Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0I027406.6ON66663351e-42
Suva_16.346.6ON62592161e-24
Skud_16.66.6ON62592126e-24
NCAS0D022006.6ON85642112e-23
KAFR0B064906.6ON66622066e-23
Smik_6.4796.6ON62592049e-23
YPL271W (ATP15)6.6ON62591996e-22
TDEL0G046506.6ON62611987e-22
TBLA0A072006.6ON65591971e-21
CAGL0A01111g6.6ON69641936e-21
Kpol_1045.826.6ON62591918e-21
ZYRO0F00418g6.6ON62571902e-20
Klac_YGOB_Anc_6.66.6ON61591883e-20
KNAG0E027906.6ON65621875e-20
Sklu_YGOB_Anc_6.66.6ON61591804e-19
Kthe_YGOB_Anc_6.66.6ON62591788e-19
Kwal_56.223336.6ON62591674e-17
TPHA0J002306.6ON62591641e-16
Ecym_30086.6ON61591321e-11
ACR021W6.6ON62591067e-08
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0I02740
         (66 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}...   133   1e-42
Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W (REAL)    88   1e-24
Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)       86   6e-24
NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6 Y...    86   2e-23
KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa] {O...    84   6e-23
Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON} ...    83   9e-23
YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon ...    81   6e-22
TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6 Y...    81   7e-22
TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa] {O...    80   1e-21
CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly s...    79   6e-21
Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON} (192423...    78   8e-21
ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON} ...    78   2e-20
Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa] ...    77   3e-20
KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6 Y...    77   5e-20
Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa] ...    74   4e-19
Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON} ANN...    73   8e-19
Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON} ...    69   4e-17
TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON} ...    68   1e-16
Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON} sim...    55   1e-11
ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic homo...    45   7e-08

>NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}
          Anc_6.6 YPL271W
          Length = 66

 Score =  133 bits (335), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 66/66 (100%), Positives = 66/66 (100%)

Query: 1  MSSSAVWRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEP 60
          MSSSAVWRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEP
Sbjct: 1  MSSSAVWRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEP 60

Query: 61 ESLQKK 66
          ESLQKK
Sbjct: 61 ESLQKK 66

>Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W
          (REAL)
          Length = 62

 Score = 87.8 bits (216), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 52/59 (88%)

Query: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65
          WRKAG++Y+AYL++AA+T+R++LK ELQTA V++RS TDAY+TKYK+G  ASEP S+ K
Sbjct: 4  WRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSITK 62

>Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)
          Length = 62

 Score = 86.3 bits (212), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 53/59 (89%)

Query: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65
          WRKAGI+Y+AYL++AA+T+R++LK ELQTA+V++RS TDA++TKYK+GA ASEP  + K
Sbjct: 4  WRKAGISYAAYLNVAAQTIRSSLKTELQTASVLSRSKTDAFYTKYKNGAAASEPTPITK 62

>NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6
          YPL271W
          Length = 85

 Score = 85.9 bits (211), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 40/64 (62%), Positives = 51/64 (79%)

Query: 1  MSSSAVWRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEP 60
          M  SA  RKAG+TY+ YL +A+RTLRA+LK ELQT  VMARS+TDAY+TKY+ G+P ++P
Sbjct: 18 MPLSATLRKAGVTYAQYLCVASRTLRASLKTELQTPVVMARSNTDAYYTKYEKGSPIADP 77

Query: 61 ESLQ 64
            LQ
Sbjct: 78 APLQ 81

>KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa]
          {ON} Anc_6.6 YPL271W
          Length = 66

 Score = 84.0 bits (206), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 39/62 (62%), Positives = 51/62 (82%)

Query: 4  SAVWRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESL 63
          S+VWRKAG+TY++YLSIA++TLR  LK E QTA V +RS T+A+ T YK+G+P S+PE L
Sbjct: 2  SSVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPL 61

Query: 64 QK 65
          QK
Sbjct: 62 QK 63

>Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON}
          YPL271W (REAL)
          Length = 62

 Score = 83.2 bits (204), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 52/59 (88%)

Query: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65
          WRKAGI+Y+AYL++AA+ +R++LK ELQTA+V++RS TDA++T+YK+GA ASEP  + K
Sbjct: 4  WRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPITK 62

>YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon
          subunit of the F1 sector of mitochondrial F1F0 ATP
          synthase, which is a large, evolutionarily conserved
          enzyme complex required for ATP synthesis;
          phosphorylated
          Length = 62

 Score = 81.3 bits (199), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 50/59 (84%)

Query: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65
          WRKAGI+Y+AYL++AA+ +R++LK ELQTA+V+ RS TDA++T+YK+G  ASEP  + K
Sbjct: 4  WRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPITK 62

>TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6
          YPL271W
          Length = 62

 Score = 80.9 bits (198), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 39/61 (63%), Positives = 49/61 (80%)

Query: 5  AVWRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQ 64
          A WRKAG+TY+ YLS+AART+RAALKPELQ A V+ARS TDA + KY+ G+ AS+   LQ
Sbjct: 2  AAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPLQ 61

Query: 65 K 65
          +
Sbjct: 62 E 62

>TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa]
          {ON} Anc_6.6 YPL271W
          Length = 65

 Score = 80.5 bits (197), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 37/59 (62%), Positives = 49/59 (83%)

Query: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65
          WRKAGITY+AY++IAA+T+R ALKPELQTA V+ RS T+A FTKY  G+P ++P  L++
Sbjct: 4  WRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALLKE 62

>CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271w ATP15
          Length = 69

 Score = 79.0 bits (193), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 50/64 (78%)

Query: 2  SSSAVWRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPE 61
          ++S  WRKAG++YS++L+IAART+R +LK ELQT  VM R  TDA +TKY+ G+P S+P 
Sbjct: 6  NASTAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPI 65

Query: 62 SLQK 65
           LQ+
Sbjct: 66 PLQE 69

>Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON}
          (192423..192611) [189 nt, 63 aa]
          Length = 62

 Score = 78.2 bits (191), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 34/59 (57%), Positives = 47/59 (79%)

Query: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65
          WRKAGITY+ Y++IAA+T+R ALK EL+T TV+ARS T+A F  +++GAP  EP  +Q+
Sbjct: 4  WRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPIQQ 62

>ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON}
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271W ATP15 Epsilon subunit of the F1 sector of
          mitochondrial F1F0 ATP synthase which is a large
          evolutionarily conserved enzyme complex required for
          ATP synthesis
          Length = 62

 Score = 77.8 bits (190), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 46/57 (80%)

Query: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESL 63
          WRKAG+TY+AYLS+AA+T+R+ALKPE QTA V++R   D+ +TK++ G P  EP+ L
Sbjct: 4  WRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60

>Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 77.0 bits (188), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 49/59 (83%), Gaps = 1/59 (1%)

Query: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65
          WRKAG+T++ Y+S+AA T+RAALKPELQT +V+ARS ++A F K+++G  ASEP  L+K
Sbjct: 4  WRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGV-ASEPVPLKK 61

>KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6
          YPL271W
          Length = 65

 Score = 76.6 bits (187), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 34/62 (54%), Positives = 48/62 (77%)

Query: 4  SAVWRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESL 63
          SA W+KAGITY+ YL++ A+TLR+ALK ELQT  V++R  TDA +T Y+ G P ++P+ L
Sbjct: 2  SAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQPL 61

Query: 64 QK 65
          Q+
Sbjct: 62 QE 63

>Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 73.9 bits (180), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 48/59 (81%), Gaps = 1/59 (1%)

Query: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65
          WRKAG+TY+ YLSIAA+T+RAALK E QTA V++RS ++A F K+++G P S+P  L+K
Sbjct: 4  WRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTP-SDPIPLKK 61

>Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 62

 Score = 73.2 bits (178), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 46/59 (77%)

Query: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65
          WRKAG+TY+ Y++IAA+T+R+ALK +LQTA V+ RS T+A F KY+ G P +E + L+ 
Sbjct: 4  WRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPLKN 62

>Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON}
          YPL271W (ATP15) - nuclear gene for ATP synthase epsilon
          subunit [contig 186] FULL
          Length = 62

 Score = 68.9 bits (167), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 46/59 (77%)

Query: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65
          WRKAG+TY+ Y++IAA+T+R+ALK E QTA V+ RS T+A F KY++G   +E + L++
Sbjct: 4  WRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPLKE 62

>TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON}
          Anc_6.6 YPL271W
          Length = 62

 Score = 67.8 bits (164), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 45/59 (76%)

Query: 5  AVWRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESL 63
          + WRKAG+TYS YL++AA+T+R +LK +L+T +V++RS TD  +T ++ G   SEP S+
Sbjct: 2  STWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60

>Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON}
          similar to Ashbya gossypii ACR021W
          Length = 61

 Score = 55.5 bits (132), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 47/59 (79%), Gaps = 1/59 (1%)

Query: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65
          WRKAG++Y+ Y+++AAR +R+ALKPEL+ A V++RS+T+A    YKDGA AS+   L+K
Sbjct: 4  WRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGA-ASDAVPLKK 61

>ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YPL271W (ATP15)
          Length = 62

 Score = 45.4 bits (106), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 42/59 (71%)

Query: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65
          WRKAG+TY++YL++AART+RAALK ELQ+  V+ RS T+A    Y     A+E   L+K
Sbjct: 4  WRKAGLTYNSYLAVAARTVRAALKKELQSPAVLNRSVTEAKVIDYASKGSAAEAVPLRK 62

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.120    0.330 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,826,444
Number of extensions: 140493
Number of successful extensions: 232
Number of sequences better than 10.0: 20
Number of HSP's gapped: 232
Number of HSP's successfully gapped: 20
Length of query: 66
Length of database: 53,481,399
Length adjustment: 39
Effective length of query: 27
Effective length of database: 49,009,425
Effective search space: 1323254475
Effective search space used: 1323254475
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)