRSGH--SWIPVEE---GCILWGGYTXXXXXXXXXXXXXXIL 293
            ++KWT +  P+  P P  R GH  S I   +      ++GG                  
Sbjct: 200 NSHKWT-IPTPQG-PRPLGRYGHKISIIAANQMKTKLYVFGGQ----------------F 241

Query: 294 NDCWYLKMKS-DLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDET 347
           +D ++  +   DLSS R     WE  K   F P P    +M     +  +FGG     +T
Sbjct: 242 DDTYFNDLAEFDLSSFRRSDSHWEFIKPATFMPPPLANHTMISFDHKLWVFGG-----DT 296

Query: 348 EESLESLFYNDLFSYNVETNRWFALNLRKN 377
            + L     N++F ++   N W  +    N
Sbjct: 297 PQGLT----NEVFMFDPAANDWCVVQTTGN 322

>TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1016

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 105/267 (39%), Gaps = 55/267 (20%)

Query: 115 GMTHFYNDLLSYTPDTQQWRKITSQNSPMPR-SSAAMCYHPSGIAILHGGEFSSPKQNTF 173
            +T  +++   YTP    W +I   NSP PR    A  Y      I   G          
Sbjct: 128 AVTTLHHNQKEYTP----WNRIKLTNSPFPRYRHVASSYESVDNEIFVIGGLHDQSV--- 180

Query: 174 YHYSDTWILDTSTKEWTKVDIKK------SPVARSGHRIVHWKNYFVLFGGFKDIGNNQT 227
             Y DTW + TST   T+   K       SP  R GH      N FV+FGG     N   
Sbjct: 181 --YGDTWSI-TSTNNGTQFISKALEILDLSPPPRVGHASTLCGNAFVVFGGDTHKVNKDG 237

Query: 228 NYFNDVWCFDILNYKWTQVEFPKNHPLPDPRSGH--SWIPVEEG---CILWGGYTXXXXX 282
              +D++ F+I ++KWT +  P   P P  R GH  S I          L+GG       
Sbjct: 238 LMDDDIYLFNINSHKWT-IPSPVG-PRPLGRYGHKISIIATSSSKTKLYLFGGQ------ 289

Query: 283 XXXXXXXXXILNDCWYLKMKS-DLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGI 336
                      +D ++  +   DLSS R     WE  K  G  P P    +M  +  +  
Sbjct: 290 ----------FDDTYFNDIAVFDLSSFRRADSHWEFIKPKGLIPPPMTNHTMVTYDNKLW 339

Query: 337 LFGGVYDFDETEESLESLFYNDLFSYN 363
           +FGG     +T++ L     ND+++++
Sbjct: 340 VFGG-----DTKDGL----INDIYAFD 357

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/242 (21%), Positives = 96/242 (39%), Gaps = 43/242 (17%)

Query: 141 SPMPR--SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWT-KVDIKKS 197
           SP PR   ++ +C       ++ GG+     ++      D ++ + ++ +WT    +   
Sbjct: 207 SPPPRVGHASTLC---GNAFVVFGGDTHKVNKDGLMD-DDIYLFNINSHKWTIPSPVGPR 262

Query: 198 PVARSGHRIV-----HWKNYFVLFGG-FKDIGNNQTNYFNDVWCFDILNYKWTQV--EFP 249
           P+ R GH+I        K    LFGG F D       YFND+  FD+ +++      EF 
Sbjct: 263 PLGRYGHKISIIATSSSKTKLYLFGGQFDDT------YFNDIAVFDLSSFRRADSHWEFI 316

Query: 250 KNHPL-PDPRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXXXXILNDCWYLKMKSDLSSI 308
           K   L P P + H+ +  +    ++GG T              ++ND +       +++ 
Sbjct: 317 KPKGLIPPPMTNHTMVTYDNKLWVFGGDT-----------KDGLINDIYAFDPADSINT- 364

Query: 309 RWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESLFYNDLFSYNVETNR 368
            W +    G  P P    S   +     + GG  + D        ++ N +  +N +  +
Sbjct: 365 -WTKIDVTGDIPCPVQEHSALIYDNLMCVIGGKDEND--------MYLNSVHFFNFDKLK 415

Query: 369 WF 370
           WF
Sbjct: 416 WF 417

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/128 (19%), Positives = 52/128 (40%), Gaps = 17/128 (13%)

Query: 243 WTQVEFPKNHPLPDPRS-GHSWIPVEEGCILWGGYTXXXXXXXXXXXXXXILNDCWYLKM 301
           W +++   N P P  R    S+  V+    + GG                +  D W +  
Sbjct: 142 WNRIKL-TNSPFPRYRHVASSYESVDNEIFVIGGL-----------HDQSVYGDTWSITS 189

Query: 302 KSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESLFYNDLFS 361
            ++ +    +  + L   P PRVG +        ++FGG    D  + + + L  +D++ 
Sbjct: 190 TNNGTQFISKALEILDLSPPPRVGHASTLCGNAFVVFGG----DTHKVNKDGLMDDDIYL 245

Query: 362 YNVETNRW 369
           +N+ +++W
Sbjct: 246 FNINSHKW 253

>YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}
           KEL2Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 882

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 67/255 (26%), Positives = 105/255 (41%), Gaps = 51/255 (20%)

Query: 133 WRKITSQNSPMPR---SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWIL----DTS 185
           W ++  +NSP PR   SS+ +  + + I +  G    S        Y D W +    D +
Sbjct: 73  WNRVKLKNSPFPRYRHSSSFIVTNDNRIFVTGGLHDQSV-------YGDVWQIAANADGT 125

Query: 186 TKEWTKVDI-KKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWT 244
           +    ++DI + +P  R GH      N +V+FGG     N      +D++ F+I +YKWT
Sbjct: 126 SFTSKRIDIDQNTPPPRVGHASTICGNAYVVFGGDTHKLNKNGLLDDDLYLFNINSYKWT 185

Query: 245 QVEFPKNHPLPDPRSGH--SWI---PVEEGCILWGGYTXXXXXXXXXXXXXXILNDCWYL 299
             +     PL   R GH  S I   P++    L+GG                  ND    
Sbjct: 186 IPQPIGRRPL--GRYGHKISIIASNPMQTKLYLFGGQV-----------DETYFNDLVVF 232

Query: 300 KMKSDLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESL 354
               DLSS R     WE  + +G  P P    +M  +  +  +FGG     ET +++   
Sbjct: 233 ----DLSSFRRPNSHWEFLEPVGDLPPPLTNHTMVAYDNKLWVFGG-----ETPKTIS-- 281

Query: 355 FYNDLFSYNVETNRW 369
             ND + Y+   + W
Sbjct: 282 --NDTYRYDPAQSEW 294

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 87/192 (45%), Gaps = 30/192 (15%)

Query: 94  AHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWRKITSQ--------NSPMPR 145
           A N    +L +FGG+    ET    ++NDL+ +  D   +R+  S         + P P 
Sbjct: 206 ASNPMQTKLYLFGGQVD--ET----YFNDLVVF--DLSSFRRPNSHWEFLEPVGDLPPPL 257

Query: 146 SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDIK-KSPVARSGH 204
           ++  M  + + + +  GGE      N  Y Y      D +  EW+KV    + P     H
Sbjct: 258 TNHTMVAYDNKLWVF-GGETPKTISNDTYRY------DPAQSEWSKVKTTGEKPPPIQEH 310

Query: 205 RIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWI 264
             V +K+   + GG KD  N    Y NDV+  ++L+ KW ++   K   +P  RSGHS  
Sbjct: 311 ASVVYKHLMCVLGG-KDTHNA---YSNDVYFLNLLSLKWYKLPRMK-EGIPQERSGHSLT 365

Query: 265 PVE-EGCILWGG 275
            ++ E  ++ GG
Sbjct: 366 LMKNEKLLIMGG 377

>ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR158C (KEL1) and
           YGR238C (KEL2)
          Length = 1211

 Score = 54.7 bits (130), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 77/299 (25%), Positives = 117/299 (39%), Gaps = 60/299 (20%)

Query: 97  KKGKELLMFGGEYTSPE--------TGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSA 148
           K GK+  + G   T PE        TG +       +  P+T  W ++    +P PR   
Sbjct: 9   KNGKDKSVVGRATTGPEPVGAAGGPTGGSSRAAGRDARRPETP-WDRVKLVQTPFPRYRH 67

Query: 149 AMCYHPSGI--AILHGGEFSSPKQNTFYHYSDTWILDT--STKEWTKVDIK---KSPVAR 201
               + S     I+ GG            Y DTWIL    + K+++   I+    +P  R
Sbjct: 68  VASAYASDTNEVIVIGGLHDQ------SVYGDTWILRAQDNGKQFSARTIEITETTPPPR 121

Query: 202 SGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPLPDPRSGH 261
            GH      N FV+FGG     NN+    +DV+  ++ ++KWT +  P   P P  R GH
Sbjct: 122 VGHAATLCGNAFVIFGGDTHKTNNEGLMDDDVYLLNVNSHKWT-IPHPVG-PRPLGRYGH 179

Query: 262 --SWIPVEE---GCILWGGYTXXXXXXXXXXXXXXILNDCWYLKMKS-DLSSIR-----W 310
             S I   +      ++GG                  +D ++  +   DLSS R     W
Sbjct: 180 KISIIATSQMKTKLYVFGGQ----------------FDDTYFNDLAVYDLSSFRRPDSHW 223

Query: 311 ERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESLFYNDLFSYNVETNRW 369
              K   F P P    +M  +  +  +FGG     +T + L     N+LF Y+   N W
Sbjct: 224 VFVKPASFVPPPLTNHTMVSYDYKLWVFGG-----DTPQGL----INELFVYDPVVNDW 273

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 47/98 (47%), Gaps = 7/98 (7%)

Query: 180 WILDTSTKEWTKVDIKKS-PVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDI 238
           ++ D    +W+ V+   + P     H  V +++   + GG  D    Q NY  DV+  ++
Sbjct: 264 FVYDPVVNDWSVVETTGAKPPPLQEHAAVLYRDLMCVVGGKDD----QDNYSQDVYFMNM 319

Query: 239 LNYKWTQVEFPKNHPLPDPRSGHS-WIPVEEGCILWGG 275
             ++W ++   ++  +P PRSGHS  +      ++ GG
Sbjct: 320 KTFRWFKLPHFQDM-VPSPRSGHSVTLLANRKLLIMGG 356

>Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C
           (REAL)
          Length = 894

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 97/213 (45%), Gaps = 39/213 (18%)

Query: 73  PQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQ 132
           P G++ H       S+I +   H     EL +FGG+    ET    ++NDL  +  D   
Sbjct: 194 PLGRYGH-----KISIIASKQMHT----ELYLFGGQID--ET----YFNDLAVF--DLSS 236

Query: 133 WRKITSQ--------NSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDT 184
           +R+  S           P P ++  M    + + +  GGE  +PK  +    +DT+  D 
Sbjct: 237 FRRPNSHWEFLEPISALPPPLTNHTMVTFDNKLWVF-GGE--TPKTIS----NDTYCYDP 289

Query: 185 STKEWTKVDIK-KSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKW 243
               W+KV+   + P     H  V +K+   +FGG KDI N    Y NDV+  ++L+ KW
Sbjct: 290 IQNAWSKVETTGEKPPPVQEHASVVYKHLMCVFGG-KDIHNT---YSNDVYFLNLLSLKW 345

Query: 244 TQVEFPKNHPLPDPRSGHSWIPV-EEGCILWGG 275
            ++   K   +P  RSGHS   +  E  ++ GG
Sbjct: 346 FKLPCVK-EGIPQERSGHSLTLMNNEKLVIMGG 377

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/251 (23%), Positives = 103/251 (41%), Gaps = 57/251 (22%)

Query: 140 NSPMPR--SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWT-KVDIKK 196
           N+P PR   ++ MC       ++ GG+     +N      D ++ + ++ +WT    I  
Sbjct: 137 NTPPPRVGHASTMC---GNAYVVFGGDTHKLNKNRLLD-DDLYLFNINSYKWTIPHPIGS 192

Query: 197 SPVARSGHRI-------VHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFP 249
            P+ R GH+I       +H + Y  LFGG  D       YFND+  FD+ +++      P
Sbjct: 193 RPLGRYGHKISIIASKQMHTELY--LFGGQID-----ETYFNDLAVFDLSSFRR-----P 240

Query: 250 KNH--------PLPDPRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXXXXILNDCWYLKM 301
            +H         LP P + H+ +  +    ++GG T              I ND +    
Sbjct: 241 NSHWEFLEPISALPPPLTNHTMVTFDNKLWVFGGETPKT-----------ISNDTYCY-- 287

Query: 302 KSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESLFYNDLFS 361
             D     W + +  G +P P    +   +K    +FGG        + + + + ND++ 
Sbjct: 288 --DPIQNAWSKVETTGEKPPPVQEHASVVYKHLMCVFGG--------KDIHNTYSNDVYF 337

Query: 362 YNVETNRWFAL 372
            N+ + +WF L
Sbjct: 338 LNLLSLKWFKL 348

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 65/259 (25%), Positives = 101/259 (38%), Gaps = 59/259 (22%)

Query: 133 WRKITSQNSPMPR---SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTS---- 185
           W +I  ++SP PR   SS+ +  + + I +  GG +          Y D W +  +    
Sbjct: 73  WNRIKLKDSPFPRYRHSSSFITTNDNRIFVT-GGLYDQSV------YGDVWEITANANGT 125

Query: 186 --TKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKW 243
             T +  ++D   +P  R GH      N +V+FGG     N      +D++ F+I +YKW
Sbjct: 126 SFTSKRIQID-HNTPPPRVGHASTMCGNAYVVFGGDTHKLNKNRLLDDDLYLFNINSYKW 184

Query: 244 TQVEFPKNHPL---PDPRSGHSWIPVEEGCI-----LWGGYTXXXXXXXXXXXXXXILND 295
           T    P  HP+   P  R GH    +    +     L+GG                  ND
Sbjct: 185 T---IP--HPIGSRPLGRYGHKISIIASKQMHTELYLFGG-----------QIDETYFND 228

Query: 296 CWYLKMKSDLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEES 350
                   DLSS R     WE  + +   P P    +M     +  +FGG     ET ++
Sbjct: 229 LAVF----DLSSFRRPNSHWEFLEPISALPPPLTNHTMVTFDNKLWVFGG-----ETPKT 279

Query: 351 LESLFYNDLFSYNVETNRW 369
           +     ND + Y+   N W
Sbjct: 280 IS----NDTYCYDPIQNAW 294

>TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {ON}
           Anc_5.88 YGR238C
          Length = 828

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 100/266 (37%), Gaps = 56/266 (21%)

Query: 129 DTQQWRKITSQNSPMPRSS--AAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTST 186
           D   W KI  + +P PR     +   +PS    ++GG F S        Y DTW L+   
Sbjct: 18  DYSPWSKINVKGTPFPRYRHITSSYIYPSNDLYINGGLFESDV------YGDTWKLNIK- 70

Query: 187 KEWTKVDIKK-------------SPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFND- 232
           + + + D+++             +P  R GH      N  ++FGG     N      +D 
Sbjct: 71  ENYNENDLERWHYSCNIIDIMGTTPPPRVGHAATLCGNALIVFGGDTHKVNVSNGLMDDD 130

Query: 233 VWCFDILNYKWTQVEFPKN-HPLPDPRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXXXX 291
           ++  ++   KWT +  PK   PL   R GH    +     L+GG                
Sbjct: 131 LYFLNLDTTKWT-IPSPKGIRPLG--RYGHKISVINSNLYLFGG-----------QFDET 176

Query: 292 ILNDCWYLKMKSDL-----SSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDE 346
             ND     +K DL     ++ +WE  K  GF P P    SM   + +  +FGG      
Sbjct: 177 YFNDL----VKFDLLNFKDANSQWEFIKPKGFIPPPLSNFSMCTFENKLYVFGG------ 226

Query: 347 TEESLESLFYNDLFSYNVETNRWFAL 372
                  +  N+ F Y+ E N W  L
Sbjct: 227 ---DTYQVLTNETFVYDPELNEWSIL 249

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 76/173 (43%), Gaps = 31/173 (17%)

Query: 102 LLMFGGEYTSPETGMTHFYN----DLLSYTPDTQQWRKITSQN-SPMPRSSAAMCYHPSG 156
           L +FGG++       T+F +    DLL++     QW  I  +   P P S+ +MC   + 
Sbjct: 166 LYLFGGQFDE-----TYFNDLVKFDLLNFKDANSQWEFIKPKGFIPPPLSNFSMCTFENK 220

Query: 157 IAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKV------DIKKSPVARSGHRIVHWK 210
           + +  G  +      TF       + D    EW+ +      D  K P  +  H  + +K
Sbjct: 221 LYVFGGDTYQVLTNETF-------VYDPELNEWSILETFGQEDTNKPPPIQE-HAGIIYK 272

Query: 211 NYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQV-EFPKNHPLPDPRSGHS 262
           +   + GG KD  +N   Y N V+  ++++ KW ++ EF     L   RSGHS
Sbjct: 273 HLMCVVGG-KDSNDN---YLNSVYFLNLISKKWFKLPEFNDTAML--GRSGHS 319

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
           Ashbya gossypii ADL149W
          Length = 1362

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 67/267 (25%), Positives = 105/267 (39%), Gaps = 59/267 (22%)

Query: 129 DTQQWRKITSQNSPMPRSSAAMCYHPSG------IAILHGGEFSSPKQNTFYHYSDTWIL 182
           D   W ++    SP PR       + S       I  LH              Y DTWI+
Sbjct: 154 DETPWNRVKLLQSPFPRYRHVASSYASDSNEVFVIGGLHDQSV----------YGDTWII 203

Query: 183 DT--STKEWTKVDIK---KSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFD 237
            +  +  ++T   ++    +P  R GH      N FV+FGG     N +    +DV+  +
Sbjct: 204 KSHENGNKFTSKTVEITETTPPPRVGHASTLCGNAFVIFGGDTHKTNAEGLMDDDVYLLN 263

Query: 238 ILNYKWTQVEFPKNHPLPDPRSGH--SWIPVEE---GCILWGGYTXXXXXXXXXXXXXXI 292
           I ++KWT +  P   P P  R GH  S I   +      ++GG                 
Sbjct: 264 INSHKWT-IPRPVG-PRPLGRYGHKISIIATSQMKTKLYVFGGQ---------------- 305

Query: 293 LNDCWYLKMKS-DLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDE 346
            +D ++  +   DLSS R     W+  K + F P P    +M  +  +  +FGG     +
Sbjct: 306 FDDTYFNDLAVYDLSSFRRPDSHWQFLKPVSFVPPPLTNHTMVSYDYKLWVFGG-----D 360

Query: 347 TEESLESLFYNDLFSYNVETNRWFALN 373
           T + L     N+LF Y+  TN W  ++
Sbjct: 361 TPQGL----INELFMYDPTTNDWSVVD 383

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 82/186 (44%), Gaps = 33/186 (17%)

Query: 101 ELLMFGGEYTSPETGMTHFYNDLLSYT------PDTQ-QWRKITSQNSPMPRSSAAMCYH 153
           +L +FGG++         ++NDL  Y       PD+  Q+ K  S   P P ++  M  +
Sbjct: 298 KLYVFGGQFDD------TYFNDLAVYDLSSFRRPDSHWQFLKPVS-FVPPPLTNHTMVSY 350

Query: 154 PSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVD---IKKSPVARSGHRIVHWK 210
              + +  GG+      N  + Y      D +T +W+ VD   +K  P+    H  + +K
Sbjct: 351 DYKLWVF-GGDTPQGLINELFMY------DPTTNDWSVVDTTGVKPPPLQE--HAALLYK 401

Query: 211 NYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPL-PDPRSGHSWIPVEEG 269
           +   + GG  D    Q NY  +V+  ++ +++W   + P    L P PRSGHS   +   
Sbjct: 402 DLMCIVGGKDD----QDNYSQEVYFLNLKSFRW--FKLPHFRSLVPSPRSGHSVTLLSNK 455

Query: 270 CILWGG 275
            +L  G
Sbjct: 456 KLLIMG 461

>Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON}
           YGR238C (REAL)
          Length = 894

 Score = 52.4 bits (124), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 90/192 (46%), Gaps = 30/192 (15%)

Query: 94  AHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWRKITSQ--------NSPMPR 145
           A+N    +L +FGG+    ET    ++NDL  +  D   +R+  S           P P 
Sbjct: 206 ANNPMQTKLFLFGGQID--ET----YFNDLAMF--DLSSFRRPNSHWVFLKPVSIVPPPL 257

Query: 146 SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDIK-KSPVARSGH 204
           ++  M    + + +  G    +P  NT  +  +T+  D    +W+K+    + P A   H
Sbjct: 258 TNHTMVTFDNKLWVFGG---KTP--NTLSN--ETFCYDPVQNDWSKIQTTGERPPAVQEH 310

Query: 205 RIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWI 264
             V +K+   +FGG KDI   Q  Y NDV+  +++ +KW ++   K   LP  RSGHS  
Sbjct: 311 ASVVYKHLMCIFGG-KDI---QNAYSNDVYFLNLITFKWYKLPRIK-EGLPKERSGHSLT 365

Query: 265 PVE-EGCILWGG 275
            ++ +  ++ GG
Sbjct: 366 LIKNDKLVIMGG 377

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 67/255 (26%), Positives = 100/255 (39%), Gaps = 51/255 (20%)

Query: 133 WRKITSQNSPMPR---SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWI----LDTS 185
           W +I  +NSP PR   S++ +  + + I +  G        +    Y DTW     LD +
Sbjct: 73  WNRIKLKNSPFPRYRHSASPIVTNDNRIFVTGG-------LHDHLVYGDTWQITGNLDGT 125

Query: 186 TKEWTKVDI-KKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWT 244
           +     + I + +P  R GH      N +V+FGG     N      +D++ F+I +YKWT
Sbjct: 126 SFVSKTIQIGQNTPPPRVGHASTICGNAYVVFGGDTHKLNMNRLLDDDLYLFNINSYKWT 185

Query: 245 QVEFPKNHPLPDPRSGH--SWI---PVEEGCILWGGYTXXXXXXXXXXXXXXILNDCWYL 299
             +     PL   R GH  S I   P++    L+GG                  ND    
Sbjct: 186 IPQPVGTRPL--GRYGHKISIIANNPMQTKLFLFGGQIDETY-----------FNDLAMF 232

Query: 300 KMKSDLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESL 354
               DLSS R     W   K +   P P    +M     +  +FGG     +T  +L   
Sbjct: 233 ----DLSSFRRPNSHWVFLKPVSIVPPPLTNHTMVTFDNKLWVFGG-----KTPNTLS-- 281

Query: 355 FYNDLFSYNVETNRW 369
             N+ F Y+   N W
Sbjct: 282 --NETFCYDPVQNDW 294

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 53/251 (21%), Positives = 104/251 (41%), Gaps = 55/251 (21%)

Query: 139 QNSPMPR--SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWT-KVDIK 195
           QN+P PR   ++ +C       ++ GG+      N      D ++ + ++ +WT    + 
Sbjct: 136 QNTPPPRVGHASTIC---GNAYVVFGGDTHKLNMNRLLD-DDLYLFNINSYKWTIPQPVG 191

Query: 196 KSPVARSGHRIVHWKN-----YFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPK 250
             P+ R GH+I    N        LFGG  D       YFND+  FD+ +++      P 
Sbjct: 192 TRPLGRYGHKISIIANNPMQTKLFLFGGQID-----ETYFNDLAMFDLSSFRR-----PN 241

Query: 251 NH--------PLPDPRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXXXXILNDCW-YLKM 301
           +H         +P P + H+ +  +    ++GG T              + N+ + Y  +
Sbjct: 242 SHWVFLKPVSIVPPPLTNHTMVTFDNKLWVFGGKTPNT-----------LSNETFCYDPV 290

Query: 302 KSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESLFYNDLFS 361
           ++D     W + +  G +P      +   +K    +FGG        + +++ + ND++ 
Sbjct: 291 QND-----WSKIQTTGERPPAVQEHASVVYKHLMCIFGG--------KDIQNAYSNDVYF 337

Query: 362 YNVETNRWFAL 372
            N+ T +W+ L
Sbjct: 338 LNLITFKWYKL 348

>Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa]
           {ON} complement(151895..154816) [2922 nt, 974 aa]
          Length = 973

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 67/265 (25%), Positives = 101/265 (38%), Gaps = 56/265 (21%)

Query: 126 YTPDTQQWRKITSQNSPMPRSSAAMCYHPS---GIAILHGGEFSSPKQNTFYHYSDTWIL 182
           YTP    W +     SP PR       H S    + I+ G    S        Y D W +
Sbjct: 34  YTP----WNRFKLNPSPFPRYRHVASSHASKDDTLFIIGGLREQSV-------YGDVWSI 82

Query: 183 D-TSTKEWTKVDIKKSPVA---RSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDI 238
           +    K ++   I+ +P     R GH      N  +LFGG     N      +D++ F++
Sbjct: 83  NHKDDKSFSASSIEITPTTPPPRVGHASTICGNALILFGGDTHKVNEDGLMDDDLYLFNL 142

Query: 239 LNYKWTQVEFPKNHPLPDPRSGH-----SWIPVEEGCILWGGYTXXXXXXXXXXXXXXIL 293
            +YKWT  E     PL   R GH     +  P +    L+GG                  
Sbjct: 143 NSYKWTIPEPIGLRPL--GRYGHKISIIATQPTKTKLFLFGGQ----------------F 184

Query: 294 NDCWYLKMKS-DLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDET 347
           +D ++  +   DLS+ R     WE  K   F P P    +M  +  +  +FGG       
Sbjct: 185 DDTYFNDLSMFDLSTFRKPDAQWEFIKPKSFFPPPVSNHTMISYDNKLWVFGG------- 237

Query: 348 EESLESLFYNDLFSYNVETNRWFAL 372
            E+L+ L  N++F Y+   N W  +
Sbjct: 238 -ETLQGLI-NEVFVYDPIVNDWSVI 260

>Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON}
           YGR238C (REAL)
          Length = 883

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 104/256 (40%), Gaps = 53/256 (20%)

Query: 133 WRKITSQNSPMPR---SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTS---- 185
           W +I  ++SP PR   SS+ +    + I +  GG ++         Y D W +  +    
Sbjct: 71  WNRIKLKDSPFPRYRHSSSPIVSSENRIFVT-GGLYNQSV------YGDVWQITANADGT 123

Query: 186 --TKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKW 243
             T +  ++D + +P  R GH      N +V+FGG     N      +D++ F++ +YKW
Sbjct: 124 SFTPKAIQID-RNTPPPRVGHASTLCGNAYVVFGGDTHKLNEDKLLDDDIYLFNVNSYKW 182

Query: 244 TQVEFPKNHPLPDPRSGH-----SWIPVEEGCILWGGYTXXXXXXXXXXXXXXILNDCWY 298
           T  +   + PL   R GH     ++ P++    L+GG                  ND   
Sbjct: 183 TIPQPIGSRPL--GRYGHKISIIAYNPMQTKLYLFGG-----------QLDKTYFNDLAM 229

Query: 299 LKMKSDLSSIR-----WERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLES 353
                DLSS R     WE  +     P P    +M  +  +  +FGG     ET +++  
Sbjct: 230 F----DLSSFRRRNSHWEFLEPATTVPPPLANHTMVTYGNKLWVFGG-----ETPKTVS- 279

Query: 354 LFYNDLFSYNVETNRW 369
              N+ + Y+   N W
Sbjct: 280 ---NETYCYDPIQNDW 292

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 88/192 (45%), Gaps = 30/192 (15%)

Query: 94  AHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWRKITSQ--------NSPMPR 145
           A+N    +L +FGG+          ++NDL  +  D   +R+  S           P P 
Sbjct: 204 AYNPMQTKLYLFGGQLDKT------YFNDLAMF--DLSSFRRRNSHWEFLEPATTVPPPL 255

Query: 146 SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDIK-KSPVARSGH 204
           ++  M  + + + +  GGE  +PK  +    ++T+  D    +W+K++   + P     H
Sbjct: 256 ANHTMVTYGNKLWVF-GGE--TPKTVS----NETYCYDPIQNDWSKIETTGEIPPPVQEH 308

Query: 205 RIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWI 264
             V +K+   +FGG          Y NDV+  D+L++KW ++   K   +P  RSGHS  
Sbjct: 309 ASVVYKHIMCVFGG----KYTHNAYSNDVYFLDLLSFKWYKLPHIKEG-IPRERSGHSLT 363

Query: 265 PVE-EGCILWGG 275
            ++ E  ++ GG
Sbjct: 364 LMKNEKILIMGG 375

>TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1172

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 112/293 (38%), Gaps = 76/293 (25%)

Query: 115 GMTHFYNDLLSYTPDTQQWRKITSQNSPMPR---SSAAMCYHPSGIAILHGGEFSSPKQN 171
           G++   N+L  YTP    W +    NSP PR    ++++    + + ++ G    S    
Sbjct: 41  GVSTNPNNLNEYTP----WCRYKLHNSPFPRYRHVASSVVSSDNKVFVIGGLHDQSV--- 93

Query: 172 TFYHYSDTWILDTST-----------------------KEWTKVDIKK-SPVARSGHRIV 207
               Y DTWI+  +T                            V+I + +P  R GH   
Sbjct: 94  ----YGDTWIISENTININSPATMHTPTSTTSTTSNISFSSKTVEITEYTPPPRVGHAST 149

Query: 208 HWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPLPDPRSGH--SWIP 265
              N FV+FGG     N      +D++ F+I +YKWT +  P   P P  R GH  S I 
Sbjct: 150 LCGNAFVIFGGDTHKTNKDGLMDDDIYLFNINSYKWT-IPQPVG-PRPLGRYGHKISIIA 207

Query: 266 VEE---GCILWGGYTXXXXXXXXXXXXXXILND-CWYLKMKSDLSSIR-----WERRKKL 316
             +      ++GG                  ND C Y     DLSS R     WE  K  
Sbjct: 208 TSQMKTKLYVFGG-----------QFDDSYFNDLCVY-----DLSSFRKPESHWEFLKPK 251

Query: 317 GFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESLFYNDLFSYNVETNRW 369
            F P P    +M  +  +  +FGG     +T++ L     N LF ++   N W
Sbjct: 252 SFIPPPLTNHTMVSYDYKLWVFGG-----DTQQGL----INQLFMFDPVINDW 295

>CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {ON}
           weakly similar to uniprot|P50090 Saccharomyces
           cerevisiae YGR238c KEL2 or uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1
          Length = 936

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 97/258 (37%), Gaps = 51/258 (19%)

Query: 133 WRKITSQNSPMPRSS--AAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWIL----DTST 186
           W +    +SP+PR    A+    P     + GG            Y DTW+L    D++ 
Sbjct: 162 WGRTRLMSSPLPRYRHIASTYATPDNRIFVMGGLHGE------LVYGDTWMLTANSDSTN 215

Query: 187 KEWTKVDIK-KSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQ 245
                +D+   +P  R GH      N  V+FGG     N++    +D++ F++ +++WT 
Sbjct: 216 FTTQVIDLTVNTPPPRVGHAATLCGNALVIFGGDTHKLNSEGLLDDDLYLFNVDSHRWTI 275

Query: 246 VEFPKNHPLPDPRSGH-----SWIPVEEGCILWGGYTXXXXXXXXXXXXXXILNDCWYLK 300
                  PL   R GH     +  P +    L+GG                 L+D ++  
Sbjct: 276 PTPIGTRPL--GRYGHQVSVIATTPKKAKLYLFGGQ----------------LDDNYFND 317

Query: 301 MKS-DLSSI-----RWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESL 354
           +   DLS       RW+  K   F P P    +M  +  +  +FGG         S    
Sbjct: 318 LAMYDLSDFRNPHSRWQFLKSKAFTPPPLTNHTMVAYDYKLWVFGG---------SSRGE 368

Query: 355 FYNDLFSYNVETNRWFAL 372
             N L+ Y  + N W  L
Sbjct: 369 LQNQLYVYIPDLNEWRCL 386

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 101/245 (41%), Gaps = 43/245 (17%)

Query: 140 NSPMPR--SSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWT-KVDIKK 196
           N+P PR   +A +C       ++ GG+             D ++ +  +  WT    I  
Sbjct: 226 NTPPPRVGHAATLC---GNALVIFGGDTHKLNSEGLLD-DDLYLFNVDSHRWTIPTPIGT 281

Query: 197 SPVARSGHRI-----VHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYK--WTQVEFP 249
            P+ R GH++        K    LFGG  D      NYFND+  +D+ +++   ++ +F 
Sbjct: 282 RPLGRYGHQVSVIATTPKKAKLYLFGGQLD-----DNYFNDLAMYDLSDFRNPHSRWQFL 336

Query: 250 KNHPL-PDPRSGHSWIPVEEGCILWGGYTXXXXXXXXXXXXXXILNDCWYLKMKSDLSSI 308
           K+    P P + H+ +  +    ++GG +               L +  Y+ +  DL+  
Sbjct: 337 KSKAFTPPPLTNHTMVAYDYKLWVFGGSSRGE------------LQNQLYVYIP-DLN-- 381

Query: 309 RWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESLFYNDLFSYNVETNR 368
            W   +  G +P P    S   +K    +FGG    DE        + N ++  N++T +
Sbjct: 382 EWRCLETEGDKPQPIQEHSATIYKNLMCVFGGKNKDDE--------YQNTMYFLNLQTLK 433

Query: 369 WFALN 373
           W+ L+
Sbjct: 434 WYRLD 438

>KAFR0C02890 Chr3 (570621..574976) [4356 bp, 1451 aa] {ON} Anc_8.157
           YGL197W
          Length = 1451

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 40/94 (42%), Gaps = 11/94 (11%)

Query: 149 AMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDIKKSPVARSGHRIVH 208
           +MCY  S + I  G   S          ++ W LD +TKEW+ +        R  HR VH
Sbjct: 145 SMCYSNSSLYIFGGLVVSPTSAYELVPTNELWRLDLTTKEWSLLSKNPKIKGRFNHR-VH 203

Query: 209 WKN--------YFVLFGGFKDIGNNQTNYFNDVW 234
            KN          V+ GG  D  +N+  Y  DV+
Sbjct: 204 VKNENVNIRDTKLVIVGGLDD--SNRPIYKVDVY 235

>ZYRO0C03344g Chr3 complement(259809..261785) [1977 bp, 658 aa] {ON}
           similar to similar to uniprot|Q08282 YOL141w
           Saccharomyces cerevisiae PPM2 Putative carboxyl methyl
           transferase
          Length = 658

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 48/102 (47%), Gaps = 13/102 (12%)

Query: 91  AASAHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQ-QWRKITSQNSPMPRSSAA 149
            AS  +   K+LL FGG  + P+       N+++S  PD   +        +P+ R+   
Sbjct: 364 GASVLDPNKKQLLYFGG--SCPQRT-----NEIISIGPDGDCEAVPFDKTTAPVARACHT 416

Query: 150 MCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTK 191
                +  A++ GG     ++N +   SDTW+ + S+ EWT+
Sbjct: 417 FTLVNNDTAMVVGG-----RRNPWQPLSDTWMFNLSSHEWTR 453

>KNAG0A01180 Chr1 (9765..11795) [2031 bp, 676 aa] {ON} Anc_3.15
           YOL141W
          Length = 676

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 35/79 (44%), Gaps = 9/79 (11%)

Query: 198 PVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPLPDP 257
           P AR+ H      N  VL  G +   N     +ND+W +D  +  W Q        LP P
Sbjct: 418 PDARTCHTWTKLGNGKVLLVGGR---NAPHRPYNDIWIYDTEHNLWEQ-----KTSLPYP 469

Query: 258 RSGHSWIPVEEGCIL-WGG 275
           R  H    V+E C+L +GG
Sbjct: 470 RFRHCTAQVDENCVLIYGG 488

>Kpol_1049.15 s1049 complement(28625..31222) [2598 bp, 865 aa] {ON}
           complement(28625..31222) [2598 nt, 866 aa]
          Length = 865

 Score = 35.0 bits (79), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%), Gaps = 13/76 (17%)

Query: 210 KNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVE-FPKNH-------PLPDPRSGH 261
           K   VL+GG     +N  + + D+W FD+   KW  V  F K         P+  P  GH
Sbjct: 670 KKTLVLYGG-----SNYYDVYGDMWWFDLDGEKWECVSAFAKTENNDEGMVPIEVPNVGH 724

Query: 262 SWIPVEEGCILWGGYT 277
           S  P+    +  GG T
Sbjct: 725 SLCPIGSMLVCVGGLT 740

>Kwal_55.20756 s55 (545793..550520) [4728 bp, 1575 aa] {ON} YGL197W
           (MDS3) - 1:1 [contig 139] FULL
          Length = 1575

 Score = 34.7 bits (78), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 323 RVGCSMAYHKGRGILFGGVYDFDETEESLESLFYNDLFSYNVETNRWFALN 373
           RV  SM +H GR  LFGG+    +++  L  +  N+L+S ++ET  W  L+
Sbjct: 138 RVFHSMCFHDGRLYLFGGLVVSPQSDYEL--IASNELWSLDLETKTWLQLS 186

>TDEL0A00340 Chr1 (58839..60872) [2034 bp, 677 aa] {ON} Anc_3.15
           YOL141W
          Length = 677

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 49/119 (41%), Gaps = 13/119 (10%)

Query: 100 KELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAI 159
           K +L FGG  +SP        N+L+    DT  +  + +  +P  R    +    S    
Sbjct: 386 KLVLYFGG--SSPAR-----LNELIEVDVDTGNYIPLDTGEAPPVRMCHTLTSLGSSQEF 438

Query: 160 LHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGG 218
           +  G   SPK      Y+DTW+ +  +  W +      P +R  H     +N  ++FGG
Sbjct: 439 MMIGGRQSPKDG----YTDTWVFNMGSNLWRQG--PSLPESRYRHAACLIENQILVFGG 491

>KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa]
           {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
           YLR084C RAX2 N-glycosylated protein involved in the
           maintenance of bud site selection during bipolar budding
           localization requires Rax1p
          Length = 1200

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 26/60 (43%), Gaps = 9/60 (15%)

Query: 310 WERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESLFYNDLFSYNVETNRW 369
           +E   ++ F  + RV   +++     IL GG Y+ D           NDL  YN +T  W
Sbjct: 874 YENVARVNFSTNERVNSMVSFSSNNSILVGGSYEIDNC---------NDLCLYNYQTKEW 924

>ADR414C Chr4 complement(1450330..1452684) [2355 bp, 784 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL056W
           (KRH1) and YOR371C (KRH2)
          Length = 784

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 33/72 (45%), Gaps = 16/72 (22%)

Query: 158 AILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDI--------KKSPVA--RSGHRIV 207
            I+HGG   S        Y D W  D + + W+++ +        ++ P+     GH I 
Sbjct: 611 VIIHGGSDGS------RVYGDMWWFDLADERWSRIALYSRDPDSGERRPIGLPAVGHSIF 664

Query: 208 HWKNYFVLFGGF 219
           H ++ F+L+GG 
Sbjct: 665 HSRDEFLLYGGL 676

>KLLA0F00374g Chr6 complement(20124..22511) [2388 bp, 795 aa] {ON}
           weakly similar to uniprot|Q08886 Saccharomyces
           cerevisiae YOR371C GPB1 Proposed beta subunit of the
           heterotrimeric G protein that interacts with the
           receptor Grp1p has signaling role in response to
           nutrients involved in regulation of pseudohyphal growth
           through cAMP levels homolog of Gpb2p
          Length = 795

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 32/84 (38%), Gaps = 16/84 (19%)

Query: 159 ILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDIKKS----------PVARSGHRIVH 208
           I+HGG       N F H  D W  D     WTK+ +K                +GH  VH
Sbjct: 617 IIHGGS-----ANKFIH-GDMWCYDLDEGTWTKLSLKAKDKETGELKIVEFPLTGHTFVH 670

Query: 209 WKNYFVLFGGFKDIGNNQTNYFND 232
            K   V+ GG      + + Y+ D
Sbjct: 671 NKQITVVIGGLSQKDVDSSLYWKD 694

>TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7.9
           YAL056W
          Length = 838

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 6/59 (10%)

Query: 223 GNNQTNYFNDVWCFDILNYKWTQVEFPKNH------PLPDPRSGHSWIPVEEGCILWGG 275
           G+N T+ ++D+W FD     W Q+E           P+    +GHS   V    I  GG
Sbjct: 664 GSNATHIYSDMWWFDFETESWVQIETQAQTEDKGLVPIEMALAGHSMATVGSASIFVGG 722

>KNAG0G01390 Chr7 complement(313096..317799) [4704 bp, 1567 aa] {ON}
           Anc_8.157 YGL197W
          Length = 1567

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 45/104 (43%), Gaps = 16/104 (15%)

Query: 149 AMCYHPSGIAILHGGEFSSPKQN-TFYHYSDTWILDTSTKEWTKVDIKKSPVARSGHRIV 207
           AMCY    + I  GG   SP+        ++ W LD  T +WT +    S +AR  +  V
Sbjct: 183 AMCYVDHSLFIF-GGLVVSPQNGYELVATNELWKLDLLTNKWTLLSRNPS-IARRFNHTV 240

Query: 208 HWKN--------YFVLFGGFKDIGN--NQTNYFN---DVWCFDI 238
           H KN          ++ GG  ++    N  + +N   + W F++
Sbjct: 241 HVKNELRDTRDTKLIIVGGLNNLNEPINTIDIYNVTQNCWQFEV 284

>Ecym_5007 Chr5 (13107..15623) [2517 bp, 838 aa] {ON} similar to
           Ashbya gossypii ADR414C
          Length = 838

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 32/71 (45%), Gaps = 16/71 (22%)

Query: 159 ILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDI----------KKSPVARSGHRIVH 208
           ++HGG       N  + Y D W  D  +++WT+V +           ++ +   GH +V 
Sbjct: 656 VVHGGS------NGTHVYGDMWWFDLDSEQWTEVPLLLKNEHTKQRDRTCIPVVGHELVQ 709

Query: 209 WKNYFVLFGGF 219
             + F++ GG 
Sbjct: 710 HNSRFLILGGI 720

>Kpol_1043.52 s1043 (102664..103416) [753 bp, 250 aa] {ON}
           (102664..103416) [753 nt, 251 aa]
          Length = 250

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 12/89 (13%)

Query: 161 HGGEFSSPKQNTFYHYSDTWILDTST-KEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGF 219
           HG E      ++  H+S T++ D  T +EW K D   + + +SG+           +G  
Sbjct: 164 HGIELKFKDPHSKSHFSATFLPDVMTEQEWDKEDTFLNLIEKSGY-----------WGNA 212

Query: 220 KDIGNNQTNYFNDVWCFDILNYKWTQVEF 248
           KD+ NN  +YF +V  ++ +    T  EF
Sbjct: 213 KDVLNNYQDYFLEVIRYEGVKSSITYEEF 241

>KNAG0E04180 Chr5 complement(833612..836071) [2460 bp, 819 aa] {ON} 
          Length = 819

 Score = 31.6 bits (70), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 211 NYFVLFGGFKDIGNNQTNYFNDVWCFDI 238
           N  ++FGG+K +G+++    ND+W  DI
Sbjct: 496 NRILIFGGYKQVGDDEYEAMNDLWQVDI 523

>KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9
           YAL056W
          Length = 878

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 8/63 (12%)

Query: 223 GNNQTNYFNDVWCFDILNYKWTQVEF---PKNH-----PLPDPRSGHSWIPVEEGCILWG 274
           G++ TN + D+W FD+  ++WT+V     PK+      P+     GH+ +      +  G
Sbjct: 701 GSDDTNVYGDMWWFDLETFQWTKVATYIKPKDQDSSLVPINIKIVGHTMMTSGCMAVCVG 760

Query: 275 GYT 277
           G T
Sbjct: 761 GIT 763

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,713,535
Number of extensions: 2686512
Number of successful extensions: 7663
Number of sequences better than 10.0: 74
Number of HSP's gapped: 7464
Number of HSP's successfully gapped: 144
Length of query: 663
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 547
Effective length of database: 40,180,143
Effective search space: 21978538221
Effective search space used: 21978538221
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)