Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0I027306.5ON83283238050.0
NCAS0D022106.5ON77368025740.0
CAGL0A01133g6.5ON80170122990.0
Suva_16.356.5ON76767322770.0
Smik_6.4786.5ON77368622710.0
YPL270W (MDL2)6.5ON77358122600.0
TDEL0G046606.5ON73968522380.0
Skud_16.76.5ON77369722400.0
Kpol_1045.836.5ON74866322180.0
ZYRO0F00396g6.5ON73259221980.0
TBLA0A071906.5ON79458021700.0
TPHA0J002206.5ON74065721450.0
KNAG0E028006.5ON74168120770.0
SAKL0E00748g6.5ON77459120320.0
Kwal_56.223296.5ON77659120010.0
KLLA0D00748g6.5ON78958920000.0
KAFR0B064806.5ON75159319820.0
KLTH0C11616g6.5ON74059119760.0
ACR022W6.5ON75459719430.0
Ecym_30076.5ON76959819000.0
Kpol_2000.791.67ON70760313571e-176
TPHA0B046201.67ON72059513571e-176
Smik_12.2481.67ON69658413241e-172
NCAS0B087001.67ON71559913251e-171
TDEL0C063501.67ON69358813141e-170
YLR188W (MDL1)1.67ON69558413121e-170
Skud_12.2531.67ON69259013121e-170
Ecym_10721.67ON68358813091e-169
SAKL0C02244g1.67ON71260513081e-169
Suva_10.2841.67ON69359112951e-167
NDAI0A005601.67ON71459512951e-167
KLLA0C01991g1.67ON70658812921e-167
AFR683C1.67ON67758412811e-166
ZYRO0F17050g1.67ON71460112631e-162
Kwal_33.133081.67ON70659712401e-159
KLTH0F02024g1.67ON73460512411e-159
TBLA0A053001.67ON70759512141e-155
CAGL0E00385g1.67ON60857911501e-147
Kwal_26.94805.20ON7193865115e-54
KLLA0A10131g5.20ON7203945109e-54
Skud_13.4755.20ON6913895072e-53
Smik_13.5185.20ON6873895043e-53
Suva_13.4915.20ON6933935043e-53
KLTH0B09482g5.20ON6943885026e-53
YMR301C (ATM1)5.20ON6903894982e-52
SAKL0H00968g5.20ON7003924964e-52
TDEL0F003401.527ON12574945031e-51
KNAG0E013205.20ON6953904894e-51
YKL209C (STE6)1.527ON12905284888e-50
NCAS0D024305.20ON7023934781e-49
Ecym_56495.20ON6963874771e-49
TBLA0C070005.20ON7253914762e-49
NDAI0I024405.20ON7304634711e-48
KAFR0I025805.20ON7093414673e-48
Kpol_1018.1851.527ON12764994736e-48
KNAG0G001901.527ON12754914727e-48
TPHA0L022705.20ON7113974648e-48
TDEL0G004305.20ON6963894621e-47
AGL335W5.20ON6913854584e-47
CAGL0M13739g5.20ON7273864585e-47
NDAI0D015401.527ON12935044639e-47
Kpol_513.235.20ON7083424569e-47
ZYRO0D07106g5.20ON7093854514e-46
SAKL0A10208g1.527ON13104964551e-45
Skud_11.111.527ON12955024513e-45
KAFR0E002301.527ON12704984504e-45
Suva_11.111.527ON12904964495e-45
NCAS0G035101.527ON12885034442e-44
ZYRO0G02244g1.527ON12734194406e-44
CAGL0K00363g1.527ON12274294398e-44
TBLA0B100701.527ON12965244328e-43
KLLA0B14256g1.527ON12714924193e-41
AFR432W1.527ON12844894184e-41
Smik_11.141.527ON13164454166e-41
TPHA0O001601.527ON12534314157e-41
KLTH0B01100g1.527ON12984274051e-39
TPHA0C009608.303ON15234873953e-38
Ecym_36121.527ON13155043918e-38
YHL035C (VMR1)4.6ON15925143882e-37
Kwal_33.155611.527ON12973833829e-37
KAFR0B056308.303ON15154973757e-36
NCAS0B034708.303ON15124903684e-35
CAGL0C03289g4.6ON16485023661e-34
TDEL0E056104.52ON15355493641e-34
NCAS0E041605.10ON15065503642e-34
Ecym_42658.303ON15055013622e-34
Skud_4.3958.303ON15164943613e-34
NDAI0B006405.10ON14915413613e-34
NDAI0J011508.303ON15175003604e-34
YGR281W (YOR1)5.10ON14775453587e-34
KNAG0E011204.6ON17175093561e-33
KNAG0J027304.52ON15374983561e-33
Skud_7.6145.10ON14775433552e-33
KNAG0K001705.10ON14424983552e-33
CAGL0E03982g4.6ON16595533552e-33
Smik_16.275.10ON14775453542e-33
Suva_7.5775.10ON14785463533e-33
ZYRO0G07612g4.6ON16954993543e-33
NCAS0C059304.6ON16575003533e-33
KAFR0C065105.10ON14574993523e-33
TBLA0G007104.6ON16915213524e-33
SAKL0H16016g8.303ON14994973515e-33
Smik_4.3808.303ON15165043515e-33
Smik_8.64.6ON15855083508e-33
SAKL0H00704g5.10ON14395573498e-33
YDR135C (YCF1)8.303ON15155013499e-33
Smik_12.484.52ON15575483472e-32
ZYRO0D06160g8.303ON15254803472e-32
CAGL0G00242g5.10ON14775143462e-32
CAGL0E03355g4.52ON15355023462e-32
Ecym_84184.6ON16784953444e-32
Suva_2.2978.303ON15165023444e-32
Kwal_34.157704.6ON14365093435e-32
Suva_8.164.6ON15995423391e-31
Kpol_1033.288.303ON15315033382e-31
KNAG0I009908.303ON15354883382e-31
NDAI0H001904.6ON16825073382e-31
Kwal_56.22747na 1ON15384813363e-31
KLTH0G12716g8.303ON15004903355e-31
AGR047W8.303ON14924953345e-31
NCAS0J00160singletonON16544993338e-31
KLLA0F20075g8.303ON15164943321e-30
TDEL0F043008.303ON15144883311e-30
TPHA0F001804.6ON16464953312e-30
TPHA0K023104.6ON16494783302e-30
KLTH0C09240gna 1ON15463093302e-30
SAKL0H26026g4.6ON16535153302e-30
CAGL0L06402g8.303ON15354743292e-30
YLL048C (YBT1)4.6ON16615593293e-30
Suva_10.234.6ON16615153283e-30
Skud_12.524.52ON15615443274e-30
KLTH0H16038g4.6ON16495103265e-30
Kpol_311.34.6ON16575073241e-29
Kpol_1060.75.10ON14605443241e-29
TDEL0G018504.6ON16425113222e-29
KLLA0E00529g4.6ON16504943222e-29
Kwal_56.238448.303ON14944693194e-29
KAFR0I013004.52ON15362473194e-29
TPHA0A056205.10ON14775063176e-29
Skud_8.94.6ON15875093168e-29
ZYRO0G22176g4.52ON15704933168e-29
KLTH0B00396gsingletonON15074863141e-28
Suva_10.594.52ON15615513142e-28
Suva_10.60singletonON9905453112e-28
TBLA0A038008.303ON15465403132e-28
Smik_12.114.6ON16615203113e-28
KAFR0L001904.6ON16533843113e-28
Skud_12.224.6ON16615193104e-28
YKR104WsingletonON3062522917e-28
SAKL0H23958g4.52ON15582573071e-27
TDEL0G003305.10ON14655113052e-27
KLLA0C14234g5.10ON14544983042e-27
TPHA0F004104.52ON15705053015e-27
YLL015W (BPT1)4.52ON15595503007e-27
Zrou_YGOB_Anc_5.105.10ON9925052997e-27
KLTH0B09724g5.10ON14865062999e-27
Smik_11.367na 2ON15955472918e-26
AGL346W5.10ON14004992891e-25
TBLA0C06400singletonON13775242872e-25
KLLA0D04059g4.52ON15682352863e-25
TBLA0A06840singletonON10582812827e-25
Skud_18.2singletonON15802502837e-25
Kwal_26.95325.10ON14714982837e-25
TBLA0C071005.10ON14855022821e-24
ACL072C4.6ON16275052792e-24
Kpol_YGOB_1041.454.52ON15685302758e-24
Kpol_1041.45singletonOFF15965302731e-23
Ecym_56605.10ON15362132095e-16
YKR103W (NFT1)na 2ON12182312032e-15
ACR128C8.661ON8271991791e-12
SAKL0D10208g1.366ON7522361772e-12
Kpol_175.1singletonON13772191773e-12
Suva_16.1638.661ON8701961763e-12
YPL147W (PXA1)8.661ON8701961745e-12
ZYRO0E08800g3.534ON6102421736e-12
Smik_6.3448.661ON8701961737e-12
Kwal_26.87308.661ON8311991728e-12
CAGL0K10472g1.366ON7522111711e-11
KAFR0A037908.661ON8762061701e-11
ZYRO0D11880g5.500ON14982221702e-11
YER036C (ARB1)3.534ON6102461692e-11
YOL075C3.133ON12942481692e-11
Suva_5.1343.534ON6101871673e-11
SAKL0F01606g3.534ON6081871663e-11
AFR232C3.534ON6072651663e-11
KAFR0C045401.366ON7522381674e-11
TPHA0D011708.661ON9152071674e-11
Skud_16.1358.661ON8701961664e-11
KNAG0C019601.366ON7522381664e-11
Skud_5.1453.534ON6101871664e-11
Smik_5.1593.534ON6101871664e-11
KLTH0D10890g8.661ON8302091664e-11
ZYRO0D11836gna 3ON14622371674e-11
TDEL0B057601.427ON10362661665e-11
CAGL0C02343g3.534ON7202451655e-11
KNAG0A029808.661ON8713421656e-11
TPHA0A058903.534ON6102441638e-11
Suva_15.913.133ON13022461649e-11
Ecym_24108.661ON8282131631e-10
Ecym_11943.534ON6092101621e-10
NDAI0H035701.366ON7552101631e-10
Smik_15.843.133ON12952371631e-10
Kwal_47.191163.534ON6072461602e-10
KNAG0K009503.133ON12842311612e-10
NDAI0E012408.661ON8972201602e-10
KLTH0H13442g1.366ON7522401602e-10
TDEL0A060708.661ON8721931593e-10
TBLA0D043501.427ON11192471603e-10
KLLA0F11484g8.661ON8452331593e-10
NCAS0E004803.534ON6102421583e-10
AEL032W1.366ON7532401584e-10
ZYRO0G01144g1.366ON7522721584e-10
TBLA0I033303.534ON6102081574e-10
Kwal_34.162401.366ON7522401575e-10
YFR009W (GCN20)1.366ON7522101575e-10
TPHA0A008403.133ON13122461585e-10
TDEL0D060203.534ON6102081575e-10
Smik_7.3131.366ON7522101566e-10
ZYRO0D11858gna 4ON15032261576e-10
CAGL0I04862g3.220ON15072391576e-10
KAFR0J027003.534ON6082081558e-10
TBLA0D017805.500ON15952271569e-10
TBLA0D01820singletonON15512251551e-09
NDAI0B028703.133ON12672381551e-09
TBLA0C012201.366ON7512341541e-09
TDEL0A036405.500ON15092251551e-09
AGL142CsingletonON14972221551e-09
KAFR0C05210na 4ON14932251551e-09
NDAI0I030203.534ON6092421531e-09
Suva_6.841.366ON7522101531e-09
Kpol_1043.431.366ON7522361531e-09
ZYRO0E04092g1.427ON10622411532e-09
NCAS0A085701.427ON10602521532e-09
KNAG0B038705.500ON15132221532e-09
SAKL0D09394g1.427ON10272381522e-09
SAKL0H06908g8.661ON8361851522e-09
KLTH0G01452g3.534ON6072421512e-09
KAFR0E03450na 4ON15532221523e-09
ZYRO0A04114g3.220ON15182381523e-09
KAFR0C052205.500ON14992371513e-09
KNAG0I005301.427ON10472481504e-09
ZYRO0F07018g8.661ON8611981504e-09
Kpol_1050.263.534ON6101871494e-09
Kwal_0.3271.427ON10192381504e-09
Ecym_8014na 5ON15172591505e-09
KLLA0D03432g3.220ON14832411495e-09
KAFR0E03460na 3ON15462221495e-09
TBLA0C017808.661ON8881911495e-09
KLLA0A10857g1.366ON7522291486e-09
NCAS0B053003.133ON12732361496e-09
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0I02730
         (832 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {O...  1470   0.0  
NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5      996   0.0  
CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} simila...   890   0.0  
Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W (...   881   0.0  
Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON...   879   0.0  
YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}  MDL2Mitocho...   875   0.0  
TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5...   866   0.0  
Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)   867   0.0  
Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON} (1930...   858   0.0  
ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON...   851   0.0  
TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa] ...   840   0.0  
TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON...   830   0.0  
KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5...   804   0.0  
SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON...   787   0.0  
Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON...   775   0.0  
KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON...   775   0.0  
KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa] ...   768   0.0  
KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} simila...   765   0.0  
ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic ho...   753   0.0  
Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON} s...   736   0.0  
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...   527   e-176
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...   527   e-176
Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188...   514   e-172
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...   514   e-171
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...   510   e-170
YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}  MDL1Mitoc...   509   e-170
Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188...   509   e-170
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...   508   e-169
SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} simila...   508   e-169
Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188...   503   e-167
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...   503   e-167
KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} simila...   502   e-167
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...   498   e-166
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...   491   e-162
Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188...   482   e-159
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...   482   e-159
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...   472   e-155
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...   447   e-147
Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa] ...   201   5e-54
KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {...   201   9e-54
Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {...   199   2e-53
Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {...   198   3e-53
Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {...   198   3e-53
KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {...   197   6e-53
YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON} ...   196   2e-52
SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly...   195   4e-52
TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON...   198   1e-51
KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.2...   192   4e-51
YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}  ...   192   8e-50
NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20     188   1e-49
Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {O...   188   1e-49
TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa] ...   187   2e-49
NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {O...   186   1e-48
KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {O...   184   3e-48
Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON} (46...   186   6e-48
KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON...   186   7e-48
TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {...   183   8e-48
TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20 ...   182   1e-47
AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homo...   181   4e-47
CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa...   181   5e-47
NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1....   182   9e-47
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...   180   9e-47
ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} simila...   178   4e-46
SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} simil...   179   1e-45
Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON...   178   3e-45
KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON...   177   4e-45
Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON...   177   5e-45
NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1....   175   2e-44
ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} simil...   174   6e-44
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...   173   8e-44
TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_...   171   8e-43
KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} sim...   166   3e-41
AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic...   165   4e-41
Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON...   164   6e-41
TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {O...   164   7e-41
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...   160   1e-39
TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8....   156   3e-38
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...   155   8e-38
YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}  V...   154   2e-37
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...   151   9e-37
KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa]...   149   7e-36
NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {...   146   4e-35
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...   145   1e-34
TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_...   144   1e-34
NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10    144   2e-34
Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar ...   144   2e-34
Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {O...   143   3e-34
NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10    143   3e-34
NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] ...   143   4e-34
YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Pla...   142   7e-34
KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4....   141   1e-33
KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] ...   141   1e-33
Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR28...   141   2e-33
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...   141   2e-33
CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} simil...   141   2e-33
Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON...   140   2e-33
Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR28...   140   3e-33
ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] ...   140   3e-33
NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_...   140   3e-33
KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_...   140   3e-33
TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4....   140   4e-33
SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} sim...   139   5e-33
Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {O...   139   5e-33
Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON} Y...   139   8e-33
SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar...   139   8e-33
YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON} ...   139   9e-33
Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015...   138   2e-32
ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highl...   138   2e-32
CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {O...   137   2e-32
CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] ...   137   2e-32
Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar ...   137   4e-32
Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {O...   137   4e-32
Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {O...   136   5e-32
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...   135   1e-31
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...   134   2e-31
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....   134   2e-31
NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON...   134   2e-31
Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL01...   134   3e-31
KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} hig...   133   5e-31
AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic h...   133   5e-31
NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {O...   132   8e-31
KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa...   132   1e-30
TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {...   132   1e-30
TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON...   132   2e-30
TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4...   131   2e-30
KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] ...   131   2e-30
SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} sim...   131   2e-30
CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} high...   131   2e-30
YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}  ...   131   3e-30
Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON...   130   3e-30
Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015...   130   4e-30
KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} sim...   130   5e-30
Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..104...   129   1e-29
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...   129   1e-29
TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4....   128   2e-29
KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {O...   128   2e-29
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...   127   4e-29
KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {...   127   4e-29
TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_...   126   6e-29
Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON} Y...   126   8e-29
ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} sim...   126   8e-29
KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {O...   125   1e-28
Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015...   125   2e-28
Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W...   124   2e-28
TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {...   125   2e-28
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...   124   3e-28
KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {O...   124   3e-28
Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON...   124   4e-28
YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative tr...   116   7e-28
SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa...   122   1e-27
TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON...   122   2e-27
KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} sim...   121   2e-27
TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.5...   120   5e-27
YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC ...   120   7e-27
Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 a...   119   7e-27
KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] ...   119   9e-27
Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR10...   116   8e-26
AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic hom...   115   1e-25
TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa]...   115   2e-25
KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] ...   114   3e-25
TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_...   113   7e-25
Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (R...   113   7e-25
Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa]...   113   7e-25
TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON}           113   1e-24
ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON} ...   112   2e-24
Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 156...   110   8e-24
Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]...   109   1e-23
Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {...    85   5e-16
YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}  NFT1Puta...    83   2e-15
ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON} S...    74   1e-12
SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {...    73   2e-12
Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON} comp...    73   3e-12
Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147...    72   3e-12
YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subun...    72   5e-12
ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {...    71   6e-12
Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON...    71   7e-12
Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {O...    71   8e-12
CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} hig...    70   1e-11
KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {O...    70   1e-11
ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} sim...    70   2e-11
YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}  ...    70   2e-11
YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}...    70   2e-11
Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON...    69   3e-11
SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly...    69   3e-11
AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON} S...    69   3e-11
KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {O...    69   4e-11
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    69   4e-11
Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147...    69   4e-11
KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {O...    69   4e-11
Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON...    69   4e-11
Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON...    69   4e-11
KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {...    69   4e-11
ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} simil...    69   4e-11
TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON} Anc_...    69   5e-11
CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 ...    68   5e-11
KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.6...    68   6e-11
TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa] ...    67   8e-11
Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {...    68   9e-11
Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar t...    67   1e-10
Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar t...    67   1e-10
NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {O...    67   1e-10
Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {...    67   1e-10
Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]...    66   2e-10
KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa] ...    67   2e-10
NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661     66   2e-10
KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]...    66   2e-10
TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa] ...    66   3e-10
TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]...    66   3e-10
KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} simi...    66   3e-10
NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON}                 65   3e-10
AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic ho...    65   4e-10
ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly s...    65   4e-10
TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {O...    65   4e-10
Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009...    65   5e-10
YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Posit...    65   5e-10
TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {...    65   5e-10
TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa] ...    65   5e-10
Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W ...    65   6e-10
ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} high...    65   6e-10
CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] ...    65   6e-10
KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {...    64   8e-10
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    65   9e-10
TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON}              64   1e-09
NDAI0B02870 Chr2 complement(726822..730625) [3804 bp, 1267 aa] {...    64   1e-09
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    64   1e-09
TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5....    64   1e-09
AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON} ...    64   1e-09
KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON}            64   1e-09
NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {O...    64   1e-09
Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}...    64   1e-09
Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {O...    64   1e-09
ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} simil...    64   2e-09
NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON} Anc_...    64   2e-09
KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {...    64   2e-09
SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa] ...    63   2e-09
SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} simila...    63   2e-09
KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly...    63   2e-09
KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {...    63   3e-09
ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] ...    63   3e-09
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    63   3e-09
KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.42...    62   4e-09
ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {...    62   4e-09
Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {O...    62   4e-09
Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}...    62   4e-09
Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to...    62   5e-09
KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} simil...    62   5e-09
KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {...    62   5e-09
TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {O...    62   5e-09
KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {...    62   6e-09
NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3....    62   6e-09
NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {O...    62   6e-09
KAFR0E03480 Chr5 complement(701160..705818) [4659 bp, 1552 aa] {...    62   6e-09
Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 b...    62   6e-09
KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3....    62   6e-09
Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    62   7e-09
Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    62   7e-09
Kpol_1012.10 s1012 complement(20013..20741,21318..21326,21750..2...    61   7e-09
Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}...    61   8e-09
Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}...    62   8e-09
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    62   8e-09
KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1....    61   9e-09
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    61   1e-08
YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}  PDR18Put...    61   1e-08
NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_...    61   1e-08
ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} simil...    61   1e-08
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    61   1e-08
TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.3...    60   1e-08
KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly...    60   1e-08
Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar...    60   1e-08
Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON...    55   2e-08
SAKL0C08074g Chr3 complement(747926..751699) [3774 bp, 1257 aa] ...    60   2e-08
Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR40...    60   2e-08
ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} sim...    60   2e-08
KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] ...    60   2e-08
YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Pl...    60   2e-08
Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR07...    60   2e-08
KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa] ...    60   2e-08
ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa...    60   2e-08
Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR15...    60   2e-08
NCAS0E01630 Chr5 complement(308563..313260) [4698 bp, 1565 aa] {...    60   2e-08
YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plas...    60   2e-08
KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {...    60   3e-08
CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} high...    60   3e-08
TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON}            60   3e-08
Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W...    60   3e-08
Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {...    59   3e-08
KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534...    59   3e-08
KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON}              59   4e-08
Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR40...    59   4e-08
SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa...    59   4e-08
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                59   4e-08
KNAG0L00680 Chr12 complement(105318..109460) [4143 bp, 1380 aa] ...    59   4e-08
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    59   4e-08
KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa...    59   5e-08
NCAS0F00790 Chr6 complement(158502..162704) [4203 bp, 1400 aa] {...    59   5e-08
CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}             59   5e-08
NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366       59   5e-08
Smik_3.97 Chr3 complement(133624..136773) [3150 bp, 1049 aa] {ON...    59   5e-08
TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.3...    59   6e-08
KLLA0D03476g Chr4 (296287..300969) [4683 bp, 1560 aa] {ON} simil...    59   6e-08
Suva_8.379 Chr8 (672487..677184) [4698 bp, 1565 aa] {ON} YPL058C...    59   6e-08
CAGL0M02387g Chr13 (280372..282942) [2571 bp, 856 aa] {ON} simil...    59   6e-08
AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic h...    58   7e-08
TDEL0D04040 Chr4 complement(738550..743052) [4503 bp, 1500 aa] {...    59   7e-08
Smik_9.181 Chr9 complement(302896..307125) [4230 bp, 1409 aa] {O...    58   7e-08
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    58   9e-08
Smik_15.508 Chr15 (881347..886047) [4701 bp, 1566 aa] {ON} YOR32...    58   9e-08
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    58   1e-07
TBLA0F01040 Chr6 (252002..255817) [3816 bp, 1271 aa] {ON} Anc_3....    58   1e-07
YCR011C Chr3 complement(133724..136873) [3150 bp, 1049 aa] {ON} ...    57   1e-07
Suva_3.37 Chr3 complement(47453..50614) [3162 bp, 1053 aa] {ON} ...    57   1e-07
Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR0...    57   1e-07
Smik_15.185 Chr15 (316883..321064) [4182 bp, 1393 aa] {ON} YNR07...    57   2e-07
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    57   2e-07
CAGL0F01419g Chr6 complement(142623..146819) [4197 bp, 1398 aa] ...    57   2e-07
TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {...    57   2e-07
TBLA0G02820 Chr7 (745762..750297) [4536 bp, 1511 aa] {ON} Anc_3....    57   2e-07
NCAS0E01650 Chr5 complement(319448..323914) [4467 bp, 1488 aa] {...    57   2e-07
YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasm...    57   2e-07
Skud_15.78 Chr15 complement(148836..152720) [3885 bp, 1294 aa] {...    57   2e-07
Skud_15.317 Chr15 (568579..573117) [4539 bp, 1512 aa] {ON} YOR15...    57   2e-07
NCAS0E01640 Chr5 complement(313479..317987) [4509 bp, 1502 aa] {...    57   2e-07
Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR07...    56   3e-07
KNAG0A02100 Chr1 complement(177773..182290) [4518 bp, 1505 aa] {...    56   3e-07
Suva_8.204 Chr8 (368920..373455) [4536 bp, 1511 aa] {ON} YOR153W...    56   3e-07
ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON} ...    56   4e-07
Smik_4.244 Chr4 (445916..450421) [4506 bp, 1501 aa] {ON} YDR011W...    56   4e-07
Kpol_1035.32 s1035 (76084..76926) [843 bp, 280 aa] {ON} (76084.....    54   4e-07
SAKL0C11704g Chr3 (1050447..1054979) [4533 bp, 1510 aa] {ON} sim...    56   4e-07
KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} sim...    56   4e-07
NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON} Anc_...    56   5e-07
NDAI0G01850 Chr7 complement(409416..413918) [4503 bp, 1500 aa] {...    56   5e-07
KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa...    55   6e-07
KNAG0G01040 Chr7 (221426..225631) [4206 bp, 1401 aa] {ON}  YIL013C     55   7e-07
Ecym_2737 Chr2 (1425670..1428726) [3057 bp, 1018 aa] {ON} simila...    55   9e-07
SAKL0C06996g Chr3 complement(649424..654061) [4638 bp, 1545 aa] ...    55   9e-07
KAFR0C00830 Chr3 (163830..168284) [4455 bp, 1484 aa] {ON} Anc_3....    55   9e-07
ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-synten...    55   1e-06
KAFR0G03410 Chr7 (702624..705056) [2433 bp, 810 aa] {ON} Anc_4.2...    54   1e-06
SAKL0G08008g Chr7 complement(673391..678040) [4650 bp, 1549 aa] ...    54   1e-06
KNAG0K01350 Chr11 complement(265564..270069) [4506 bp, 1501 aa] ...    54   1e-06
YIL013C Chr9 complement(328207..332442) [4236 bp, 1411 aa] {ON} ...    54   2e-06
Smik_17.26 Chr17 complement(23946..28454) [4509 bp, 1502 aa] {ON...    54   2e-06
Kpol_1050.16 s1050 complement(38346..41489) [3144 bp, 1047 aa] {...    54   2e-06
Suva_9.192 Chr9 complement(316679..320920) [4242 bp, 1413 aa] {O...    54   2e-06
TPHA0A04220 Chr1 complement(948357..952811) [4455 bp, 1484 aa] {...    54   2e-06
NCAS0I00670 Chr9 (111140..115240) [4101 bp, 1366 aa] {ON}              54   2e-06
TPHA0M00640 Chr13 complement(117604..122076) [4473 bp, 1490 aa] ...    54   2e-06
Kpol_1036.28 s1036 (70446..70928,73046..77023) [4461 bp, 1486 aa...    53   3e-06
TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8....    53   3e-06
NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {...    53   3e-06
KLTH0E15796g Chr5 (1400194..1403937) [3744 bp, 1247 aa] {ON} sim...    53   3e-06
Skud_15.174 Chr15 (310212..314393) [4182 bp, 1393 aa] {ON} YALI0...    53   3e-06
Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON} (114...    53   4e-06
CAGL0L07744g Chr12 (851958..855125) [3168 bp, 1055 aa] {ON} simi...    52   5e-06
KAFR0C02740 Chr3 complement(537867..539465) [1599 bp, 532 aa] {O...    52   5e-06
Ecym_3605 Chr3 (1148339..1152817) [4479 bp, 1492 aa] {ON} simila...    52   6e-06
TBLA0I01760 Chr9 (392252..397147) [4896 bp, 1631 aa] {ON} Anc_3....    52   6e-06
TPHA0L01500 Chr12 (311715..316274) [4560 bp, 1519 aa] {ON} Anc_8...    52   7e-06
SAKL0B01518g Chr2 complement(148745..149542) [798 bp, 265 aa] {O...    50   9e-06
Skud_3.76 Chr3 complement(116029..119199) [3171 bp, 1056 aa] {ON...    51   9e-06
CAGL0I08019g Chr9 complement(783133..786990) [3858 bp, 1285 aa] ...    51   1e-05
KLLA0C04477g Chr3 complement(409543..413304) [3762 bp, 1253 aa] ...    51   1e-05
CAGL0M07293g Chr13 complement(733072..737619) [4548 bp, 1515 aa]...    51   1e-05
KAFR0K01230 Chr11 (254346..258488) [4143 bp, 1380 aa] {ON}  YIL013C    51   1e-05
ZYRO0F08866g Chr6 (709888..714450) [4563 bp, 1520 aa] {ON} highl...    51   2e-05
Suva_15.188 Chr15 (324904..329088) [4185 bp, 1394 aa] {ON} YOR01...    50   2e-05
TBLA0A01150 Chr1 (262829..266992) [4164 bp, 1387 aa] {ON}              50   2e-05
Kpol_513.9 s513 (23141..27682) [4542 bp, 1513 aa] {ON} (23141..2...    50   2e-05
Suva_2.220 Chr2 (374470..376092) [1623 bp, 540 aa] {ON} YDR061W ...    50   2e-05
YOR011W Chr15 (349679..353863) [4185 bp, 1394 aa] {ON}  AUS1Plas...    50   2e-05
NCAS0C03820 Chr3 complement(774039..774923) [885 bp, 294 aa] {ON...    49   2e-05
TDEL0B01210 Chr2 complement(219068..223606) [4539 bp, 1512 aa] {...    50   3e-05
YFL028C Chr6 complement(79344..80213) [870 bp, 289 aa] {ON}  CAF...    49   3e-05
ZYRO0F08888g Chr6 (716318..720880) [4563 bp, 1520 aa] {ON} highl...    50   3e-05
NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {...    50   3e-05
Ecym_1500 Chr1 (1027467..1028318) [852 bp, 283 aa] {ON} similar ...    49   3e-05
TDEL0C00680 Chr3 complement(110674..111519) [846 bp, 281 aa] {ON...    48   4e-05
KAFR0C03470 Chr3 (707203..708039) [837 bp, 278 aa] {ON} Anc_8.42...    48   4e-05
NDAI0G03160 Chr7 complement(744284..745141) [858 bp, 285 aa] {ON...    48   5e-05
NCAS0C02250 Chr3 complement(418244..422770) [4527 bp, 1508 aa] {...    49   5e-05
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    49   6e-05
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    49   6e-05
KNAG0D02010 Chr4 complement(335815..337413) [1599 bp, 532 aa] {O...    49   6e-05
Skud_4.316 Chr4 (550218..551840) [1623 bp, 540 aa] {ON} YDR061W ...    49   6e-05
KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8....    49   7e-05
KLLA0B09702g Chr2 complement(842245..846801) [4557 bp, 1518 aa] ...    49   8e-05
KLTH0H07942g Chr8 complement(696683..698269) [1587 bp, 528 aa] {...    48   9e-05
CAGL0G05093g Chr7 complement(483230..484864) [1635 bp, 544 aa] {...    48   1e-04
TBLA0D02530 Chr4 complement(629614..630444) [831 bp, 276 aa] {ON...    47   1e-04
Kwal_27.12711 s27 (1342807..1346547) [3741 bp, 1246 aa] {ON} YOL...    48   1e-04
Suva_7.3 Chr7 complement(6379..10671) [4293 bp, 1430 aa] {ON} YN...    48   1e-04
NCAS0B04350 Chr2 complement(786960..788561) [1602 bp, 533 aa] {O...    47   1e-04
SAKL0C05654g Chr3 complement(532258..536787) [4530 bp, 1509 aa] ...    47   2e-04
TPHA0B01940 Chr2 (434881..437436) [2556 bp, 851 aa] {ON} Anc_4.2...    47   2e-04
SAKL0H10670g Chr8 complement(918091..922620) [4530 bp, 1509 aa] ...    47   2e-04
Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa] ...    47   2e-04
SAKL0H19294g Chr8 complement(1703651..1705213) [1563 bp, 520 aa]...    47   2e-04
YDR061W Chr4 (574164..575783) [1620 bp, 539 aa] {ON} Protein wit...    47   2e-04
Skud_6.42 Chr6 complement(82602..83471) [870 bp, 289 aa] {ON} YF...    46   2e-04
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    47   2e-04
Kwal_33.15623 s33 (1193685..1195373) [1689 bp, 562 aa] {ON} YFR0...    47   2e-04
NDAI0A03750 Chr1 complement(849511..851118) [1608 bp, 535 aa] {O...    47   2e-04
Suva_6.30 Chr6 complement(52879..53748) [870 bp, 289 aa] {ON} YF...    46   2e-04
Smik_6.50 Chr6 complement(94583..95452) [870 bp, 289 aa] {ON} YF...    46   2e-04
KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} hig...    47   2e-04
CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON...    47   3e-04
NCAS0A08760 Chr1 complement(1729600..1732737) [3138 bp, 1045 aa]...    47   3e-04
Kwal_0.167 s0 (88989..92123) [3135 bp, 1044 aa] {ON} YNL014W (HE...    47   3e-04
Suva_10.346 Chr10 (604006..607140) [3135 bp, 1044 aa] {ON} YLR24...    47   3e-04
TDEL0B04340 Chr2 complement(764357..766018) [1662 bp, 553 aa] {O...    46   3e-04
YLR249W Chr12 (636780..639914) [3135 bp, 1044 aa] {ON}  YEF3Gamm...    46   4e-04
KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1....    46   4e-04
NDAI0G05180 Chr7 complement(1254531..1257665) [3135 bp, 1044 aa]...    46   4e-04
KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {...    46   5e-04
Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR24...    46   5e-04
KNAG0I01340 Chr9 complement(258887..262024) [3138 bp, 1045 aa] {...    46   5e-04
Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON...    46   5e-04
TBLA0A08720 Chr1 complement(2139184..2140668) [1485 bp, 494 aa] ...    45   5e-04
Skud_14.314 Chr14 (573040..576174) [3135 bp, 1044 aa] {ON} YNL01...    46   5e-04
KNAG0F01740 Chr6 (326444..329950) [3507 bp, 1168 aa] {ON} Anc_6....    46   5e-04
TPHA0O00680 Chr15 (128579..131713) [3135 bp, 1044 aa] {ON} Anc_1...    45   6e-04
Ecym_3232 Chr3 complement(431386..433830) [2445 bp, 814 aa] {ON}...    45   7e-04
Skud_12.330 Chr12 (583354..586488) [3135 bp, 1044 aa] {ON} YLR24...    45   8e-04
KLLA0B02563g Chr2 complement(222951..225377) [2427 bp, 808 aa] {...    45   8e-04
Kwal_YGOB_56.24219 s56 complement(908618..909109,909112..912147)...    45   9e-04
AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic h...    45   9e-04
Suva_14.333 Chr14 (585838..588972) [3135 bp, 1044 aa] {ON} YNL01...    45   0.001
Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON...    45   0.001
AER091W Chr5 (809767..812172) [2406 bp, 801 aa] {ON} Syntenic ho...    45   0.001
KLTH0D15246g Chr4 (1257193..1259589) [2397 bp, 798 aa] {ON} simi...    44   0.001
Suva_11.36 Chr11 complement(70977..73538) [2562 bp, 853 aa] {ON}...    44   0.001
Kwal_14.1242 s14 (250275..251084) [810 bp, 269 aa] {ON} YFL028C ...    44   0.001
Smik_6.431 Chr6 complement(699005..702574) [3570 bp, 1189 aa] {O...    44   0.001
TPHA0H00120 Chr8 complement(11464..13092) [1629 bp, 542 aa] {ON}...    44   0.001
KLTH0H03300g Chr8 (295271..298801) [3531 bp, 1176 aa] {ON} simil...    44   0.001
CAGL0K12474g Chr11 (1218012..1218896) [885 bp, 294 aa] {ON} simi...    44   0.001
YNL014W Chr14 (606319..609453) [3135 bp, 1044 aa] {ON}  HEF3Tran...    44   0.001
YPL226W Chr16 (121767..125357) [3591 bp, 1196 aa] {ON}  NEW1ATP ...    44   0.001
Skud_16.52 Chr16 (95317..98853) [3537 bp, 1178 aa] {ON} YPL226W ...    44   0.001
KLLA0F08833g Chr6 (822039..822860) [822 bp, 273 aa] {ON} similar...    43   0.001
Kwal_56.23429 s56 complement(532382..533998) [1617 bp, 539 aa] {...    44   0.001
Kwal_YGOB_56.23429 s56 complement(532059..532313,532316..533998)...    44   0.001
TBLA0G02050 Chr7 complement(537114..540098) [2985 bp, 994 aa] {O...    44   0.002
TPHA0H01820 Chr8 complement(415382..418765) [3384 bp, 1127 aa] {...    44   0.002
TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]...    44   0.002
TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON} Anc_...    44   0.002
SAKL0A03586g Chr1 (328346..331885) [3540 bp, 1179 aa] {ON} simil...    44   0.002
AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic h...    44   0.002
KAFR0A07090 Chr1 complement(1427525..1431157) [3633 bp, 1210 aa]...    44   0.002
TDEL0E00840 Chr5 complement(172712..175192) [2481 bp, 826 aa] {O...    44   0.002
ZYRO0E07634g Chr5 complement(593495..597025) [3531 bp, 1176 aa] ...    44   0.002
Kwal_56.24221 s56 complement(908983..912147) [3165 bp, 1054 aa] ...    44   0.002
Skud_11.38 Chr11 complement(72504..75071) [2568 bp, 855 aa] {ON}...    44   0.002
Kpol_1002.29 s1002 (89520..93068) [3549 bp, 1182 aa] {ON} (89520...    44   0.002
NCAS0D03950 Chr4 (737216..740788) [3573 bp, 1190 aa] {ON} Anc_6....    44   0.002
Kwal_23.4045 s23 complement(543590..545875) [2286 bp, 761 aa] {O...    43   0.003
Suva_16.80 Chr16 (131166..134702) [3537 bp, 1178 aa] {ON} YPL226...    44   0.003
CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa] ...    44   0.003
TPHA0D00450 Chr4 complement(76541..77377) [837 bp, 278 aa] {ON} ...    42   0.003
TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]...    43   0.003
TDEL0F01870 Chr6 (348408..351950) [3543 bp, 1180 aa] {ON} Anc_6....    43   0.003
CAGL0D03674g Chr4 (370066..373626) [3561 bp, 1186 aa] {ON} highl...    43   0.003
YDR091C Chr4 complement(626708..628534) [1827 bp, 608 aa] {ON}  ...    43   0.003
NDAI0I00960 Chr9 complement(226758..230396) [3639 bp, 1212 aa] {...    43   0.003
KLLA0C16115g Chr3 (1405766..1409317) [3552 bp, 1183 aa] {ON} sim...    43   0.004
ZYRO0E05148g Chr5 complement(387268..390405) [3138 bp, 1045 aa] ...    43   0.005
KLLA0C17556g Chr3 complement(1544404..1546227) [1824 bp, 607 aa]...    42   0.005
Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar ...    42   0.005
NCAS0A02680 Chr1 (510902..513559) [2658 bp, 885 aa] {ON} Anc_4.287     42   0.005
Smik_4.299 Chr4 (540966..542588) [1623 bp, 540 aa] {ON} YDR061W ...    42   0.006
NCAS0A06310 Chr1 complement(1243683..1246823) [3141 bp, 1046 aa]...    42   0.006
Smik_14.315 Chr14 (564639..567773) [3135 bp, 1044 aa] {ON} YNL01...    42   0.006
Smik_4.334 Chr4 complement(592554..594380) [1827 bp, 608 aa] {ON...    42   0.007
SAKL0D08316g Chr4 (695101..698235) [3135 bp, 1044 aa] {ON} highl...    42   0.008
NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1....    42   0.008
Kpol_1002.105 s1002 complement(266533..268176) [1644 bp, 547 aa]...    42   0.009
Skud_4.351 Chr4 complement(602770..604596) [1827 bp, 608 aa] {ON...    42   0.009
KNAG0E03270 Chr5 complement(655376..656218) [843 bp, 280 aa] {ON...    41   0.010
ZYRO0B13266g Chr2 (1074171..1076639) [2469 bp, 822 aa] {ON} simi...    42   0.010
Kpol_1048.72 s1048 complement(202581..205715) [3135 bp, 1044 aa]...    42   0.011
AGR125W Chr7 (987077..988900) [1824 bp, 607 aa] {ON} Syntenic ho...    41   0.011
KLLA0F12210g Chr6 (1125630..1128764) [3135 bp, 1044 aa] {ON} hig...    41   0.011
ZYRO0G09130g Chr7 (732487..734034) [1548 bp, 515 aa] {ON} simila...    41   0.013
KNAG0D04550 Chr4 (824870..827338) [2469 bp, 822 aa] {ON} Anc_4.2...    41   0.013
NDAI0D04610 Chr4 (1084921..1087599) [2679 bp, 892 aa] {ON} Anc_4...    41   0.013
SAKL0G16280g Chr7 (1408229..1410607) [2379 bp, 792 aa] {ON} simi...    41   0.014
ZYRO0F03234g Chr6 complement(273742..274569) [828 bp, 275 aa] {O...    40   0.014
CAGL0G08041g Chr7 complement(758811..760634) [1824 bp, 607 aa] {...    40   0.022
Kpol_1055.54 s1055 complement(131851..134565) [2715 bp, 904 aa] ...    39   0.043
TDEL0A01370 Chr1 (248469..250292) [1824 bp, 607 aa] {ON} Anc_8.2...    39   0.047
Smik_11.42 Chr11 complement(71610..74165) [2556 bp, 851 aa] {ON}...    39   0.055
KLTH0G14520g Chr7 (1276585..1278411) [1827 bp, 608 aa] {ON} high...    39   0.062
Kwal_14.2052 s14 complement(589149..590720) [1572 bp, 523 aa] {O...    39   0.064
ZYRO0B11616g Chr2 complement(910480..912303) [1824 bp, 607 aa] {...    39   0.072
YKL188C Chr11 complement(86225..88786) [2562 bp, 853 aa] {ON}  P...    39   0.078
Suva_2.252 Chr2 complement(426492..428318) [1827 bp, 608 aa] {ON...    38   0.085
KLTH0G18326g Chr7 complement(1579374..1580183) [810 bp, 269 aa] ...    37   0.11 
TPHA0A01980 Chr1 (400671..402494) [1824 bp, 607 aa] {ON} Anc_8.2...    37   0.17 
Ecym_5557 Chr5 (1126965..1128539) [1575 bp, 524 aa] {ON} similar...    37   0.18 
KNAG0H02970 Chr8 complement(548970..550802) [1833 bp, 610 aa] {O...    37   0.24 
Kpol_1032.48 s1032 complement(108249..110072) [1824 bp, 607 aa] ...    37   0.27 
KAFR0A02430 Chr1 (508632..510455) [1824 bp, 607 aa] {ON} Anc_8.2...    36   0.34 
SAKL0H17996g Chr8 (1607260..1609323) [2064 bp, 687 aa] {ON} high...    36   0.39 
Kwal_27.12817 s27 (1386470..1389226) [2757 bp, 919 aa] {ON} YDR4...    36   0.40 
TBLA0F03760 Chr6 complement(924333..926159) [1827 bp, 608 aa] {O...    36   0.41 
Ecym_1222 Chr1 complement(458018..462082) [4065 bp, 1354 aa] {ON...    36   0.50 
KLLA0D02156g Chr4 complement(184520..186085) [1566 bp, 521 aa] {...    35   0.68 
Ecym_5560 Chr5 complement(1134384..1136207) [1824 bp, 607 aa] {O...    35   0.74 
Suva_13.378 Chr13 (635459..638755) [3297 bp, 1098 aa] {ON} YMR19...    35   0.76 
NCAS0B04030 Chr2 (730062..731888) [1827 bp, 608 aa] {ON} Anc_8.2...    35   0.84 
YER172C Chr5 complement(529530..536021) [6492 bp, 2163 aa] {ON} ...    35   1.2  
Skud_6.83 Chr6 (155917..156978) [1062 bp, 353 aa] {ON} YFR007W (...    34   1.3  
Smik_5.344 Chr5 complement(529147..535632) [6486 bp, 2161 aa] {O...    34   1.9  
Kpol_364.12 s364 (26116..27537) [1422 bp, 473 aa] {ON} (26116..2...    33   3.6  
NCAS0C04460 Chr3 complement(914189..915700) [1512 bp, 503 aa] {O...    33   4.0  
TDEL0A01260 Chr1 (211170..217724) [6555 bp, 2184 aa] {ON} Anc_8....    33   5.0  
NDAI0A03440 Chr1 (789010..790836) [1827 bp, 608 aa] {ON} Anc_8.2...    32   6.2  

>NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {ON}
           Anc_6.5
          Length = 832

 Score = 1470 bits (3805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 732/832 (87%), Positives = 732/832 (87%)

Query: 1   MIKNIFPLSIPQTISPFSKPNLAVRTYSILTSNQFNNAKWMYNDLLISKGDHISCRQGSR 60
           MIKNIFPLSIPQTISPFSKPNLAVRTYSILTSNQFNNAKWMYNDLLISKGDHISCRQGSR
Sbjct: 1   MIKNIFPLSIPQTISPFSKPNLAVRTYSILTSNQFNNAKWMYNDLLISKGDHISCRQGSR 60

Query: 61  YDRDISKTNLSRNLSISTQKSQYHTNHXXXXXXXXXXXTAKQDSILLLKTKPFNCNKVAL 120
           YDRDISKTNLSRNLSISTQKSQYHTNH           TAKQDSILLLKTKPFNCNKVAL
Sbjct: 61  YDRDISKTNLSRNLSISTQKSQYHTNHSILSRLSILSLTAKQDSILLLKTKPFNCNKVAL 120

Query: 121 RFNSXXXXXXXXXXXXXXXXXXXXXXXPNEIEPDQGESNFKDVFRLFLLVKKDYKXXXXX 180
           RFNS                       PNEIEPDQGESNFKDVFRLFLLVKKDYK     
Sbjct: 121 RFNSTTNTTDTIPPHTESTESTKASTEPNEIEPDQGESNFKDVFRLFLLVKKDYKLLIVS 180

Query: 181 XXXXXXXXXXGMMIPKIIGLILDALKSVAXXXXXXXXXXXXIMFGLTLYEFLGGFSVALF 240
                     GMMIPKIIGLILDALKSVA            IMFGLTLYEFLGGFSVALF
Sbjct: 181 LTLLTISCTIGMMIPKIIGLILDALKSVATTPDGGSSPPPTIMFGLTLYEFLGGFSVALF 240

Query: 241 IGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVS 300
           IGCAANYG        SERLVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVS
Sbjct: 241 IGCAANYGRLILLRILSERLVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVS 300

Query: 301 RSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSREL 360
           RSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSREL
Sbjct: 301 RSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSREL 360

Query: 361 QDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTS 420
           QDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTS
Sbjct: 361 QDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTS 420

Query: 421 LVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAAS 480
           LVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAAS
Sbjct: 421 LVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAAS 480

Query: 481 RLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCI 540
           RLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCI
Sbjct: 481 RLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCI 540

Query: 541 VGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIR 600
           VGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIR
Sbjct: 541 VGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIR 600

Query: 601 DNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARA 660
           DNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARA
Sbjct: 601 DNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARA 660

Query: 661 LIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLG 720
           LIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLG
Sbjct: 661 LIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLG 720

Query: 721 NDGSVVEMGKFKELFADPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANGSSIHHEG 780
           NDGSVVEMGKFKELFADPT                               ANGSSIHHEG
Sbjct: 721 NDGSVVEMGKFKELFADPTSELSKLLNEKSSRKKVVTKTVPPVSSTSVSSANGSSIHHEG 780

Query: 781 TILEEDHAQEDHESEAPPTIITTQQLEDSIESVLNDVSAESKPIKLSPKDPL 832
           TILEEDHAQEDHESEAPPTIITTQQLEDSIESVLNDVSAESKPIKLSPKDPL
Sbjct: 781 TILEEDHAQEDHESEAPPTIITTQQLEDSIESVLNDVSAESKPIKLSPKDPL 832

>NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5
          Length = 773

 Score =  996 bits (2574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/680 (73%), Positives = 550/680 (80%), Gaps = 25/680 (3%)

Query: 154 DQGESNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALK-SVAXXX 212
           ++ +SNF DV RLFLLVK D+K               GMMIPK+IG+ILD+LK   A   
Sbjct: 118 EEPKSNFSDVIRLFLLVKTDWKLLLVALTLLTISCVIGMMIPKVIGIILDSLKVQTATQS 177

Query: 213 XXXXXXXXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHT 272
                    +MFGLT+YEFLGGFS+AL  GC AN+G        SERLVARLRS V+K T
Sbjct: 178 EGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGRLILLRILSERLVARLRSTVIKRT 237

Query: 273 LHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLS 332
           +HQD++F+D+HK GDLISRLGAD+YIVSRSITQKISDG KSLICGGVG+GMM  LS+DLS
Sbjct: 238 IHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLS 297

Query: 333 SVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIK 392
           +VL   +IPVV+SASIFGKQIRINSRELQDATGQLTRVSEEQLNGV+TVQSFVAEQREIK
Sbjct: 298 AVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIK 357

Query: 393 RFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFM 452
           RFN +IR IF VGKR+AFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFM
Sbjct: 358 RFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFM 417

Query: 453 LYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKNV 512
           LYTEYTGN+IFGLSTFYSEIMQGAGAASRLFELTD VP IRPTLGKTY PGKGEIEFKNV
Sbjct: 418 LYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNV 477

Query: 513 SFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQD 572
           SF+YPTRP NQIFK+LNFKI+PGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQD
Sbjct: 478 SFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQD 537

Query: 573 ITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKF 632
           ITK+NSKSLRR++ +VQQEPVLMSG+IRDNITYGLT  PTKEEIR VAKQCFCHNFI KF
Sbjct: 538 ITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKF 597

Query: 633 PYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQL 692
           P+TYDT IGP GTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQL
Sbjct: 598 PHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQL 657

Query: 693 MKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPTXXXXXXXXXXXXX 752
           MK+KSMTIVSIAHRLSTIRRSEN+IVLGNDGSV+EMGKFKELF+DP+             
Sbjct: 658 MKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPSSELSKLLN----- 712

Query: 753 XXXXXXXXXXXXXXXXXXANGSSIHHEGTILEEDHAQEDHESEAPPTIITTQQLEDSIES 812
                                SS     +       + D ++   P       +ED++ S
Sbjct: 713 -------------------EKSSRKKTKSDPISSAPEVDADATGEPVEPIDPAIEDALHS 753

Query: 813 VLNDVSAESKPIKLSPKDPL 832
           VLNDV++ESKPIK+S  D L
Sbjct: 754 VLNDVTSESKPIKMSTTDTL 773

>CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 801

 Score =  890 bits (2299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/701 (64%), Positives = 523/701 (74%), Gaps = 28/701 (3%)

Query: 152 EPDQGESNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXX 211
           E  +  S F+D+ RL LLV++D+K               GM IPK+IGLILD LK+    
Sbjct: 109 ETKENHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAA 168

Query: 212 XXXXXXXXXX-----IMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRS 266
                          I+FGL+ YEFLGGF++AL +G AANYG        SERLVARLR+
Sbjct: 169 NSVDGQPVSIDKLPPIVFGLSFYEFLGGFALALLVGIAANYGRIILLRVLSERLVARLRA 228

Query: 267 VVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLE 326
            V+K T+HQD+EFFD HKVGDLISRLG+D+Y+VSRS+TQK+SDG K+LICG VGIGMML 
Sbjct: 229 TVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMLA 288

Query: 327 LSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVA 386
           LS  LS +L+ F  PV+LSAS+FGKQI   SRELQ+ATG LT+V+EEQL+G++TVQSFVA
Sbjct: 289 LSPQLSCLLLVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVA 348

Query: 387 EQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIG 446
           EQREI R+N +IR+IF++GK+AA INAKFF+STS +GDLSFLTVL +GSYLVL  SLTIG
Sbjct: 349 EQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIG 408

Query: 447 DLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGE 506
           DLTAFM+YTEYTGN+IFGLSTFYSEIMQGAGAASRLFELTDRVP+I  T G  Y PG GE
Sbjct: 409 DLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGE 468

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           IEFKNVSFAYPTRPSN IFK+LNFKI+ GSNVCIVGPSG+GKST+ALLL  YY P+SG+I
Sbjct: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528

Query: 567 LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCH 626
           LIDGQ+I  LNSKSLRR I +VQQEP+LMSGTIRDNI YGLTE PTK+EIR VAKQCFCH
Sbjct: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCH 588

Query: 627 NFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAIN 686
           NFI +F  +YDT IGPHGTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAIN
Sbjct: 589 NFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAIN 648

Query: 687 YTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPTXXXXXXX 746
           YTFGQLMK K MTIVSIAHRLSTIRRSEN+IVLG+DGSVVEMGKFKEL+ DPT       
Sbjct: 649 YTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLL 708

Query: 747 XXXXXXXXXXXXXXX--XXXXXXXXXANGSSIHHEGTILEEDHAQEDHESEAPPTIITT- 803
                                               T++E+          +PP  I+T 
Sbjct: 709 NEKSTPHQTTNITVTPPPTTMAEKVVEEVVENAEPETVIEDPG--------SPPMYISTV 760

Query: 804 ------------QQLEDSIESVLNDVSAESKPIKLSPKDPL 832
                       +Q+ED+IE+V+ DV++E KP+KL   + L
Sbjct: 761 SEVSAEGHELINEQIEDTIENVMKDVTSERKPLKLQKDENL 801

>Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W
           (REAL)
          Length = 767

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/673 (65%), Positives = 518/673 (76%), Gaps = 8/673 (1%)

Query: 159 NFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXXXXXXXXX 218
           ++KD+ RLF+L K+D+K               GM IPK+IG++LD LK+ +         
Sbjct: 98  DYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKI 157

Query: 219 XXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSE 278
               +F L LYEFL  F+VAL IGC AN+G        SER+VARLR+ V+K TLHQD+E
Sbjct: 158 P---IFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAE 214

Query: 279 FFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCF 338
           FFD HKVGDLISRLG+D+Y+VSRS+TQK+SDGVK+LICG VG+GMM  LS  LS +L+ F
Sbjct: 215 FFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSVLLLFF 274

Query: 339 VIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSI 398
             PV+ SAS+FGKQIR  S++LQ+ATGQLTRV+EEQL+G++TVQSFVAE  E+ R+N +I
Sbjct: 275 TPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAI 334

Query: 399 REIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYT 458
           R+IF VGK AAF NAKFFT+TSL+GDLSFLTVL YGSYLVL   L+IGDLTAFMLYTEYT
Sbjct: 335 RDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYT 394

Query: 459 GNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPT 518
           GNA+FGLSTFYSEIMQGAGAASRLFELTDR P+I PT+G  Y P +G IEFK+VSF+YPT
Sbjct: 395 GNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPT 454

Query: 519 RPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNS 578
           RPS QIFKSLNFKI PGS+VCIVGPSG+GKSTIALLLL YYNPT+G I+ID QDITK+N 
Sbjct: 455 RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNC 514

Query: 579 KSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDT 638
           KSLRR I +VQQEPVLMSGTIRDNITYGLT  PTKEEIR+VAKQCFCHNFI KFP TYDT
Sbjct: 515 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 574

Query: 639 YIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSM 698
            IGP+GTLLSGGQKQRIAIARALIKKP +LILDEATSALDVESEGAINYTFGQLMKSKSM
Sbjct: 575 VIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSM 634

Query: 699 TIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPTXXXXXXXXXXXXXXXXXXX 758
           TIVSIAHRLSTIRRSEN+IVLG+DGSVVEMGKFKEL+++PT                   
Sbjct: 635 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNERTAPVPSEQQ 694

Query: 759 XXXXXXXXXXXXANGSSIHHEGTILEEDHAQEDHESEAPPTIITTQQ---LEDSIESVLN 815
                             +H+     +D +  D++S   P     ++   +E+S+E VL 
Sbjct: 695 QQVEKDNEKEEPNEDE--NHDQRNEGDDGSNHDNDSNNKPLESKDKKSDDIEESVEHVLK 752

Query: 816 DVSAESKPIKLSP 828
           D + E+ PIKLSP
Sbjct: 753 DAAKEANPIKLSP 765

>Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON}
           YPL270W (REAL)
          Length = 773

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/686 (64%), Positives = 517/686 (75%), Gaps = 29/686 (4%)

Query: 159 NFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXXXXXXXXX 218
           ++KD+ RLF+L K+D+K               GM IPK+IG++LD LK+ +         
Sbjct: 101 DYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKI 160

Query: 219 XXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSE 278
               +F L LYEFL  F+VAL IGCAAN+G        SER+VARLR+ V+K TLHQD+E
Sbjct: 161 P---IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAE 217

Query: 279 FFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCF 338
           FFD HKVGDLISRLG+D+Y+VSRS+TQK+SDGVK+LICG VG+GMM  LS  LS +L+ F
Sbjct: 218 FFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFF 277

Query: 339 VIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSI 398
             PV+ SAS+FGKQIR  S++LQ+ATGQLTRV+EEQL+G++TVQSFVAE  E+ R+N +I
Sbjct: 278 TPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAI 337

Query: 399 REIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYT 458
           R+IF VGK AAF NAKFFT+TSL+GDLSFLTVL YGSYLVL   L+IGDLTAFMLYTEYT
Sbjct: 338 RDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYT 397

Query: 459 GNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPT 518
           GNA+FGLSTFYSEIMQGAGAASRLFELTDR P+I PT+G  Y P +G IEFK+VSF+YPT
Sbjct: 398 GNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFKDVSFSYPT 457

Query: 519 RPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNS 578
           RPS QIFKSLNFKI PGS+VCIVGPSG+GKSTIALLLL YYNPT+G I+ID QDITKLN 
Sbjct: 458 RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNC 517

Query: 579 KSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDT 638
           KSLRRQI +VQQEPVLMSGTIRDNITYGLT  PTKEEIR+VAKQCFCHNFI KFP TYDT
Sbjct: 518 KSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577

Query: 639 YIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSM 698
            IGPHGTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFGQLMKSKSM
Sbjct: 578 VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSM 637

Query: 699 TIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPTXXXXXXXXXXXXXXXXXXX 758
           TIVSIAHRLSTIRRSEN+IVLG+DGSVVEMGKFKEL+A+ T                   
Sbjct: 638 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAAPGPSDQQ 697

Query: 759 XXXXXXXXXXXXANGSSIHHEGTILEEDHAQEDHESEAPPTII---------------TT 803
                         G           E H Q++ + +                      +
Sbjct: 698 LQIEKVEEKEDTNEG-----------EKHDQQNKQDDDNSHNNHDNDSNNQSLEVKDKNS 746

Query: 804 QQLEDSIESVLNDVSAESKPIKLSPK 829
           + +E+S+E +L D + E+ PIKL+P+
Sbjct: 747 ENIEESVEHLLKDAAKEANPIKLTPQ 772

>YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}
           MDL2Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, required for respiratory
           growth at high temperature; similar to human TAP1 and
           TAP2 implicated in bare lymphocyte syndrome and
           Wegener-like granulomatosis
          Length = 773

 Score =  875 bits (2260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/581 (73%), Positives = 487/581 (83%), Gaps = 3/581 (0%)

Query: 159 NFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXXXXXXXXX 218
           ++KD+ RLF+L K+D+K               GM IPK+IG++LD LK+ +         
Sbjct: 101 DYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKI 160

Query: 219 XXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSE 278
               +F L LYEFL  F+VAL IGCAAN+G        SER+VARLR+ V+K TLHQD+E
Sbjct: 161 P---IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAE 217

Query: 279 FFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCF 338
           FFD HKVGDLISRLG+D+Y+VSRS+TQK+SDGVK+LICG VG+GMM  LS  LS +L+ F
Sbjct: 218 FFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFF 277

Query: 339 VIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSI 398
             PV+ SAS+FGKQIR  S++LQ+ATGQLTRV+EEQL+G++TVQSFVAE  E+ R+N +I
Sbjct: 278 TPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAI 337

Query: 399 REIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYT 458
           R+IF VGK AAF NAKFFT+TSL+GDLSFLTVL YGSYLVL   L+IGDLTAFMLYTEYT
Sbjct: 338 RDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYT 397

Query: 459 GNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPT 518
           GNA+FGLSTFYSEIMQGAGAASRLFELTDR P+I PT+G  Y P +G IEFK+VSF+YPT
Sbjct: 398 GNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPT 457

Query: 519 RPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNS 578
           RPS QIFK+LNFKI PGS+VCIVGPSG+GKSTIALLLL YYNPT+G I ID QDI+KLN 
Sbjct: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNC 517

Query: 579 KSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDT 638
           KSLRR I +VQQEPVLMSGTIRDNITYGLT  PTKEEIR+VAKQCFCHNFI KFP TYDT
Sbjct: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577

Query: 639 YIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSM 698
            IGPHGTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFGQLMKSKSM
Sbjct: 578 VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSM 637

Query: 699 TIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPT 739
           TIVSIAHRLSTIRRSEN+IVLG+DGSVVEMGKFKEL+A+PT
Sbjct: 638 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPT 678

>TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5
           YPL270W
          Length = 739

 Score =  866 bits (2238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/685 (63%), Positives = 514/685 (75%), Gaps = 32/685 (4%)

Query: 148 PNEIEPDQGESNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKS 207
           P E E   G    KDV RL +L K D+K               GM IPK+IG+ILD LK+
Sbjct: 82  PKEAEQKSG---LKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKT 138

Query: 208 -----VAXXXXXXXXXXXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVA 262
                              I  G ++YEFLGGF+  +  G  ANYG        SER+VA
Sbjct: 139 GLETNEGKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVA 198

Query: 263 RLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIG 322
           RLR+ V+K T+HQDSEFFD HKVGDLISRLG+D+Y+VSRS+TQK+SDG K+LICGGVG+G
Sbjct: 199 RLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGVG 258

Query: 323 MMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQ 382
           MM+ +S  LS +L+ F  PV+ SASIFG++IR  S +LQ+ATGQLTRVSEEQL+GVRTVQ
Sbjct: 259 MMVSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQ 318

Query: 383 SFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGS 442
           SFVAEQ+EI R++H+IR+IF+VGKRAA+INA+FFT+TS +GD+SFL VL YGSYLVL G 
Sbjct: 319 SFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGG 378

Query: 443 LTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTP 502
           LTIGDLTAFMLYTEYTG+++FGL++FYSE+MQG GAA+RLFELTDRVP+I+PT GK + P
Sbjct: 379 LTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVP 438

Query: 503 GKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPT 562
           GKGEI FK+V+F+YPTRP N IF+ ++ KI  GSNVC+VGPSG+GKSTIALLLL +YNP+
Sbjct: 439 GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS 498

Query: 563 SGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQ 622
           SGQI IDGQDI+KLN KSLRR I +VQQEPVLMSGT+RDNITYGLTE P+KEEIR VAKQ
Sbjct: 499 SGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQ 558

Query: 623 CFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESE 682
           CFCHNFIVKFP+ YDT IGP G LLSGGQKQRIAIARALIKKP IL+LDEATSALDVESE
Sbjct: 559 CFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESE 618

Query: 683 GAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPTXXX 742
           GAINYTFGQLMKSKS+TIVSIAHRLSTIRRSENIIVLGNDGSVVE GKFKELFADP+   
Sbjct: 619 GAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPS--- 675

Query: 743 XXXXXXXXXXXXXXXXXXXXXXXXXXXXANGSSIHHEGTILEEDHAQEDHESEAPPTIIT 802
                                        + +S         E    E ++  AP     
Sbjct: 676 ----------------SELSKLLNEKSSRSENSSSSYSPNASEQPEDEANQKNAP----- 714

Query: 803 TQQLEDSIESVLNDVSAESKPIKLS 827
            +  +DS+E +L DV+AE KPIK+S
Sbjct: 715 EEAHDDSVEEILKDVTAEGKPIKIS 739

>Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)
          Length = 773

 Score =  867 bits (2240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/697 (63%), Positives = 518/697 (74%), Gaps = 51/697 (7%)

Query: 159 NFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXXXXXXXXX 218
           ++KD+ RLF+L K+D+K               GM IPK+IG++LD LK+ +         
Sbjct: 101 DYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFELKI 160

Query: 219 XXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSE 278
               +F L LYEFL  F+VAL IGCAAN+G        SER+VARLR+ V+K TLHQD+E
Sbjct: 161 P---IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAE 217

Query: 279 FFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCF 338
           FFD HKVGDLISRLG+D+Y+VSRS+TQK+SDGVK+LICG VG+GMM  LS  LS +L+ F
Sbjct: 218 FFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFF 277

Query: 339 VIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSI 398
             PV+ SAS+FGKQIR  S++LQ+ATGQLTRV+EEQL+G++TVQSFVAE  E+ R+N +I
Sbjct: 278 TPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAI 337

Query: 399 REIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYT 458
           R+IF VGK AAF NAKFFT+TSL+GDLSFLTVL YGSYLVL   L+IGDLTAFMLYTEYT
Sbjct: 338 RDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYT 397

Query: 459 GNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPT 518
           GNA+FGLSTFYSEIMQGAGAASRLFELTDR P+I PT G  Y P +G +EFK+VSF+YPT
Sbjct: 398 GNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPT 457

Query: 519 RPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNS 578
           RPS QIFK+LNFKI PGS+VCIVGPSG+GKSTIALLLL YYNP++G I+ID QDITK+N 
Sbjct: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNC 517

Query: 579 KSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDT 638
           KSLRR I +VQQEPVLMSGTIRDNITYGLT  PTKEEIR+VAKQCFCHNFI KFP TYDT
Sbjct: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577

Query: 639 YIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSM 698
            IG  GTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFG LMKSKSM
Sbjct: 578 VIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSM 637

Query: 699 TIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPTXXXXXXXXXXXXXXXXXXX 758
           TI+SIAHRLSTIRRSEN+IVLG+DGSVVEMGKFK+L+A+PT                   
Sbjct: 638 TIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPT------------------- 678

Query: 759 XXXXXXXXXXXXANGSSIHHEGTILEEDHAQEDHESEAPP-------------------- 798
                       A G S   +   +E+D+  E+   E  P                    
Sbjct: 679 -SALSQLLNERAAPGPSDQQQQ--IEKDNENEESTEEKAPDHSNKNDNDDNDNNHDNDSN 735

Query: 799 ------TIITTQQLEDSIESVLNDVSAESKPIKLSPK 829
                 T   +  +E+S+E +L D + E+ PIKL+P+
Sbjct: 736 KQSQEVTHKNSDDIEESVEHLLRDAAKEATPIKLTPQ 772

>Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON}
           (193072..195318) [2247 nt, 749 aa]
          Length = 748

 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/663 (63%), Positives = 513/663 (77%), Gaps = 19/663 (2%)

Query: 162 DVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXXXXXXXXXXXX 221
           D+ RL  L K+D+K               GM +PKIIG++LD LK +             
Sbjct: 101 DLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPE 160

Query: 222 IMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFD 281
           I FGL LYEF+    V+L +G AANYG        SER+VARLR+ V+K T+HQD+EFFD
Sbjct: 161 IAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFD 220

Query: 282 VHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIP 341
            +KVGDLISRL +D+Y+VSRS+TQK+SDG K+++CG VGIGMM+ +S  LS+ L+    P
Sbjct: 221 NNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPP 280

Query: 342 VVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREI 401
           V+LSAS FG+ IR NSR+LQ+ATG LT+V+EEQ +G++TVQSFVAEQ+EIKR+NH+IR I
Sbjct: 281 VMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHI 340

Query: 402 FDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNA 461
           F+VGK++AFINAKFF+ T+++GD+SFL VL YGSYLVLHGSL+IGDLTA+M+YTEYTG++
Sbjct: 341 FNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSS 400

Query: 462 IFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPS 521
           IFGLSTFYSEIMQGAGAASRLFELTDR+P+I PTLGK + P KGEIEFKNVSF+YPTR S
Sbjct: 401 IFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRAS 460

Query: 522 NQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSL 581
           NQIFK+L+FKI  GSNVCIVGPSG+GKSTIA LLL YYNPT+GQI +DGQDI+K++SKSL
Sbjct: 461 NQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSL 520

Query: 582 RRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIG 641
           RR +++VQQEPVLMSGTIRDNITYGL E+PT++E+R++ K+CFCHNFI KFP +YDT +G
Sbjct: 521 RRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILG 580

Query: 642 PHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIV 701
           PHGTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFG+LMKSKS+TI+
Sbjct: 581 PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITII 640

Query: 702 SIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPTXXXXXXXXXXXXXXXXXXXXXX 761
           SIAHRLSTIRRSEN+IVLGNDGSV E+GKFKEL+ADP                       
Sbjct: 641 SIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADP-----------GSELSKLLHEKA 689

Query: 762 XXXXXXXXXANGSSIHHEGTILEEDHAQEDHESEAPPTIITTQQLEDSIESVLNDVSAES 821
                    A    I  E TI        + E+  P + IT + LE+ I+  + DV+A++
Sbjct: 690 TRSERQQNTAEDQEIDPEETI--------NIENSTPESDITQELLENPIKEAIMDVAADN 741

Query: 822 KPI 824
           KPI
Sbjct: 742 KPI 744

>ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 732

 Score =  851 bits (2198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/592 (69%), Positives = 488/592 (82%), Gaps = 4/592 (0%)

Query: 151 IEPDQG-ESNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALK--- 206
           +EP Q  ES++KD  RLF L K+D++               GM IPK+IGL+LD L+   
Sbjct: 67  LEPIQKKESSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGI 126

Query: 207 SVAXXXXXXXXXXXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRS 266
                          I FGLT+Y+FLG F+  L +G AAN+         SER+VARLRS
Sbjct: 127 EGKDLQNVNMDDLGPIAFGLTIYQFLGVFAGLLLVGTAANFARIVMLRILSERVVARLRS 186

Query: 267 VVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLE 326
            VM  TLHQDSEF+D HKVGDLISRLG+D+Y+VSRS+TQK+SDG K+LICGGVGIGMM+ 
Sbjct: 187 GVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVS 246

Query: 327 LSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVA 386
           +S +LS VL+ F  P++ SAS+FGK+IR  S++LQ+ATGQLTRV+EEQL+GV+TVQSFVA
Sbjct: 247 ISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVA 306

Query: 387 EQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIG 446
           EQRE+ R+N +IR I++VG++AAFINA+FFTST+++GD+SF+ VL+YGSYLVL GSLTIG
Sbjct: 307 EQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIG 366

Query: 447 DLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGE 506
           DLTAFMLYTEYTG+++FGL+TFYSE+MQG GAASRLF+LTD + +I PT G+ Y PGKG+
Sbjct: 367 DLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGD 426

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           IEFKNVSF+YPTRP NQIFK +N K+ PGSNVCIVGPSG+GKSTIALLLL YYNPT+GQI
Sbjct: 427 IEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQI 486

Query: 567 LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCH 626
           L+DGQDI+K+N K+LRR I +VQQEP+LMSGTIRDNITYGL E  TKEEIR+VAKQCFCH
Sbjct: 487 LVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCH 546

Query: 627 NFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAIN 686
           NFI KFP  YDT IG  G LLSGGQ+QRIAIARALIKKPNIL+LDEATSALDVESEGAIN
Sbjct: 547 NFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAIN 606

Query: 687 YTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADP 738
           YTFGQLMKS SMTIVSIAHRLSTI+RSEN+IVLG DGSV+E GKFKELFA+P
Sbjct: 607 YTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANP 658

>TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa]
           {ON} Anc_6.5 YPL270W
          Length = 794

 Score =  840 bits (2170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/580 (70%), Positives = 478/580 (82%), Gaps = 2/580 (0%)

Query: 162 DVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXXXXXXXXXXXX 221
           ++ RL L+  +D+K               GM IPK+IGL+LDALK+V             
Sbjct: 147 ELARLVLMTLRDWKLLLLAITLLTISCSIGMAIPKVIGLVLDALKNVMTDSPSSLETSDL 206

Query: 222 --IMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEF 279
             I FGLTLY FLG F+ AL IG   NYG        SER+VARLRS V+K TLHQD+EF
Sbjct: 207 PPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEF 266

Query: 280 FDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFV 339
           FD +KVGDLISRLG+D+Y+VSRS+TQK+SDG K+++CGG GIGMM+ +S  LSS LV F 
Sbjct: 267 FDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCGGAGIGMMISISPQLSSFLVIFA 326

Query: 340 IPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIR 399
             VV+SASIFGK+IR  S  LQ+ATGQLTRVSEEQLNGV+TVQSFVAEQ+EI+R+N++IR
Sbjct: 327 PAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIR 386

Query: 400 EIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTG 459
           +I+++GK +A +N+KF TSTS++GD+SFL VL YGSYLVLHGSLTIGDLTAFMLYT+YT 
Sbjct: 387 DIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTA 446

Query: 460 NAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTR 519
           N+IFGLS FYSEIMQG GAA RLF+LTDR+P IRPT+G+ + PG G IEF+N+ FAYPTR
Sbjct: 447 NSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTR 506

Query: 520 PSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSK 579
           P NQ+FK+LNFKI+PG++VCIVGPSG+GKSTIALLLL YYNP+SGQILID QDI KLN K
Sbjct: 507 PENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPK 566

Query: 580 SLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTY 639
           SLR+ + +VQQEPVLMSG+IRDNITYGL  E T +EIR V+KQCFCHNFI KFP  Y+T 
Sbjct: 567 SLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETI 626

Query: 640 IGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMT 699
           IGPHGTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFG+LMKSKS+T
Sbjct: 627 IGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVT 686

Query: 700 IVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPT 739
           IVSIAHRLSTIRRSE IIVLGNDGSVVE GKFKEL+ADPT
Sbjct: 687 IVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPT 726

>TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON}
           Anc_6.5 YPL270W
          Length = 740

 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/657 (62%), Positives = 490/657 (74%), Gaps = 10/657 (1%)

Query: 162 DVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSV----------AXX 211
           D+ RL  L KKD+K               GM +PK+IG++LD LK+           +  
Sbjct: 76  DIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSAD 135

Query: 212 XXXXXXXXXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKH 271
                     I FGL+LYEFLG    AL IG AAN+G        SER+VARLRS V+K 
Sbjct: 136 LSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGRVVLLRVLSERVVARLRSQVIKK 195

Query: 272 TLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDL 331
           T+HQD+EFFD +KVGDLISRLG+D+Y+VSRS+TQK+SDG K+L+CGGVG+GMM+ +S +L
Sbjct: 196 TIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCGGVGVGMMVSISPEL 255

Query: 332 SSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREI 391
           S+ L+ F  PV+LS+  FG+ IR NSR+LQ+ATGQLTRVSEEQ +GV+TVQ+FVAEQREI
Sbjct: 256 SAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREI 315

Query: 392 KRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAF 451
           KR+N+ I+++++VGK +AFINAK FT TS +GD+SFL VL YGSYLVLHG L+IGDLTA+
Sbjct: 316 KRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAY 375

Query: 452 MLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKN 511
           M+YTE TG+A+FGLS+FYSEIMQG GAASRLFELTDR+P I PT GK Y PGKGEIEFKN
Sbjct: 376 MMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGEIEFKN 435

Query: 512 VSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQ 571
           VSFAYPTRP +QIFKSLNFKI+PGSNVCIVGPSG+GKSTIA LLL YY PT+G I +DGQ
Sbjct: 436 VSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQ 495

Query: 572 DITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVK 631
           DI+KLNSKSLRR I +VQQEP+LMSG+IRDNITYGLT E T EEIR V KQCFCHNFI K
Sbjct: 496 DISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITK 555

Query: 632 FPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQ 691
           FP  Y T +GP+GTLLSGGQKQRIAIARAL+KKPN+LILDEATSALDVESE AINYTFG+
Sbjct: 556 FPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGK 615

Query: 692 LMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPTXXXXXXXXXXXX 751
           LMK K +TI+SIAHRLSTIRRSE +IVLGNDGSVVE+GKFK LF +P             
Sbjct: 616 LMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKST 675

Query: 752 XXXXXXXXXXXXXXXXXXXANGSSIHHEGTILEEDHAQEDHESEAPPTIITTQQLED 808
                               N ++      +LEE+  Q D  S+    I+  Q   D
Sbjct: 676 INERNPNEKPAETPEQESQKNAANESIVDVVLEEEILQNDIRSQDEKDILDKQPFPD 732

>KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5
           YPL270W
          Length = 741

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/681 (61%), Positives = 499/681 (73%), Gaps = 35/681 (5%)

Query: 155 QGESNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXXXXX 214
           + E  +KD++RLFLLVK D+K               GM IPK+IG +LD+LK +      
Sbjct: 83  EDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSLKDI-----Q 137

Query: 215 XXXXXXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLH 274
                  +++ ++L  F  G S  L +GC ANY         SE LVA+LR+ V+KH +H
Sbjct: 138 GKEFSELMIWDMSLKHFFYGLSGLLLLGCGANYVRVILLRILSENLVAKLRANVIKHIIH 197

Query: 275 QDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLS-S 333
           QD++FFD +KVGDLISR+G D++IVSRSITQKISDGVK++  G  G+GMML +S+ LS S
Sbjct: 198 QDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMLSISIPLSCS 257

Query: 334 VLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKR 393
           +L+    P++LSA +FGKQIR NS++LQ+ T  LTRVSEEQ NG++T+QSFVAEQ E+ +
Sbjct: 258 ILILMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHK 317

Query: 394 FNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFML 453
           FN SIR+IF VGK AAFINAKFFT+ S++GDLSFL VL YGS+LV    L++GDLTAFML
Sbjct: 318 FNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFML 377

Query: 454 YTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKG-EIEFKNV 512
           YTEYTGNAIF LS F+SEIMQGAGAASR+FELTD  P I PT G  + P KG EIEFKNV
Sbjct: 378 YTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIEFKNV 437

Query: 513 SFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQD 572
           SF YPTRP+  IF++LNFKI+ GSNVCIVGPSGKGKSTIA LLLHYYNP+ GQILIDGQD
Sbjct: 438 SFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQD 497

Query: 573 ITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKF 632
           I+ L++KSLRR I +VQQEP+LMSGTIRDNITYGLT  PTKEEIR+VAKQCFCHNFI +F
Sbjct: 498 ISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRF 557

Query: 633 PYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQL 692
           P TYDT IGPHGTLLSGGQKQRIAIARALIKKP +LILDEATSALDVESEGAINYTFGQL
Sbjct: 558 PDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQL 617

Query: 693 MKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPTXXXXXXXXXXXXX 752
           MKSKSMTIVSIAHRLSTIRRSEN+IVLGNDGSVVE GKFKELFA+P              
Sbjct: 618 MKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPA------------- 664

Query: 753 XXXXXXXXXXXXXXXXXXANGSSIHHEGTILEEDHAQEDHES---EAPP----TIITTQQ 805
                             ++G++   E    E     E+  S   EA P    T    + 
Sbjct: 665 --------SELSKLLREKSSGNNAAPEIQPQEISQTIEEDPSFSGEATPASSVTGFKAET 716

Query: 806 LEDSIESVLNDVSAESKPIKL 826
             ++I  VL D+S E KP+K+
Sbjct: 717 EAETINEVLKDISTEGKPLKI 737

>SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 774

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/591 (64%), Positives = 470/591 (79%), Gaps = 4/591 (0%)

Query: 150 EIEPDQGESN--FKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKS 207
           E E   G S   +K++FRLF L + D+K               GM +PK+IG++LD  K+
Sbjct: 112 EQESTSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKN 171

Query: 208 V--AXXXXXXXXXXXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLR 265
              +            +++GL LY+FL  F+ AL +   AN+G         E+LVARLR
Sbjct: 172 AITSDEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLR 231

Query: 266 SVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMML 325
           S V+K T+HQD+EFFD +KVGDLISRL +D+Y+VSRS+TQ ISDG K++ICGGVGIGMM 
Sbjct: 232 SNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMF 291

Query: 326 ELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFV 385
            +S  L++ L  F  P+++ A+I+G++IR  SR+LQ +TG LT+V+EEQL+GV+TVQSFV
Sbjct: 292 HISSTLATALFLFAPPLLVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFV 351

Query: 386 AEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTI 445
           AEQ+EIKR+NH+IR++FDVGKR A  NA FF+STS++GD SFL VL YGS+LVL GSL+I
Sbjct: 352 AEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSI 411

Query: 446 GDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKG 505
           GDLTAFMLYTEY+G+A+FGLS FYSE+M+GAGAASRLFELTD  P+I  T G  Y PGKG
Sbjct: 412 GDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKG 471

Query: 506 EIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQ 565
           EI+F+NVSF+YPTR +NQIF +LNF I  GSNVC+VGPSG+GKSTIA LLL YYNPTSG+
Sbjct: 472 EIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGR 531

Query: 566 ILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFC 625
           I IDGQDI+K+++KSLRR + VVQQEP+LMSG+IRDNITYG+   PT +EIR+V+K+CFC
Sbjct: 532 ITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFC 591

Query: 626 HNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 685
           HNFI KF   Y+T IGP G LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI
Sbjct: 592 HNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 651

Query: 686 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFA 736
           NYT GQLMKS+ +TI+SIAHRLSTIRRSEN+IVLG+DGSVVEMGKFKEL+A
Sbjct: 652 NYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYA 702

>Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON}
           YPL270W (MDL2) - ATP-binding cassette (ABC) transporter
           family member [contig 186] FULL
          Length = 776

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/591 (63%), Positives = 468/591 (79%), Gaps = 5/591 (0%)

Query: 149 NEIEPDQGESNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSV 208
           +E  P+ G   +K+V RLF L   D+K               GM IPK+IG++LDA+K+ 
Sbjct: 131 DEESPNMG---YKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNT 187

Query: 209 --AXXXXXXXXXXXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRS 266
             +            I+  L++YEFLG F+ AL IG  AN+G         E+LVARLRS
Sbjct: 188 YSSATGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRS 247

Query: 267 VVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLE 326
            V++  +HQD+EFFD +KVGDLISRL +D+Y+VSRS+TQ +SDG K++ICGGVGIGMM+ 
Sbjct: 248 NVIRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMVN 307

Query: 327 LSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVA 386
           +S+ L+S L+ F  P+++ A I+GK+IR+ SR+LQ++TG LTRVSEEQL+GV+T+QSFVA
Sbjct: 308 ISISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVA 367

Query: 387 EQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIG 446
           E +E++R+N +IR++F  GK+ A  NA FF+ST+++GDLSFL VL YGS+LVL G LT+G
Sbjct: 368 EGKELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVG 427

Query: 447 DLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGE 506
           DLTAFMLYTEYTG+A+FGLS FYSE+M+GAGAASRLFE+TD  P+I+PT GK Y PG G+
Sbjct: 428 DLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGK 487

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           I FK+VSF+YPTRP NQIF  LNF I+PGSNVCIVGPSG+GKSTI  LLL YYNP+SGQI
Sbjct: 488 ISFKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQI 547

Query: 567 LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCH 626
            ID QDI++L+ KSLRR + VVQQEP+LMSG+I+ N+TYGL  E + +EIR+VAK+CFCH
Sbjct: 548 TIDDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCH 607

Query: 627 NFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAIN 686
            F+ KFP  YDT IGP G  LSGGQKQRIAIARAL+KKP ILILDEATSALDVESEGAIN
Sbjct: 608 GFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAIN 667

Query: 687 YTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFAD 737
           YT G+LMKSK +TI+SIAHRLSTIRRSEN+IVLGNDGSVVE+GKFK+L+AD
Sbjct: 668 YTLGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYAD 718

>KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 789

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/589 (64%), Positives = 463/589 (78%), Gaps = 13/589 (2%)

Query: 162 DVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKS-------------V 208
           DV RLF L + D+K               GM +PK+IGL+LDA K+             +
Sbjct: 114 DVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNALSGSNTNNGNGGL 173

Query: 209 AXXXXXXXXXXXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVV 268
                        I+  + LY+F   F  AL IG  AN+G         ERLVARLRS V
Sbjct: 174 EDSKSLTLDDLPPIVGDIQLYDFFLLFGGALLIGTMANFGRVVLLKILGERLVARLRSNV 233

Query: 269 MKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELS 328
           +K T+H D EF+D +KVGDL+SRLGAD+YIVSRS+TQ ISDG K+LICGGVGIGMM  +S
Sbjct: 234 IKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHIS 293

Query: 329 MDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQ 388
             L+SVL  F  P+++ A+I+G +IR  SRELQ A+G LT+V+EEQL+G++TVQSFVAE 
Sbjct: 294 STLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEG 353

Query: 389 REIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDL 448
           +E+ R+N+++R++F+VGK+ AF NA FF+ST+++GD SFL VL YGS+LVL G+LTIGDL
Sbjct: 354 KEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDL 413

Query: 449 TAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIE 508
           TAFMLYTEYTG+A+FGLSTFYSE+M+GAGAA+RLFEL D  PTI+ T GK + P  G++E
Sbjct: 414 TAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVE 473

Query: 509 FKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI 568
           F++VSF+YPTR +NQIFK LNF I+PGSNVCIVGPSG+GKSTIA LLL YYNPTSG+IL+
Sbjct: 474 FQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILV 533

Query: 569 DGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNF 628
           DGQDITKL+SKSLRRQ+ VVQQEP+LMSGTIR+NITYG++ +P+ EEIR+VAK+CFCH F
Sbjct: 534 DGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAF 593

Query: 629 IVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYT 688
           I KFP  Y+T IGP G LLSGGQKQRIAIARAL+ KP ILILDEATSALDVESEGAINYT
Sbjct: 594 ISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYT 653

Query: 689 FGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFAD 737
            G+LMKSK +TI+SIAHRLSTIRRSEN+IVLG DGSVVEMGKFK+L+A+
Sbjct: 654 LGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYAN 702

>KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa]
           {ON} Anc_6.5 YPL270W
          Length = 751

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/593 (66%), Positives = 462/593 (77%), Gaps = 11/593 (1%)

Query: 154 DQGESNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXXXX 213
           D G S+++D+ RL +L+KKD K               GM IPKIIG ILD L++      
Sbjct: 78  DNG-SSWRDLKRLTVLIKKDIKLLVLAIVLLTISCSIGMAIPKIIGTILDTLRN---NYE 133

Query: 214 XXXXXXXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTL 273
                    +  + L  FL G  + L  GC AN+G        SERLV+RLRS V+K+ +
Sbjct: 134 NLTSLSQIKILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNII 193

Query: 274 HQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSS 333
           H+D EFFD  KVGDL+SR+G D+++VSRSIT K++DGV+S   G  GIG+ML LS +L+ 
Sbjct: 194 HKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSGFIGIFGIGLMLTLSRELTG 253

Query: 334 VLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKR 393
            L   + P++   S+FGKQIR+NS++LQD TG LTRV+EEQ NG+RTVQ FVAE+ EIKR
Sbjct: 254 ALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKR 313

Query: 394 FNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFML 453
           FN+ +REIF VGK +AFIN KFFTS SL+GDL FL VL YGSYLV+HGS++IGDLTAFML
Sbjct: 314 FNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFML 373

Query: 454 YTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKT-YTP----GKGEIE 508
           YTEYTGNAIFGLS+FYSE+MQG GAASR+FE+ D+ P I+ T G+  + P    G  EIE
Sbjct: 374 YTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIE 433

Query: 509 FKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI 568
           FKNVSF YPTRP+NQIFK+LNFK+  GSNVCIVGPSG+GKSTIA LLLH+YN  SGQILI
Sbjct: 434 FKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILI 493

Query: 569 DGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNF 628
           DGQDI  LN+KSLRR+I +VQQEP+LMSGTIRDNITYGLTEEP+KEEIR VAKQCFCHNF
Sbjct: 494 DGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNF 553

Query: 629 IVKFPYTYD--TYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAIN 686
           I KFP TYD     G  GT LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAIN
Sbjct: 554 ITKFPDTYDTTIGSGSSGTSLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAIN 613

Query: 687 YTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPT 739
           YTFGQ+MKSKSMTIVSIAHRLSTIRR E++IVLGNDGSVVEMGKFKEL+ +PT
Sbjct: 614 YTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNPT 666

>KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270W MDL2
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane
          Length = 740

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/591 (61%), Positives = 465/591 (78%), Gaps = 2/591 (0%)

Query: 149 NEIEPDQGESNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSV 208
           NE   ++ ++N++++ RL  L + D+K               GM IPK+IG++LDA+K+ 
Sbjct: 95  NESTEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNA 154

Query: 209 AXXXXXXXXXXXX--IMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRS 266
           +              I++GL +++FL  F+  L  G  AN+G         E+LVARLRS
Sbjct: 155 SGGFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRS 214

Query: 267 VVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLE 326
            V+K  +HQD+EFFD +KVGDLISRL +D+Y+VSRS+TQ +SDG K++ICGGVGIGMM+ 
Sbjct: 215 NVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMIN 274

Query: 327 LSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVA 386
           +S  L+S L  F  P+++ A I+GK+IR+ SRELQ++TG LT+VSEEQL+GV+T+Q+FVA
Sbjct: 275 ISASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVA 334

Query: 387 EQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIG 446
           E +E+ R+N++IR++F  GK+ A  NA FF+ST ++GDLSFL VL YGS+LVL G L++G
Sbjct: 335 EGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVG 394

Query: 447 DLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGE 506
           DLTAFMLYTEYTG+A+FGLS FYSE+M+GAGAASRLFE+TD    I+P+ GK Y P  GE
Sbjct: 395 DLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGE 454

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           I+F++VSF+YPTRP NQIF  LNF I+PGSNVC+VGPSG+GKSTIA LLL YY+P SG+I
Sbjct: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514

Query: 567 LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCH 626
           +IDGQ+I+KL+ KSLRR + VVQQEP+LMSG+IR N+TYG+  E T +EIR+VAK+CFCH
Sbjct: 515 MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCH 574

Query: 627 NFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAIN 686
            FI KFP  Y+T IGP G  LSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAIN
Sbjct: 575 GFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAIN 634

Query: 687 YTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFAD 737
           YT G+LM+S+ +TI+SIAHRLSTIRRSEN+IVLGNDGSVVEMGKFKEL+A+
Sbjct: 635 YTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYAN 685

>ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL270W (MDL2)
          Length = 754

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/597 (60%), Positives = 456/597 (76%), Gaps = 8/597 (1%)

Query: 148 PNEIEPDQGESNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKS 207
           P+  +P +  + + +VFRL  LVK D+K               GM +PK+IGL+LDA K 
Sbjct: 92  PSRAQPAK-PAGWHEVFRLLRLVKPDWKLLLAALGLLTISCSIGMAVPKVIGLVLDATKD 150

Query: 208 VAXXXXXXXXXXX-------XIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERL 260
                                I+   TL + L  F+ AL +G AAN+G         ERL
Sbjct: 151 AVAQAEKNETGAPMSLLDMPSIIGNFTLVDVLAAFAGALLVGSAANFGRMFLLKMLGERL 210

Query: 261 VARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVG 320
           VARLR+ V+K TLH D+EFFD +KVGDLISRLG+D+YIVSRS+T  ISDGVK+ +CGGVG
Sbjct: 211 VARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVG 270

Query: 321 IGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRT 380
           +GMM  +S  L+S ++ F  P++++A+I+GK+IR  SRELQ +TG LTRVSEEQ NG++T
Sbjct: 271 VGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKT 330

Query: 381 VQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLH 440
           ++SFVAE +E++R+N ++R +F+V KR    +A FF+ T+++GD+SFL VL YGS+LVL 
Sbjct: 331 IKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQ 390

Query: 441 GSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTY 500
           G L++G LTAFMLYTEYTG+++FGLS FYSE+M+GAGAASRLFELTD   ++  T+G+T+
Sbjct: 391 GELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTF 450

Query: 501 TPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYN 560
            P  G IEFK+VSF+YPTRP++QIFK L   I PGSNVCIVGPSG+GKSTIA LLL +Y+
Sbjct: 451 VPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYD 510

Query: 561 PTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVA 620
             SG ILIDGQDI+K+++KSLR+ + VVQQEPVLMSGTIRDNITYGL+  P+ +EIR VA
Sbjct: 511 ANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVA 570

Query: 621 KQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE 680
           K+CFCHNFI KFP  YDT IGP G LLSGGQ+QRIAIARALIKKP ILILDEATSALDVE
Sbjct: 571 KKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE 630

Query: 681 SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFAD 737
           SEGAINYT G+LM+SK +TIVSIAHRLSTIRRSENI+VLGNDGSV+E GKF +L+ D
Sbjct: 631 SEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRD 687

>Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON}
           similar to Ashbya gossypii ACR022W
          Length = 769

 Score =  736 bits (1900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/598 (59%), Positives = 451/598 (75%), Gaps = 22/598 (3%)

Query: 160 FKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALK------------- 206
           +++V RL  L K D+K               GM +PK+IGL+LDA K             
Sbjct: 97  WREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQD 156

Query: 207 ---------SVAXXXXXXXXXXXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXS 257
                    S+             I+  L++ +F+G F+ AL +G  AN+G         
Sbjct: 157 LEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIG 216

Query: 258 ERLVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICG 317
           ERLV+RLRS V+K T+H D EFFD +KVGDLISR G+D+Y+VSRS+TQ +SDG K++ICG
Sbjct: 217 ERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICG 276

Query: 318 GVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNG 377
           GVG+GMM  +S  L+SV++ F  P+++ A I+GK+I   SR+LQ ++G LTRV+EEQLNG
Sbjct: 277 GVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNG 336

Query: 378 VRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYL 437
           +RT++SFVAE++EI+R+N +IR++F VGKR AF NA FF+ST+++GD+SF+ VL+YG+ L
Sbjct: 337 IRTIKSFVAEKKEIRRYNDAIRQLFYVGKREAFTNATFFSSTTILGDMSFVIVLLYGANL 396

Query: 438 VLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLG 497
           VL G+L+IGDLTAFMLYTEYTG+++FGLSTFYSE+M+GAGAASRLFEL D   ++R  + 
Sbjct: 397 VLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNIS 456

Query: 498 KTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLH 557
              TP +G+IEF++VSF+YPTRPSNQIFK ++F I+PGSNVCIVGPSGKGKSTI  LLL 
Sbjct: 457 HALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLR 516

Query: 558 YYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIR 617
           +Y+P  G ILID  DI+K  +KSLRR + VVQQEP LMSGTIRDNITYGL+  PT +EIR
Sbjct: 517 FYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIR 576

Query: 618 TVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSAL 677
            V+KQCFCH FI KFP  YDT IGP G  LSGGQ+QRIAIARALIKKP ILILDEATSAL
Sbjct: 577 VVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSAL 636

Query: 678 DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELF 735
           DVESEGAINYT G LM+SK +TI+SIAHRLSTIRRSENIIV+GNDGSVVE+GKF +L+
Sbjct: 637 DVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLY 694

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score =  527 bits (1357), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 273/603 (45%), Positives = 383/603 (63%), Gaps = 14/603 (2%)

Query: 150 EIEPDQ-GESNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSV 208
           ++ PD+ G S FKDV RLF L + +                  M++P +IG +LD  K  
Sbjct: 86  KLTPDESGRSGFKDVKRLFELARPETFYISIALLLIFISSAVSMVVPSVIGKLLDIAKPP 145

Query: 209 AXXXXXXXXXXXXI---------MFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSER 259
           +            +         ++GLT  +F     V   +G  AN G         ER
Sbjct: 146 SADEENGKGVSEKLKEKEDEDKKIYGLTALQFYTALGVVFTVGALANTGRIIILKVTGER 205

Query: 260 LVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGV 319
           LVARLR+  MK  L Q++ F D +KVGDLISRL  D+ IV++S+TQ +SDG ++++ G V
Sbjct: 206 LVARLRTRTMKAALEQEAAFLDSNKVGDLISRLSTDASIVAKSVTQNVSDGTRAILQGFV 265

Query: 320 GIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVR 379
           G GMM  +S  L+SV++  + P+   A I+G++IR  SR+LQ + G LT+V+EEQLN  R
Sbjct: 266 GFGMMSYISWQLTSVMLLLIPPLGAMAIIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATR 325

Query: 380 TVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVL 439
           T+Q++  E++EI R+   +R +FD+G + A  +  FF ST LVG+ + L++LV G+ ++ 
Sbjct: 326 TIQAYGGEKKEIHRYATEVRNVFDIGYKEAVTSGLFFGSTGLVGNTALLSLLVVGTNMIS 385

Query: 440 HGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKT 499
            G+LT+G+L++FM+Y  YTG+++FGLSTFYSE+M+GAGAA+R+FEL+DR P I+PT+GK 
Sbjct: 386 SGALTVGELSSFMMYAVYTGSSLFGLSTFYSELMKGAGAAARVFELSDRKPAIKPTIGKD 445

Query: 500 YTPGKGE-IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHY 558
                G+ +EFKNVSF YPTRP  QIF+  + KI+PG +VC VGPSG GKST++ LLL Y
Sbjct: 446 PITLFGKTVEFKNVSFWYPTRPKQQIFQDFSIKIEPGEHVCFVGPSGSGKSTVSSLLLRY 505

Query: 559 YNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKE--EI 616
           Y+   G IL+ G+DI   + +  RR + VVQQEP+L +GTI +NI Y + EE   E   I
Sbjct: 506 YDVAKGSILVGGEDIKNFSLRKYRRLLGVVQQEPMLFNGTILENILYSVPEEIANEPGRI 565

Query: 617 RTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSA 676
               +   C  F+  FP   +T +GP GT LSGGQKQRIA+AR  +  P+ILILDEATSA
Sbjct: 566 ERAIESANCSKFLNNFPDGLNTLVGPRGTQLSGGQKQRIALARTFLLDPSILILDEATSA 625

Query: 677 LDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFA 736
           LD +SE  I     Q    K  T +SIAHRLSTI+ S  ++VLG +G VVE G F+EL +
Sbjct: 626 LDSQSEDIIAQNL-QARNEKGQTTISIAHRLSTIKHSSRVVVLGKNGCVVETGTFQELIS 684

Query: 737 DPT 739
           +P+
Sbjct: 685 NPS 687

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score =  527 bits (1357), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 267/595 (44%), Positives = 388/595 (65%), Gaps = 14/595 (2%)

Query: 158 SNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXXXXXXXX 217
           + FKDV RLF L K +                  M++P +IG +LD   + +        
Sbjct: 91  TGFKDVKRLFTLAKPETAYIVLALVLILISSTVSMVVPSVIGKLLDLSSNTSNDDTGDAK 150

Query: 218 XXXXI----------MFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSV 267
               +          ++G T  +F  G  +   IG  AN G         E+LVARLR+ 
Sbjct: 151 SKEKVDNKEDRDNNTIYGFTHTQFFAGLGIVFVIGAIANTGRIVILKVTGEKLVARLRTR 210

Query: 268 VMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLEL 327
            MK  L QD+ F D ++VGDLISRL +D+ IV++S+T  +SDG ++++ G VG  MM  +
Sbjct: 211 TMKAALDQDATFLDSNRVGDLISRLSSDASIVAKSVTMNVSDGTRAILQGFVGFSMMSYI 270

Query: 328 SMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAE 387
           S  L+SV+V  + P+ + A ++GK+IR  SR+LQ A G LT+V+EEQLN  +T+Q++  E
Sbjct: 271 SFKLTSVMVLLIPPLGIMALVYGKKIRNLSRQLQTAVGGLTKVAEEQLNATKTIQAYGGE 330

Query: 388 QREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGD 447
           ++EI+R+   +R++FDVG + A  +  FF ST LVG+ + L++L+ G+ ++  GSLT+GD
Sbjct: 331 KKEIRRYASEVRDVFDVGLKEAITSGIFFGSTGLVGNAALLSLLLVGTNMISSGSLTVGD 390

Query: 448 LTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGE- 506
           L++FM+Y  YTG+++FGLS+FYSE+M+GAGAA+R+FEL DR P I+PT+GK     KG+ 
Sbjct: 391 LSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELDDRKPLIKPTIGKDPVTLKGKA 450

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           I F++VSF YPTRP++++F  ++FKI+PG ++C VGPSG GKST++ LLL YY+ T G I
Sbjct: 451 IIFQDVSFHYPTRPNHRVFNKISFKIEPGEHICFVGPSGSGKSTVSQLLLRYYDATEGNI 510

Query: 567 LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEE--PTKEEIRTVAKQCF 624
           LI   +I  L+ +  R+ + VVQQEP+L +GTI DNI Y + +E    K ++    K+  
Sbjct: 511 LIGEDNIKSLSLRKYRKLLGVVQQEPMLFNGTIIDNILYNVPDEIASQKNKVDLAIKKSN 570

Query: 625 CHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGA 684
           C  F+  FP   +T +GP GT LSGGQKQRIAIAR+ +  P+IL+LDEATSALD +SE  
Sbjct: 571 CTKFLANFPDGLNTIVGPRGTQLSGGQKQRIAIARSFLLDPSILLLDEATSALDTQSEDI 630

Query: 685 INYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPT 739
           I  T  +  +++ +T +SIAHRLSTI+ S  ++VL  +GSVVE GKF EL A+PT
Sbjct: 631 IAMTLKK-REAEGLTTISIAHRLSTIKYSSRVVVLNKNGSVVETGKFTELIANPT 684

>Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188W
           (REAL)
          Length = 696

 Score =  514 bits (1324), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 270/584 (46%), Positives = 366/584 (62%), Gaps = 5/584 (0%)

Query: 158 SNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXXXXXXXX 217
           S FKD+ RLF+L K + K                M +P +IG +LD L S          
Sbjct: 84  SGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLD-LASETEDEEKEEK 142

Query: 218 XXXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDS 277
                ++GLT  +F     +   IG  AN           ERLVARLR+  MK  L QD+
Sbjct: 143 AKSNKLYGLTKRQFFTALGLVFIIGAVANASRIIILKVTGERLVARLRTRTMKAALDQDA 202

Query: 278 EFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVC 337
            F D ++VGDLISRL +D+ IV++S+TQ +SDG +++I G VG GMM  LS  L+ V++ 
Sbjct: 203 TFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMV 262

Query: 338 FVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHS 397
              P+   A I+G++IR  SR+LQ + G LT+V+EEQLN  RT+Q++  E+ E++R+   
Sbjct: 263 LAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYAKE 322

Query: 398 IREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEY 457
           +R +F +G + A  +  FF ST LVG+ + L++L+ G+ ++  GS+T+G+L++FM+Y  Y
Sbjct: 323 VRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSSFMMYAVY 382

Query: 458 TGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKT-YTPGKGEIEFKNVSFAY 516
           TG+++FGLS+FYSE+M+GAGAA+R+FEL DR P IRPT+GK   +  +  I FKNVSF Y
Sbjct: 383 TGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQKPIVFKNVSFTY 442

Query: 517 PTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKL 576
           PTRP +QIFK LN  I PG +VC VGPSG GKSTIA LLL YY+  SG I    +DI   
Sbjct: 443 PTRPKHQIFKDLNITINPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRSF 502

Query: 577 NSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRT--VAKQCFCHNFIVKFPY 634
           N +  RR I  VQQEP+L +GTI DNI Y +  E  ++E R      Q  C  F+  FP 
Sbjct: 503 NLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQEDRIGRAIGQANCTKFLANFPD 562

Query: 635 TYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMK 694
              T +G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +     Q   
Sbjct: 563 GLQTTVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNL-QRRV 621

Query: 695 SKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADP 738
            + +T +SIAHRLSTI+ S  ++VLG  GSVVE G F++L A P
Sbjct: 622 ERGLTTISIAHRLSTIKHSTRVVVLGKHGSVVETGSFQDLIAIP 665

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score =  514 bits (1325), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 275/599 (45%), Positives = 386/599 (64%), Gaps = 23/599 (3%)

Query: 149 NEIEPDQGESNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSV 208
           NE+    G    KD+ RLF L K + K                M IP IIG +LD  K+ 
Sbjct: 85  NEVSKSNG---MKDIKRLFKLAKPEAKYILLALLFIVISSSVSMTIPTIIGKLLDLAKAD 141

Query: 209 AXXXXXX--XXXXXXIMFGLT---LYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVAR 263
                          ++FGLT    Y  LGG  +A   G  AN           ERLVAR
Sbjct: 142 NDDEDGDNNAKKEKLMIFGLTKPQFYTALGGLFLA---GAIANASRIVILKVTGERLVAR 198

Query: 264 LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGM 323
           LR+  MK  L+QD+ F D ++VGDLISRL +D+ IV++++TQ +SDG +++I G VG GM
Sbjct: 199 LRTRTMKAALYQDASFLDTNRVGDLISRLSSDASIVAKAVTQNVSDGSRAVIQGFVGFGM 258

Query: 324 MLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQS 383
           M  +S  L+ V++  V P+ + A ++G++IR  SR+LQ + G LT+V+EEQLN  RT+Q+
Sbjct: 259 MSFISWKLTCVMMIMVPPLGVMALVYGRKIRTLSRQLQASVGGLTKVAEEQLNATRTIQA 318

Query: 384 FVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSL 443
           +  E  EI R+   +R++FDVG + A  +  FF ST LVG+++ +++L+ G+ ++ +G+L
Sbjct: 319 YGGEALEIHRYATEVRKVFDVGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTSMIQYGTL 378

Query: 444 TIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTP- 502
           T+GDL++FM+Y  YTG+++FGLS FYSE+M+GAGAA+R+FEL DR P I+PT+G  Y P 
Sbjct: 379 TVGDLSSFMMYAVYTGSSLFGLSGFYSELMKGAGAATRVFELNDRKPLIKPTIG--YDPK 436

Query: 503 ---GKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYY 559
              GK  IEF+NVSFAYPTRP++ I  +L+  I+PG +VCIVGPSG GKST++ LLL YY
Sbjct: 437 SLLGK-SIEFQNVSFAYPTRPTHSILNNLSISIQPGEHVCIVGPSGSGKSTVSSLLLRYY 495

Query: 560 NPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPT----KEE 615
           + ++G I IDGQ+I + N +  RR + VVQQEP+L +GTI DNI Y +  + T      +
Sbjct: 496 DVSTGSIKIDGQNIKEFNLRKYRRLLGVVQQEPMLFNGTILDNILYAVLSKETLTANSPD 555

Query: 616 IRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATS 675
           ++   +Q  C  F+  FP   +T +GP GT LSGGQKQRIA+ARA +  P +LILDEATS
Sbjct: 556 VKRALEQANCTKFLKNFPEGVNTLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATS 615

Query: 676 ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
           ALD +SE  +     + ++   +T +SIAHRLSTI+ S  +IVL   GSVVE G F+EL
Sbjct: 616 ALDSQSEEIVAKNLSERVE-LGLTTISIAHRLSTIKHSTRVIVLDKSGSVVETGPFEEL 673

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score =  510 bits (1314), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 263/588 (44%), Positives = 369/588 (62%), Gaps = 4/588 (0%)

Query: 154 DQGESNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXXXX 213
           D   S FKD+ RLF L K +                  M IP I+G +LD  K       
Sbjct: 84  DLNGSGFKDIKRLFRLAKPETLQIALALVLILISSAVSMTIPTIVGKLLDIAKDRKDADD 143

Query: 214 XXXXXXXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTL 273
                    +FG+T  +F         +G AAN G         ERLVARLR+  MK  L
Sbjct: 144 TTEDDEGPKIFGMTTKQFCTALLAVFLVGAAANAGRIVILKITGERLVARLRTRTMKAAL 203

Query: 274 HQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSS 333
            QD+ F D ++VGDLIS L +D+ IV++S+TQ +SDG +++I G VG GMM  +S  L+S
Sbjct: 204 DQDATFLDTNRVGDLISCLSSDASIVAKSVTQNVSDGTRAVIQGFVGFGMMGYISWQLTS 263

Query: 334 VLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKR 393
           V++  + P+ + A ++G++IR  SR+LQ + G LT+VSEEQL  V+T+QS+V E++EI R
Sbjct: 264 VMILMIPPLGIMAVVYGRKIRNLSRQLQTSVGGLTKVSEEQLGAVKTIQSYVGEKKEIHR 323

Query: 394 FNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFML 453
           +   +R +F++G + A  +  FF ST LVG++S L +L+ G+ ++ +G +T+GDL++FM+
Sbjct: 324 YATEVRNVFNIGLKEALTSGVFFGSTGLVGNISLLALLMVGTNMIQNGLITVGDLSSFMM 383

Query: 454 YTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGK-TYTPGKGEIEFKNV 512
           Y  YTG+++FGLS+FYSE+M+GAGAA+R+FEL DR P I PT+G+   T     I F+NV
Sbjct: 384 YAVYTGSSMFGLSSFYSELMKGAGAAARVFELKDRKPLIPPTIGQDPVTLANKTIRFENV 443

Query: 513 SFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQD 572
           SF YPTR + +IF  L+  ++PG +VCIVGPSG GKST+A LLL YY+   G+I+I   +
Sbjct: 444 SFTYPTRLNQKIFDGLDITVEPGEHVCIVGPSGSGKSTVASLLLRYYDTNEGRIMIGDHN 503

Query: 573 ITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEE--IRTVAKQCFCHNFIV 630
           I   N +  RR + +VQQEP L +GTI DNI Y +  E    +  I T   Q  C  F+ 
Sbjct: 504 INSFNVRKYRRLLGIVQQEPQLFNGTILDNILYTVPPERADNDDLISTAIGQANCSKFLA 563

Query: 631 KFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFG 690
            FP    T +GP G  LSGGQKQRIA+ARA +  P++LILDEATSALD +SE  +  T  
Sbjct: 564 NFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPSLLILDEATSALDSQSEEIVAQTL- 622

Query: 691 QLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADP 738
           ++   + +T +SIAHRLSTI+    ++VLG  G VVE G F+EL  +P
Sbjct: 623 RVRVQRGLTTISIAHRLSTIKNCTRVVVLGKCGQVVESGPFEELLRNP 670

>YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}
           MDL1Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, mediates export of peptides
           generated upon proteolysis of mitochondrial proteins,
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 695

 Score =  509 bits (1312), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 270/584 (46%), Positives = 366/584 (62%), Gaps = 6/584 (1%)

Query: 158 SNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXXXXXXXX 217
           S FKD+ RLF+L K + K                M +P +IG +LD L S +        
Sbjct: 84  SGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLD-LASESDGEDEEGS 142

Query: 218 XXXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDS 277
                ++G T  +F         IG  AN           ERLVARLR+  MK  L QD+
Sbjct: 143 KSNK-LYGFTKKQFFTALGAVFIIGAVANASRIIILKVTGERLVARLRTRTMKAALDQDA 201

Query: 278 EFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVC 337
            F D ++VGDLISRL +D+ IV++S+TQ +SDG +++I G VG GMM  LS  L+ V++ 
Sbjct: 202 TFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMI 261

Query: 338 FVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHS 397
              P+   A I+G++IR  SR+LQ + G LT+V+EEQLN  RT+Q++  E+ E++R+   
Sbjct: 262 LAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYAKE 321

Query: 398 IREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEY 457
           +R +F +G + A  +  FF ST LVG+ + L++L+ G+ ++  GS+T+G+L++FM+Y  Y
Sbjct: 322 VRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSSFMMYAVY 381

Query: 458 TGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKT-YTPGKGEIEFKNVSFAY 516
           TG+++FGLS+FYSE+M+GAGAA+R+FEL DR P IRPT+GK   +  +  I FKNVSF Y
Sbjct: 382 TGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQKPIVFKNVSFTY 441

Query: 517 PTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKL 576
           PTRP +QIFK LN  IKPG +VC VGPSG GKSTIA LLL YY+  SG I    +DI   
Sbjct: 442 PTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRNF 501

Query: 577 NSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEE--IRTVAKQCFCHNFIVKFPY 634
           N +  RR I  VQQEP+L +GTI DNI Y +  E  +++  IR    +  C  F+  FP 
Sbjct: 502 NLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQDDRIRRAIGKANCTKFLANFPD 561

Query: 635 TYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMK 694
              T +G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +     Q   
Sbjct: 562 GLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNL-QRRV 620

Query: 695 SKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADP 738
            +  T +SIAHRLSTI+ S  +IVLG  GSVVE G F++L A P
Sbjct: 621 ERGFTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFRDLIAIP 664

>Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188W
           (REAL)
          Length = 692

 Score =  509 bits (1312), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 268/590 (45%), Positives = 364/590 (61%), Gaps = 5/590 (0%)

Query: 152 EPDQGESNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXX 211
           + +   S FKD+ RLF+L + + K                M +P +IG +LD        
Sbjct: 78  DANSKSSGFKDIKRLFVLSRPESKYIGLALLLILISSSVSMAVPSVIGKLLDVASESDDE 137

Query: 212 XXXXXXXXXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKH 271
                      ++GLT  +F     +   IG  AN           ERLVARLR+  MK 
Sbjct: 138 EDEEKARDSK-LYGLTKKQFFTALGLVFVIGAVANASRIIILKITGERLVARLRTRTMKA 196

Query: 272 TLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDL 331
            L QD+ F D ++VGDLISRL +D+ IV++S+TQ +SDG +++I G VG GMM  LS  L
Sbjct: 197 ALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKL 256

Query: 332 SSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREI 391
           + V++    P+   A ++GK+IR  SR+LQ + G LT+V+EEQLN  RT+Q++  E+ E+
Sbjct: 257 TCVMMLLAPPLGAMALVYGKKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEV 316

Query: 392 KRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAF 451
            R+   +R +F +G + A  +  FF ST LVG+ + L++L+ G+ ++  G +TIG+L++F
Sbjct: 317 HRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTNMIQSGVMTIGELSSF 376

Query: 452 MLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKT-YTPGKGEIEFK 510
           M+Y  YTG+++FGLS+FYSE+M+GAGAA+R+FEL DR P I PT+GK   +     + FK
Sbjct: 377 MMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPISLAHKPVVFK 436

Query: 511 NVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG 570
           NVSF YPTRP +QIFK LN  IKPG +VC VGPSG GKSTIA LLL YY+  SG I  D 
Sbjct: 437 NVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFDD 496

Query: 571 QDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVA--KQCFCHNF 628
           +D+   N +  RR I  VQQEP+L +GTI DNI Y +  E  + E R     +Q  C  F
Sbjct: 497 EDVRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPSEIAEREDRVARAIEQANCTKF 556

Query: 629 IVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYT 688
           +  FP    T +G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +   
Sbjct: 557 LANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPALLILDEATSALDSQSEEIVAKN 616

Query: 689 FGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADP 738
             Q    + +T +SIAHRLSTI+ S  IIVLG  GSVVE G F++L A P
Sbjct: 617 L-QKRVERGLTTISIAHRLSTIKHSTRIIVLGKHGSVVETGSFRDLIAIP 665

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
           Ashbya gossypii AFR683C
          Length = 683

 Score =  508 bits (1309), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 273/588 (46%), Positives = 366/588 (62%), Gaps = 5/588 (0%)

Query: 154 DQGESNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXXXX 213
           D  E  FK+V RLF L + + K                M IP +IG +LD  K       
Sbjct: 74  DSKEYGFKNVRRLFQLARPEAKSLAFALLLIVISGAVSMTIPSVIGKLLDISKEKEAGGD 133

Query: 214 XXXXXXXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTL 273
                   I +GLT  +F         IG  AN G         E+LVARLR+  MK  L
Sbjct: 134 GDEEQETRI-YGLTEKQFYTALGGVFVIGACANVGRIVILKVTGEKLVARLRTKTMKAAL 192

Query: 274 HQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSS 333
            QD+ F D ++VGDLISRL +D+ IVS+SITQ  SDG +++I G VG GMM  +S  L+ 
Sbjct: 193 QQDAAFLDYNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGMVGFGMMGYISAQLTG 252

Query: 334 VLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKR 393
           V++    P+VL A ++G++IR  +RELQ   G LT+V+EEQLN  RT+QS+  E++EI+R
Sbjct: 253 VMLLLAPPLVLMAMVYGRRIRNLTRELQTRVGGLTKVAEEQLNATRTIQSYCGERKEIRR 312

Query: 394 FNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFML 453
           +   +R +F VG R A  +  FF +T L+G+++ L +L+ G+ ++  G++T+G+L++FM+
Sbjct: 313 YAEEVRSVFRVGLREAVTSGAFFGTTGLMGNMALLALLLTGTSMIRSGAITVGELSSFMM 372

Query: 454 YTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKT-YTPGKGEIEFKNV 512
           Y  YTG+++FGLS+FYSE+M+GAGAASR+FEL DRVP I PT GK   +    EIEFKNV
Sbjct: 373 YAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRVPLIHPTKGKDPISLAAKEIEFKNV 432

Query: 513 SFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQD 572
            F+YP+R ++ +F  LN KI PG +VC+VGPSG GKSTI+ LLL +Y+  SG I I GQ+
Sbjct: 433 KFSYPSRSNHTVFTELNLKIIPGEHVCVVGPSGGGKSTISSLLLRFYDVDSGVITIGGQN 492

Query: 573 ITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEE--PTKEEIRTVAKQCFCHNFIV 630
           I   N +  RR + +VQQEP+L +G+I+DNI Y L       K  +    +   C  FI 
Sbjct: 493 IKDFNLRKYRRSLGIVQQEPLLFNGSIKDNICYALPPHIISDKHRVNRALEAANCTRFIS 552

Query: 631 KFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFG 690
            FP   DT +GP GT LSGGQKQRIAIARA I  P+ILILDEATSALD +SE  I     
Sbjct: 553 NFPDGLDTMVGPRGTQLSGGQKQRIAIARAFILDPSILILDEATSALDSQSEDIIAQALR 612

Query: 691 QLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADP 738
              +S  +TI SIAHR+STI  S  +IVL  +G V E G F +L   P
Sbjct: 613 ARSESGKITI-SIAHRISTIEHSNRVIVLSRNGGVSETGAFCDLINQP 659

>SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 712

 Score =  508 bits (1308), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 271/605 (44%), Positives = 376/605 (62%), Gaps = 24/605 (3%)

Query: 154 DQGESNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALK------- 206
           D   S FKD+ RLFLL K +                  M IP +IG +LDA K       
Sbjct: 96  DSKASGFKDIKRLFLLAKPETNSMILALVFILISGAVSMTIPSVIGKLLDAAKEGHLAGV 155

Query: 207 -------SVAXXXXXXXXXXXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSER 259
                    +            +++GLT  +F         +G  AN G         E+
Sbjct: 156 SASGEGVGSSDSSDNQEDSSDRLIYGLTFPQFYTALGTIFVVGAFANMGRIVLLKVTGEK 215

Query: 260 LVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGV 319
           LVARLR+  MK  L QD+ F D ++VGDLISRL +D+ IVS+S+TQ +SDG +++I G V
Sbjct: 216 LVARLRTRTMKAALQQDATFLDNNRVGDLISRLSSDASIVSKSVTQNLSDGARAVIQGAV 275

Query: 320 GIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVR 379
           G GMM  +S  L+ V+     P+ + A ++GK+IR  SR+LQ + G LT+V+EEQL+  R
Sbjct: 276 GFGMMSFISWKLTCVMTLMAPPLAVMAMVYGKKIRNLSRQLQTSVGGLTKVAEEQLSAAR 335

Query: 380 TVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVL 439
           TVQ++  E++EI+R+   +R +F++G + A  +  FF  T  VG+++ L +L+ G+ ++ 
Sbjct: 336 TVQAYGGEKQEIRRYAGEVRNVFNIGLKEALTSGVFFGVTGFVGNVALLALLLTGTSMIR 395

Query: 440 HGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKT 499
            G++T+GDL++FM+Y  YTG+++FGLS+FYSE+M+GAGAA+R+FEL DR P I PT G  
Sbjct: 396 SGAITVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTKGVD 455

Query: 500 YTPGKGE-IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHY 558
               +G+ IEF+NV+FAYPTR  N+IF  L+  I+PG +VCIVGPSG GKSTIA LLL Y
Sbjct: 456 PVTLQGKTIEFRNVAFAYPTRRENRIFDGLSLDIQPGEHVCIVGPSGGGKSTIASLLLRY 515

Query: 559 YNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRT 618
           Y+  +G+I I GQDI + N +  RR + VVQQEP+L +GTI DNITY +  E   ++ R 
Sbjct: 516 YDVDAGRIAIGGQDIRRFNLRKYRRLLGVVQQEPLLFNGTILDNITYAVPGELAGDDSRV 575

Query: 619 --VAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSA 676
                Q  C  F+  FP   +T +GP G  +SGGQKQRIA+ARA +  P +LILDEATSA
Sbjct: 576 SRAIGQANCTKFLANFPDGLETLVGPRGAQMSGGQKQRIALARAFLLDPAVLILDEATSA 635

Query: 677 LDVESEGAINYTFGQLMKSKSM---TIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKE 733
           LD +SE  +     Q ++S+S    T VSIAHRLSTI+ S  +IVL   G V E G F+E
Sbjct: 636 LDSQSEEVV----AQSLRSRSRRGKTTVSIAHRLSTIQHSSRVIVLDRHGGVGETGSFRE 691

Query: 734 LFADP 738
           L +DP
Sbjct: 692 LISDP 696

>Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188W
           (REAL)
          Length = 693

 Score =  503 bits (1295), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 267/591 (45%), Positives = 370/591 (62%), Gaps = 7/591 (1%)

Query: 152 EPDQGESNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXX 211
           + D   S FKD+ RLF+L + +                  M +P +IG +LD        
Sbjct: 77  DADSKSSGFKDIKRLFVLSRPESGYIGLALLLILISSSVSMAVPSVIGKLLDLASDDDDE 136

Query: 212 XXXXXXXXXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKH 271
                      ++GL+  +F         IG  AN           ERLVARLR+  MK 
Sbjct: 137 EDAKETKDNK-LYGLSKRQFFTALGAVFLIGAIANASRIIILKVTGERLVARLRTRTMKA 195

Query: 272 TLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDL 331
            L QD+ F D ++VGDLISRL +D+ IV++S+TQ +SDG +++I G VG GMM  LS  L
Sbjct: 196 ALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKL 255

Query: 332 SSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREI 391
           + V++    P+   A I+G++IR  SR+LQ + G LT+V+EEQLN  RT+Q++  E+ E+
Sbjct: 256 TCVMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEV 315

Query: 392 KRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAF 451
           +R+   +R +F VG + A  +  FF ST LVG+ + L++L+ G+ ++  G++T+G+LT+F
Sbjct: 316 RRYAKEVRNVFHVGLKEAVTSGLFFGSTGLVGNAAMLSLLLVGTNMIQSGAMTVGELTSF 375

Query: 452 MLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKT-YTPGKGEIEFK 510
           M+Y  YTG+++FGLS+FYSE+M+GAGAA+R+FEL DR P IRPT+GK   +     I FK
Sbjct: 376 MMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAHKPIVFK 435

Query: 511 NVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG 570
           +VSF YPTRP +QIFK LN  IKPG +VC VGPSG GKSTIA LLL YY+ ++G I    
Sbjct: 436 DVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDTSAGSIDFGD 495

Query: 571 QDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAK---QCFCHN 627
           +DI   N +  RR +  VQQEP+L +GTI DNI Y +  E  ++E R VA+   Q  C  
Sbjct: 496 EDIKNFNLRKYRRLMGYVQQEPLLFNGTILDNILYCIPPEIAEQEDR-VARAIGQANCTK 554

Query: 628 FIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 687
           F+  FP    T +G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +  
Sbjct: 555 FLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEVVAK 614

Query: 688 TFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADP 738
              + +K + +T +SIAHRLSTI+ S  +IVLG  GSVVE G F++L + P
Sbjct: 615 NLQRRVK-RGLTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFQDLISIP 664

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score =  503 bits (1295), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 269/595 (45%), Positives = 375/595 (63%), Gaps = 13/595 (2%)

Query: 154 DQGESNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXXXX 213
           D   S FKD+ RLF L + + +                M +P IIG +LDA K       
Sbjct: 88  DSKSSGFKDIQRLFSLARPELRYIALALLFILISSSVSMTVPSIIGKLLDAAKKGQKENE 147

Query: 214 XXXXXXXX---IMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMK 270
                        FGLT  +F     V   +G  AN G         ERLVARLR+  MK
Sbjct: 148 EEDSKTIVPDITFFGLTRTQFYTALGVLFLVGAIANTGRIIILKVTGERLVARLRTRTMK 207

Query: 271 HTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMD 330
             L QD+ F D ++VGDLISRL +D+ IVS+++TQ +SDG +++I G VG GMM  LS  
Sbjct: 208 AALDQDATFLDANRVGDLISRLSSDAAIVSKAVTQNVSDGTRAIIQGFVGFGMMGYLSWK 267

Query: 331 LSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQRE 390
           L+ V++  V P+ + A ++G++IR  S++LQ++ G L++V+EEQLN  +T+Q++V E+ E
Sbjct: 268 LTGVMMLMVPPLGIMALVYGRKIRNLSKQLQESVGGLSKVAEEQLNATKTIQAYVGERLE 327

Query: 391 IKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTA 450
           I R+   +R +F +G + A  +  FF ST LVG+++ +++L+ G+ ++  G+LT+G+L++
Sbjct: 328 IHRYATEVRNVFRIGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTNMIQSGTLTVGELSS 387

Query: 451 FMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLG---KTYTPGKGEI 507
           FM+Y  YTG+++FGLS+FYSE+M+GAGAASR+FEL DR P I+ T+G   KT   GK  I
Sbjct: 388 FMMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRKPLIKSTVGIDPKTLF-GK-SI 445

Query: 508 EFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQIL 567
           +F+NVSF YP+RP+++IF +LN +I PG +VCIVG SG GKSTIA LLL YY+  +G I 
Sbjct: 446 KFENVSFTYPSRPNHKIFDNLNLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSIR 505

Query: 568 IDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYG----LTEEPTKEEIRTVAKQC 623
           I   DI   + +  RR I  VQQEP L +G+I DNI Y     LT E   E ++   KQ 
Sbjct: 506 IGDNDIRNFSLRKYRRLIGTVQQEPSLFNGSILDNIIYAIPPELTSEKQHERVQLAIKQA 565

Query: 624 FCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEG 683
            C+ F+ KFP    T +GP G  LSGGQKQRIA+ARA +  P +LILDE+TSALD  SE 
Sbjct: 566 NCNIFLGKFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPTLLILDESTSALDSLSEE 625

Query: 684 AINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADP 738
            +  T  Q   ++ +T +SIAHRLSTI+ S  +IV+G  GSVVE G F  L  +P
Sbjct: 626 LVAKTL-QARSARGLTTISIAHRLSTIKHSSRVIVIGKYGSVVESGPFDRLIDNP 679

>KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 706

 Score =  502 bits (1292), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 263/588 (44%), Positives = 370/588 (62%), Gaps = 7/588 (1%)

Query: 154 DQGESNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXXXX 213
           D   S ++D+ RLFLL K + +                M +P +IG +LD  +       
Sbjct: 77  DSKASGWQDIKRLFLLAKPETRSMFIALILIILSSAVSMAVPTVIGKLLDIARE---EHE 133

Query: 214 XXXXXXXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTL 273
                   ++FGLT  +F         +G  AN G         ERLVARLR+  MK  L
Sbjct: 134 QPETEKETMIFGLTSTQFYTALGGVFVVGALANVGRIVILKVTGERLVARLRTRTMKAAL 193

Query: 274 HQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSS 333
            QD+ F D ++VGDLISRL +D+ IVS+S+TQ +SDG +++I G VG GMM  +S  L+ 
Sbjct: 194 EQDATFLDHNRVGDLISRLSSDAGIVSKSVTQNLSDGTRAVIQGFVGFGMMSFISWKLTC 253

Query: 334 VLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKR 393
           V++    P+ + A ++GK+IR  SR+LQ + G+LT+VSEEQL+  +T+Q++  E++EI R
Sbjct: 254 VMMLLAPPLGVMALVYGKRIRNLSRQLQTSVGELTKVSEEQLSATKTIQAYCGEKKEIHR 313

Query: 394 FNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFML 453
           +   +R++F VG + A  +  FF  T  VG+++ L +L+ G+ ++  G +T+GDL++FM+
Sbjct: 314 YADEVRKVFHVGLKEALTSGAFFGVTGFVGNVALLALLLTGTSMIKTGLMTVGDLSSFMM 373

Query: 454 YTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGK-TYTPGKGEIEFKNV 512
           Y  YTG+++FGLS+FYSE+M+GAGAA+R+FEL DR P I PT+GK   T     I F +V
Sbjct: 374 YAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPVTLENKSIHFNHV 433

Query: 513 SFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQD 572
            F+YPTRP + IF+ LNF ++PG +VCIVGPSG GKST+A LLL YY+  SG+I +   +
Sbjct: 434 KFSYPTRPQHHIFEDLNFTVRPGEHVCIVGPSGGGKSTVASLLLRYYDIGSGEIKLGNDN 493

Query: 573 ITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRT--VAKQCFCHNFIV 630
           I   N +  RR + VVQQEP+L SGTI DNITY + +E   +E R      Q  C  F+ 
Sbjct: 494 IRDFNLRKYRRLLGVVQQEPMLFSGTILDNITYAVPQELVNDETRISRAIGQANCTKFLA 553

Query: 631 KFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFG 690
            FP    T +GP GT LSGGQKQRIA+ARA +  P+ILILDEATSALD +SE  +  +  
Sbjct: 554 NFPDGLQTTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQ 613

Query: 691 QLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADP 738
           Q   ++  T +SIAHR+STI+ S  +IVL   G+V E G F +L A P
Sbjct: 614 Q-RSARGKTTISIAHRVSTIQHSSRVIVLNRHGTVAETGSFDKLIAIP 660

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR188W
           (MDL1)
          Length = 677

 Score =  498 bits (1281), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 264/584 (45%), Positives = 363/584 (62%), Gaps = 6/584 (1%)

Query: 158 SNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXXXXXXXX 217
           S  KDV RLF L + + K                M IP +IG +LD  +           
Sbjct: 80  SGAKDVRRLFQLARPELKSLVCALVLIVISGAVSMTIPSVIGKLLDVARE--DVEQESGD 137

Query: 218 XXXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDS 277
               +++GL   +F    S    +G  AN G         ERLVARLR+  MK  L Q+ 
Sbjct: 138 EEEAVLYGLPEKQFYLALSGIFAVGALANMGRIVVLKTTGERLVARLRTRTMKAALEQEG 197

Query: 278 EFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVC 337
            F D ++VGDLISRL +D+ IVS+SITQ  SDG +++I G VG GMM  +S  L++V+  
Sbjct: 198 AFLDSNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGAVGFGMMSYISWQLTAVMTL 257

Query: 338 FVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHS 397
              P+VL A+ +G+++R  SRELQ   G LT+V+EEQLN  RTVQ++  E+REI+R+   
Sbjct: 258 LAPPLVLMAAFYGRRVRNLSRELQTKVGGLTKVAEEQLNATRTVQAYCGERREIRRYATE 317

Query: 398 IREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEY 457
           +R +FDVG + A I+  FF +T  VG+ + L +L+ G+ ++  G +++G+L++FM+Y  Y
Sbjct: 318 VRNVFDVGLKEALISGSFFGATGFVGNATLLALLLTGTSMIKGGGISVGELSSFMMYAVY 377

Query: 458 TGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGE-IEFKNVSFAY 516
           TG+++F LS+FYSE+M+GAGAA R+FEL DR P I PT+GK      G+ I F +V+FAY
Sbjct: 378 TGSSLFNLSSFYSELMKGAGAAVRVFELNDRKPLIHPTIGKDPVSLTGKTIAFNSVNFAY 437

Query: 517 PTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKL 576
           PTRP +Q+F  ++  I PG +VCIVGPSG GKST+A LLL +Y+P SG I I G+DI   
Sbjct: 438 PTRPHHQVFAGMDLSICPGEHVCIVGPSGGGKSTVASLLLRFYDPISGSITIGGEDIRLF 497

Query: 577 NSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRT--VAKQCFCHNFIVKFPY 634
           N    RR + +VQQEPVL + +I +NITY L    TK+  R     +   C  F+  FP 
Sbjct: 498 NLSKYRRMMGIVQQEPVLFNASILENITYALPLHLTKDPARIDRALRLSNCSAFVGSFPE 557

Query: 635 TYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMK 694
              T +GP GT LSGGQKQR+A+ARA ++ P ILILDEATSALD +SE  +  T  Q  +
Sbjct: 558 GLQTAVGPRGTQLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIVASTLLQRCQ 617

Query: 695 SKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADP 738
              +TI SIAHR STI+ S  +IVL   G V+E G +++L  DP
Sbjct: 618 EAKITI-SIAHRKSTIQHSTRVIVLDKLGHVLETGTYQQLIGDP 660

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score =  491 bits (1263), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 263/601 (43%), Positives = 369/601 (61%), Gaps = 20/601 (3%)

Query: 154 DQGESNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXXXX 213
           ++  S F+D+ RL  L + +                  M++P +IG +LD  KS +    
Sbjct: 84  EKNSSGFRDITRLLGLARPEVWYIMGALCLIVISSTVSMLLPSVIGKLLDLAKSSSPSEN 143

Query: 214 XXXXXXXX----------IMFGLTLYEF---LGGFSVALFIGCAANYGXXXXXXXXSERL 260
                              ++G T  +F   +GG  VA   G  AN G         ERL
Sbjct: 144 EKQESGDGDDKDKDKEEGTIYGFTPKQFCVIMGGIFVA---GAFANCGRIIILKVTGERL 200

Query: 261 VARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVG 320
           VARLR+  MK  L QDS F D ++VGDLISRL +DS IV++S+TQ +SDG +++I G VG
Sbjct: 201 VARLRTRTMKAALDQDSAFLDRNRVGDLISRLSSDSSIVAKSLTQNVSDGTRAVIQGFVG 260

Query: 321 IGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRT 380
            GMM  +S  L+ V+   + P+   A I+GK+IR  S++LQ + G LT+V+EEQL   +T
Sbjct: 261 FGMMTYISWQLTCVMGLMLPPIGAMAIIYGKKIRNLSKQLQTSVGGLTKVAEEQLGATKT 320

Query: 381 VQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLH 440
           +QS+V E++EI+R+   +R++FD+G + A  +  FF ST  VG++S L +L+ G+ ++  
Sbjct: 321 IQSYVGEKKEIRRYAKEVRQVFDIGLKEALTSGMFFGSTGFVGNISLLALLMSGASMIQS 380

Query: 441 GSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTY 500
           G +T+GDL++FM+Y  YTG ++FGLS FYSE+M+GAGAA+R+FEL DR P I PTLGK  
Sbjct: 381 GLITVGDLSSFMMYAVYTGGSMFGLSNFYSELMKGAGAAARVFELNDRKPAIAPTLGKGP 440

Query: 501 TPGKG-EIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYY 559
           T  +   I FK+VSF YPTR + +IF  LN  I+PG ++CI GPSG GKSTIA LL+ YY
Sbjct: 441 TSIRNLPISFKDVSFTYPTRLNKKIFNHLNLTIQPGEHICIAGPSGSGKSTIASLLVRYY 500

Query: 560 NPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTV 619
           +   G I I   D+   N +  RR I VV QEPVL +GTI +NI Y +     ++E R  
Sbjct: 501 DVDQGGISIGDTDLRTFNLRKYRRLIGVVHQEPVLFNGTILENILYAVPPSVAQDERRVS 560

Query: 620 AK--QCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSAL 677
           A   +  C  F+  FP   +T +GP G  LSGGQKQR+A+ARA +  P +L+LDEATSAL
Sbjct: 561 AAIGKANCSKFLSNFPDGLETLVGPRGAQLSGGQKQRVALARAFLLDPALLVLDEATSAL 620

Query: 678 DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFAD 737
           D +SE  +  T  + ++ + +T +SIAHR+STI  S  ++VLG DG VVE G F+EL   
Sbjct: 621 DSQSEEIVARTLQERVR-RGLTTISIAHRISTIAHSTRVVVLGRDGFVVESGPFQELIDR 679

Query: 738 P 738
           P
Sbjct: 680 P 680

>Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188W
           (MDL1) - ATP-binding cassette (ABC) transporter family
           member [contig 118] FULL
          Length = 706

 Score =  482 bits (1240), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 262/597 (43%), Positives = 370/597 (61%), Gaps = 14/597 (2%)

Query: 154 DQGESNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXXXX 213
           +   S++KD+ RLF L + + +                M++P +IG ++DA K       
Sbjct: 78  EHNSSSWKDIKRLFQLARPESRSMFFALALIIISSSVSMLVPGVIGKLMDAAKDDQQASK 137

Query: 214 XXXXXXXXI--------MFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLR 265
                            +FGLT+ +F G       +G AAN G         E+LVARLR
Sbjct: 138 LVENDSDAAAPDADGRQIFGLTMPQFYGVLFSVFVVGAAANMGRIVILKVTGEKLVARLR 197

Query: 266 SVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMML 325
           +  +K +L QD+ F D +KVGDLISRL +D+ IVS+S+TQ +SDG +SLI G VG GMM 
Sbjct: 198 TRTLKASLQQDASFLDNNKVGDLISRLSSDASIVSKSLTQNMSDGTRSLIQGFVGFGMMS 257

Query: 326 ELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFV 385
            +S  L+ V++    P+   A I+GK+IR  SR LQ + G LT+ +EEQL+  RT+Q++ 
Sbjct: 258 YISWKLTCVMMLLAPPLAAMALIYGKRIRNLSRTLQASVGGLTKAAEEQLSATRTIQAYG 317

Query: 386 AEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTI 445
            E+  I ++   +R+++ VG + A  +  FF  T LVG+++ L +L+ G+ ++  G++T+
Sbjct: 318 GEKHAIHQYAKEVRQVYQVGLKEALTSGAFFGLTGLVGNVAVLALLLTGTSMIRTGAMTL 377

Query: 446 GDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKG 505
           GDL++FM+Y  YTG+++FG+S+FYSE+M+GAGAA+R+FEL DR P I PT G       G
Sbjct: 378 GDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELNDRRPAIHPTRGIDPVSLAG 437

Query: 506 E-IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG 564
           + +EF+NV FAYPTR  + IF++L F+I  G +VCIVGPSG GKST+A LLL +Y+  +G
Sbjct: 438 KPVEFQNVKFAYPTRHQHTIFENLTFRINAGEHVCIVGPSGGGKSTVASLLLRFYDVDTG 497

Query: 565 QILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAK--- 621
            I I GQ I   N +  RR + VVQQEP+L +GTI DNI Y + +    +E R VA+   
Sbjct: 498 AITIGGQSIASFNLRKYRRMLGVVQQEPMLFNGTILDNIVYSVPQSLLNDENR-VARAIG 556

Query: 622 QCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVES 681
           Q  C  F+  FP    T +GP GT LSGGQKQRIA+ARA +  P++LILDEATSALD  S
Sbjct: 557 QANCSAFLSSFPDGLQTLVGPRGTQLSGGQKQRIALARAFLLDPDLLILDEATSALDSRS 616

Query: 682 EGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADP 738
           E  +         ++  T +SIAHR+STI+ S  +IVLG  G VVE G F EL +DP
Sbjct: 617 EEVVARALYS-RSTRGKTTISIAHRVSTIQHSSRVIVLGRSGYVVETGTFDELISDP 672

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score =  482 bits (1241), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 260/605 (42%), Positives = 373/605 (61%), Gaps = 22/605 (3%)

Query: 154 DQGESNFKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXXX- 212
           +Q  S++KD+ RLF L + + K                M++P +IG ++D  K       
Sbjct: 78  EQNSSSWKDIKRLFQLARPESKSMFFALVLIILSSSVSMLVPGVIGKLMDVAKEDGTSSS 137

Query: 213 ----------------XXXXXXXXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXX 256
                                    ++ GLTL +F GG      +G AAN G        
Sbjct: 138 EADGKRGDATDKTDGSTAADTDSEKLILGLTLPQFYGGLFSLFVVGAAANMGRIVILKVT 197

Query: 257 SERLVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLIC 316
            E+LVARLR+  +K  L QD+ F D +KVGDLISRL +D+ IVS+S+TQ +SDG +SLI 
Sbjct: 198 GEKLVARLRTRTLKAALQQDASFLDNNKVGDLISRLSSDASIVSKSLTQNMSDGTRSLIQ 257

Query: 317 GGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLN 376
           G VG GMM  +S  L+ V++    P+ + A ++G++IR  SR LQ + G LT+ +EEQL+
Sbjct: 258 GFVGFGMMSYISWKLTCVMMLLAPPLAVMALVYGRKIRNLSRTLQASVGGLTKAAEEQLS 317

Query: 377 GVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSY 436
             RT+Q++  E++ I+ +   +R+++ VG + A  +  FF  T LVG+ + L +L+ G+ 
Sbjct: 318 ATRTIQAYGGEKQAIRHYAKEVRQVYQVGLKEALTSGGFFGLTGLVGNSAVLALLLTGTS 377

Query: 437 LVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTL 496
           ++  G++T+GDL++FM+Y  YTG+++FG+S+FYSE+M+GAGAA+R+FEL DR P I PT 
Sbjct: 378 MISTGAMTVGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELNDRKPAIHPTK 437

Query: 497 GKT-YTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLL 555
           G+   +  +  +EFK V FAYPTR  + IF+ L+ +I PG +VCIVGPSG GKST+A LL
Sbjct: 438 GRDPVSLARKPVEFKKVHFAYPTRRQHVIFEDLSLRIDPGEHVCIVGPSGGGKSTVASLL 497

Query: 556 LHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEE 615
           L +Y+  +G ILI GQ+I   N +  RR + +VQQEP+L +GTI +NI Y + +    EE
Sbjct: 498 LRFYDVDAGAILIGGQNIADFNLRKYRRLVGIVQQEPMLFNGTILENILYTVPQRLLNEE 557

Query: 616 IRTVAK---QCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDE 672
              VA+   Q  C  F+  FP    T +GP GT LSGGQKQRIA+ARA +  P++LILDE
Sbjct: 558 DGRVARAIGQANCSAFLSSFPDGLQTMVGPRGTQLSGGQKQRIALARAFLLDPDLLILDE 617

Query: 673 ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFK 732
           ATSALD  SE  I  T      ++  T +SIAHR+STI+ S  +IVLG +G VVE G F 
Sbjct: 618 ATSALDSRSEEVIARTL-HSRTTRGKTTISIAHRVSTIQHSTRVIVLGRNGGVVETGTFD 676

Query: 733 ELFAD 737
           EL ++
Sbjct: 677 ELASN 681

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
           YLR188W
          Length = 707

 Score =  472 bits (1214), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 251/595 (42%), Positives = 365/595 (61%), Gaps = 20/595 (3%)

Query: 161 KDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXXXXX------ 214
           +D++ LF L K +                  M++P +IG +LD    +            
Sbjct: 97  EDIYNLFKLAKPEKWYIIASMGLIFITSAVSMLVPSVIGKLLDISTGIEFASNKDENDES 156

Query: 215 ----------XXXXXXXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARL 264
                            +++G T   F  G  V   +G  AN G         ER+VARL
Sbjct: 157 SKEDKNENENENENKQTLIYGYTPLVFFSGLGVIFVVGAIANTGRIIILKLTGERIVARL 216

Query: 265 RSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMM 324
           R+  MK+ L QD +F D +KVGDLISRL +DS IVS ++T+ +SDG +++I G VG+GMM
Sbjct: 217 RTRTMKNILKQDGKFQDSNKVGDLISRLSSDSSIVSNAVTRNVSDGARAVIQGCVGVGMM 276

Query: 325 LELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSF 384
             +S+ LS V++  V P+ + A I+G++IR  S++LQ++ G LT++SEEQLNG RT+QS+
Sbjct: 277 SFISLKLSGVMLFMVPPIGVLAMIYGRKIRNISKKLQESVGSLTKISEEQLNGTRTIQSY 336

Query: 385 VAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLT 444
           V E+ EI ++   +R+++ VG   A  +  FF  T L+G+ + L++L  G  ++ +G+L+
Sbjct: 337 VGEKLEIHKYAKEVRKVYHVGLNEAVASGLFFGVTGLIGNGAMLSLLYVGCNMISNGTLS 396

Query: 445 IGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLG-KTYTPG 503
           IG L++FM+Y  YTG+++FGLS+FYSEIM+G+GAASR+FE+   VP I  T G    +  
Sbjct: 397 IGGLSSFMMYAVYTGSSLFGLSSFYSEIMKGSGAASRIFEINKYVPDINATKGIDPISFQ 456

Query: 504 KGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTS 563
              IEF+++ FAYPTR  + IF+ LN KI PG +VCI+GPSG GKSTI+ LLL YY+P +
Sbjct: 457 DKPIEFEHIKFAYPTRSGHMIFQDLNIKINPGEHVCIIGPSGSGKSTISSLLLRYYDPLA 516

Query: 564 GQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPT--KEEIRTVAK 621
           G I I G+DI + + +  R+ + VV QEPVL +GTI +NI Y + EE    KE +    +
Sbjct: 517 GTISIGGKDIKEYSLRKYRKLMGVVHQEPVLFNGTILENILYNVPEEIANDKERLSNAIE 576

Query: 622 QCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVES 681
              C+ F+   P   +T +GP GT LSGGQKQR+A+ARA + +P +L+LDEATSALD  S
Sbjct: 577 SSNCNKFLNTLPLGLETPVGPRGTQLSGGQKQRVALARAFLLEPTLLVLDEATSALDPRS 636

Query: 682 EGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFA 736
           E  +  T  Q   +K  T +SIAHR+STI+ S  ++VL   G VVE G ++EL  
Sbjct: 637 ESIVAQTLKQRC-AKGFTTISIAHRVSTIKHSSRVVVLDKVGHVVETGPYEELLG 690

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score =  447 bits (1150), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 247/579 (42%), Positives = 352/579 (60%), Gaps = 25/579 (4%)

Query: 160 FKDVFRLFLLVKKDYKXXXXXXXXXXXXXXXGMMIPKIIGLILDALKSVAXXXXXXXXXX 219
           +  V +L  L K + K                M +P +IG ++D   +            
Sbjct: 31  WTQVKQLLRLAKPERKYIAGAVGLIAVSSAVSMSLPSVIGTLIDHASTPDAP-------- 82

Query: 220 XXIMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEF 279
              ++GLT  +FL        +G  AN G         E+LVARLR+  MK  L QD+ F
Sbjct: 83  ---IYGLTRNQFLLALGSVFVVGAIANSGRIIILKITGEKLVARLRTKTMKSMLSQDATF 139

Query: 280 FDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFV 339
            D H+VGDLISRL +D+ IVS+S+T  +SDG ++ + G VGIGMM  +S+ L++V+   V
Sbjct: 140 LDKHRVGDLISRLSSDASIVSKSVTSNLSDGCRATLQGVVGIGMMTYISLKLTTVMTMMV 199

Query: 340 IPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIR 399
            P+ + A ++G +I+  SR+LQD  GQL++ SEEQLN ++TVQ++  E++E++R+++ +R
Sbjct: 200 PPLGILAMLYGGKIKKISRQLQDKVGQLSKTSEEQLNSLKTVQAYAGERKELQRYSNEVR 259

Query: 400 EIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTG 459
            +F++G + A  +A FF ST L+G+++ + +L+ G+      S+T+G+L++FM+Y  YTG
Sbjct: 260 SVFNIGVKEAVASALFFGSTGLIGNIAMIGLLLVGTA---DSSITLGELSSFMMYGVYTG 316

Query: 460 NAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKG----EIEFKNVSFA 515
           +++FGL+ FYSE+M+G GAA R+ EL +    I PT  K  +P K      I F NVSFA
Sbjct: 317 SSVFGLTGFYSELMKGCGAAERVLELQNMKTKISPT--KGISPPKTLKGLPITFNNVSFA 374

Query: 516 YPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITK 575
           Y    S  +   +NF+I PG +VC VG SG GKSTI+ LLL YY   SG I I   DI+ 
Sbjct: 375 YSNGKS--VLSEMNFQIHPGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIGNYDISA 432

Query: 576 LNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYT 635
            N +  RR + VVQQEP+L +GTI DNITYGL  + +  ++    K   C  FI +    
Sbjct: 433 FNLRKYRRMLGVVQQEPLLFNGTILDNITYGL-HDKSLTDLNMALKAANCDQFIKESHMG 491

Query: 636 YDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKS 695
            DT +GP G  LSGGQ+QRIA+AR  ++ P+ILILDEATSALD +SE  IN    Q  + 
Sbjct: 492 LDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDIINKEL-QRRQE 550

Query: 696 KSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
             MT +SIAHRLSTIR S  +IV+  DG VVE G F +L
Sbjct: 551 AGMTTISIAHRLSTIRHSSRVIVI-EDGRVVESGSFDQL 588

>Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa]
           {ON} YMR301C (ATM1) - mitochondrial ABC transporter
           protein [contig 73] FULL
          Length = 719

 Score =  201 bits (511), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 141/386 (36%), Positives = 199/386 (51%), Gaps = 22/386 (5%)

Query: 363 ATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFD----VGKRAAFINAK---F 415
           A  +   V+ + L     V+ F  EQ    +++ S+ +  D    V +  AF+N+     
Sbjct: 317 ADNKAASVAVDSLINFEAVKYFNNEQYLANKYHKSLAQYRDSQIKVAQSLAFLNSGQNLI 376

Query: 416 FTSTSLVGDLSFLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQ 474
           FTS         LT ++Y G   V+ G L++GDL             +  L + Y E+ Q
Sbjct: 377 FTSA--------LTAMMYMGCTGVMSGELSVGDLVLINQLVFQLSVPLNFLGSVYRELKQ 428

Query: 475 GAGAASRLFELTDRVPTIRPTLGKTYTPGK--GEIEFKNVSFAYPTRPSNQIFKSLNFKI 532
                  LF+L     +I+ +      P     EI FKNVSF Y   P   I K+ +F I
Sbjct: 429 SLIDMESLFQLQRNKVSIQNSKKPLMLPPNVPSEIVFKNVSFGYD--PDRLILKNASFTI 486

Query: 533 KPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEP 592
             GS   IVGPSG GKSTI  L+  +Y+P  G+IL+DG+D+ +L+ +SLRR I VV Q+ 
Sbjct: 487 PTGSKTAIVGPSGSGKSTILKLVFRFYDPIEGRILLDGKDVRELDIESLRRSIGVVPQDT 546

Query: 593 VLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQK 652
            L + +I DN+ +G  +  T +EI     +      I + P   DT +G  G ++SGG+K
Sbjct: 547 PLFNESIWDNVKFGRIDA-TDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEK 605

Query: 653 QRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRR 712
           QR+AIAR L+K   I+  DEATSALD  +E A+  T  +   + S T V IAHRL TI  
Sbjct: 606 QRLAIARVLLKDAPIMFFDEATSALDTHTEQALLRTIKENFTTGSKTSVYIAHRLRTIAD 665

Query: 713 SENIIVLGNDGSVVEMGKFKELFADP 738
           ++ IIVL   G V E GK  EL A P
Sbjct: 666 ADKIIVL-EHGRVKEEGKHAELLATP 690

>KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 720

 Score =  201 bits (510), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 141/394 (35%), Positives = 205/394 (52%), Gaps = 28/394 (7%)

Query: 358 RELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFD----VGKRAAFINA 413
           R    A  +   V+ + L     V+ F  E+    +++ S+ +  D    V +  AF+NA
Sbjct: 305 RSANRADNKAASVALDSLINFEAVKYFNNEEYLANKYHQSLSKYRDSQIKVAQSLAFLNA 364

Query: 414 K---FFTSTSLVGDLSFLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFY 469
                FTS         LT ++Y G+  V+ G+LT+GDL             +  L + Y
Sbjct: 365 GQNFIFTSA--------LTAMMYMGASGVMEGALTVGDLVLINQLVFQLSVPLNFLGSVY 416

Query: 470 SEIMQGAGAASRLFELTDRVP-----TIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQI 524
            E+ Q       LF+L  + P     T RP +   + P   EI+F+NV+F Y  +P   I
Sbjct: 417 RELKQSLIDMESLFKL-QKNPILIKNTERPLMLPEHLPC--EIKFENVTFGY--QPDRNI 471

Query: 525 FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQ 584
            K+  F I PG    IVGPSG GKSTI  L+  +Y+P  G+IL+DG+DI +L+   LRR 
Sbjct: 472 LKNATFTIAPGKKTAIVGPSGSGKSTILRLVFRFYDPQQGRILLDGKDIRELDLDELRRI 531

Query: 585 IAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHG 644
           + VV Q+  L + TI +N+ +G     T  EI T  ++    + I K P   +T +G  G
Sbjct: 532 VGVVPQDTPLFNDTIWENVKFGRI-NATDNEIVTAIEKAQLSDLIHKLPKGTETIVGERG 590

Query: 645 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 704
            ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E ++  T  +     + T V IA
Sbjct: 591 LMISGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQSLLKTIKENFSDVAKTSVYIA 650

Query: 705 HRLSTIRRSENIIVLGNDGSVVEMGKFKELFADP 738
           HRL TI  ++ IIVL N G+V E G    L A+P
Sbjct: 651 HRLRTIADADKIIVLEN-GAVREEGTHNALLANP 683

>Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {ON}
           YMR301C (REAL)
          Length = 691

 Score =  199 bits (507), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 138/389 (35%), Positives = 202/389 (51%), Gaps = 18/389 (4%)

Query: 358 RELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFD----VGKRAAFINA 413
           R+   A  +   V+ + L     V+ F  E+    ++N S+    D    V +  AF+N 
Sbjct: 286 RDANRADNKAASVALDSLINFEAVKYFNNEKYLSSKYNSSLMNYRDSQIKVSQSLAFLN- 344

Query: 414 KFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIM 473
              +  +L+   +   ++  G   V+ G LT+GDL             +  L + Y ++ 
Sbjct: 345 ---SGQNLIFTTALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRDLK 401

Query: 474 QGAGAASRLFELTDRVPTI----RPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLN 529
           Q       LF+L      I    RP +   + P   EI F+NV+F Y   P  +I K+ +
Sbjct: 402 QSLIDMETLFKLRKNEVKIKSVERPLMLPEHVPY--EITFENVTFGY--HPDRKILKNAS 457

Query: 530 FKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQ 589
           F I  G    IVG SG GKSTI  L+  +Y+P SG+ILI+G+DI + +  +LRR I VV 
Sbjct: 458 FTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRRVIGVVP 517

Query: 590 QEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSG 649
           Q+  L + TI +N+ +G  +  T EE++T  ++      I K P  ++T +G  G ++SG
Sbjct: 518 QDTPLFNDTIWENVKFGRIDA-TDEEVKTAVQKAQLAPLIKKLPQGFETIVGERGLMISG 576

Query: 650 GQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLST 709
           G+KQR+AIAR L+K   I+  DEATSALD  +E A+  T      S S T V IAHRL T
Sbjct: 577 GEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRT 636

Query: 710 IRRSENIIVLGNDGSVVEMGKFKELFADP 738
           I  ++ IIVL N G+V E GK  EL A P
Sbjct: 637 IADADKIIVLDN-GTVKEDGKHIELLATP 664

>Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {ON}
           YMR301C (REAL)
          Length = 687

 Score =  198 bits (504), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 138/389 (35%), Positives = 202/389 (51%), Gaps = 18/389 (4%)

Query: 358 RELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFD----VGKRAAFINA 413
           R+   A  +   V+ + L     V+ F  E+    ++N S+    D    V +  AF+N 
Sbjct: 285 RDANKADNKAASVALDSLINFEAVKYFNNEKYLSDKYNSSLISYRDSQIKVSQSLAFLN- 343

Query: 414 KFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIM 473
              +  +L+   +   ++  G   V+ G+LT+GDL             +  L + Y ++ 
Sbjct: 344 ---SGQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLK 400

Query: 474 QGAGAASRLFELTDRVPTI----RPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLN 529
           Q       LF+L      I    RP +   + P   +I F+NV+F Y   P  +I K+ +
Sbjct: 401 QSLIDMETLFKLRRNEVKIKNAERPLMLPEHVPY--DITFENVTFGY--HPDRKILKNAS 456

Query: 530 FKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQ 589
           F I  G    IVG SG GKSTI  L+  +Y+P SG+ILI+G+DI + +  +LR+ I VV 
Sbjct: 457 FTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIREYDINALRKVIGVVP 516

Query: 590 QEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSG 649
           Q+  L + TI +N+ +G  +  T EE+ TV ++      I K P  +DT +G  G ++SG
Sbjct: 517 QDTPLFNDTIWENVKFGRIDA-TDEEVMTVVEKAQLAPLIKKLPQGFDTIVGERGLMISG 575

Query: 650 GQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLST 709
           G+KQR+AIAR L+K   I+  DEATSALD  +E A+  T      S S T V IAHRL T
Sbjct: 576 GEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLRTIRSNFTSGSRTSVYIAHRLRT 635

Query: 710 IRRSENIIVLGNDGSVVEMGKFKELFADP 738
           I  ++ IIVL N G V E GK  EL A P
Sbjct: 636 IADADKIIVLDN-GRVREEGKHLELLATP 663

>Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {ON}
           YMR301C (REAL)
          Length = 693

 Score =  198 bits (504), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 143/393 (36%), Positives = 203/393 (51%), Gaps = 26/393 (6%)

Query: 358 RELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFD----VGKRAAFINA 413
           R+   A  +   V+ + L     V+ F  E+    ++N S+    D    V +  AF+N+
Sbjct: 288 RDANRADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLINYRDSQIKVSQSLAFLNS 347

Query: 414 K---FFTSTSLVGDLSFLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFY 469
                FTS         LT ++Y G   V+ G LT+GDL             +  L + Y
Sbjct: 348 GQNLIFTSA--------LTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVY 399

Query: 470 SEIMQGAGAASRLFELTDRVPTI----RPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIF 525
            E+ Q       LF+L      I    RP +   + P   +I F+NV+F Y   P  +I 
Sbjct: 400 RELKQSLIDMEALFKLRKNEIKIKNAERPLMLPEHVPY--DITFQNVTFGY--HPDRKIL 455

Query: 526 KSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQI 585
           K+ +F I  GS   IVG SG GKSTI  L+  +Y+P SG+ILI+G+DI + +  +LR+ I
Sbjct: 456 KNASFTIPAGSKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVI 515

Query: 586 AVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGT 645
            VV Q+  L + TI +N+ +G  +  T EE+ TV ++      I K P  ++T +G  G 
Sbjct: 516 GVVPQDTPLFNDTIWENVKFGRIDA-TDEEVNTVVEKAQLAPLIKKLPQGFNTIVGERGL 574

Query: 646 LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
           ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T      S S T V IAH
Sbjct: 575 MISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAH 634

Query: 706 RLSTIRRSENIIVLGNDGSVVEMGKFKELFADP 738
           RL TI  ++ IIV  N G V E GK  EL A P
Sbjct: 635 RLRTIADADKIIVFDN-GKVREEGKHLELLATP 666

>KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 694

 Score =  197 bits (502), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 138/388 (35%), Positives = 202/388 (52%), Gaps = 26/388 (6%)

Query: 363 ATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFD----VGKRAAFINAK---F 415
           A  +   V+ + L     V+ F  EQ    ++++S+ +  D    V +  AF+NA     
Sbjct: 289 ADNKAATVAVDSLINFEAVKYFNNEQFLANKYHNSLAQYRDSQIKVAQSLAFLNAGQNFI 348

Query: 416 FTSTSLVGDLSFLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQ 474
           FTS         LT ++Y G   V+ G+L++GDL             +  L + Y E+ Q
Sbjct: 349 FTSA--------LTAMMYMGCTGVISGTLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQ 400

Query: 475 GAGAASRLFELTDRVPTI----RPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNF 530
                  LF+L      I    +P +  +  P K  I F+NVSF Y   P   I K+ +F
Sbjct: 401 SLIDMESLFQLQRNKVKIQNKEKPLMLSSQRPSK--IVFENVSFGYD--PDRMILKNSSF 456

Query: 531 KIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQ 590
            +  G    IVGPSG GKSTI  L+  +Y+P  G+IL+DG+D+ +L+ +SLRR I VV Q
Sbjct: 457 TMPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILVDGKDVRELDIESLRRAIGVVPQ 516

Query: 591 EPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGG 650
           +  L + +I +N+ +G     + EEIR   ++    + + + P   DT +G  G ++SGG
Sbjct: 517 DTPLFNDSIWENVRFGKISA-SDEEIRLAVEKAQLESLVDQLPKGRDTIVGERGLMISGG 575

Query: 651 QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI 710
           +KQR+AIAR L+K   I+  DEATSALD  +E A+  T      + S T V IAHRL TI
Sbjct: 576 EKQRLAIARVLLKDAPIMFFDEATSALDTHTEQALLRTIKDNFPTGSKTSVYIAHRLRTI 635

Query: 711 RRSENIIVLGNDGSVVEMGKFKELFADP 738
             ++ IIV+   G V E GK  EL A P
Sbjct: 636 ADADKIIVI-QQGQVKEEGKHAELLAKP 662

>YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON}
           ATM1Mitochondrial inner membrane ATP-binding cassette
           (ABC) transporter, exports mitochondrially synthesized
           precursors of iron-sulfur (Fe/S) clusters to the cytosol
          Length = 690

 Score =  196 bits (498), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 138/389 (35%), Positives = 201/389 (51%), Gaps = 18/389 (4%)

Query: 358 RELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFD----VGKRAAFINA 413
           R+   A  +   V+ + L     V+ F  E+    ++N S+    D    V +  AF+N 
Sbjct: 285 RDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLMNYRDSQIKVSQSLAFLN- 343

Query: 414 KFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIM 473
              +  +L+   +   ++  G   V+ G+LT+GDL             +  L + Y ++ 
Sbjct: 344 ---SGQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLK 400

Query: 474 QGAGAASRLFELTDRVPTI----RPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLN 529
           Q       LF+L      I    RP +     P   +I F+NV+F Y   P  +I K+ +
Sbjct: 401 QSLIDMETLFKLRKNEVKIKNAERPLMLPENVPY--DITFENVTFGY--HPDRKILKNAS 456

Query: 530 FKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQ 589
           F I  G    IVG SG GKSTI  L+  +Y+P SG+ILI+G+DI + +  +LR+ I VV 
Sbjct: 457 FTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVP 516

Query: 590 QEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSG 649
           Q+  L + TI +N+ +G  +  T EE+ TV ++      I K P  +DT +G  G ++SG
Sbjct: 517 QDTPLFNDTIWENVKFGRID-ATDEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISG 575

Query: 650 GQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLST 709
           G+KQR+AIAR L+K   I+  DEATSALD  +E A+  T      S S T V IAHRL T
Sbjct: 576 GEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRT 635

Query: 710 IRRSENIIVLGNDGSVVEMGKFKELFADP 738
           I  ++ IIVL N G V E GK  EL A P
Sbjct: 636 IADADKIIVLDN-GRVREEGKHLELLAMP 663

>SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of
           iron-sulfur (Fe/S) clusters to the cytosol member of the
           ATP-binding cassette (ABC) transporter family
          Length = 700

 Score =  195 bits (496), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 137/392 (34%), Positives = 199/392 (50%), Gaps = 22/392 (5%)

Query: 358 RELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREI----FDVGKRAAFINA 413
           R    A  +   V+ + L     V+ F  E+    ++++S+         V +  AF+N+
Sbjct: 292 RSANRADNKAASVALDSLINFEAVKYFNNERYLADKYHNSLTNYTNSQIKVAQSLAFLNS 351

Query: 414 K---FFTSTSLVGDLSFLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFY 469
                FTS         LT ++Y G   V+ G L++GDL             +  L + Y
Sbjct: 352 GQNLIFTSA--------LTAMMYMGCTGVMSGDLSVGDLVLINQLVFQLSVPLNFLGSVY 403

Query: 470 SEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKG--EIEFKNVSFAYPTRPSNQIFKS 527
            E+ Q       LF+L      I+ +      P     EI+F+NV+F Y   P  +I ++
Sbjct: 404 RELKQSLIDMESLFKLQKNKVNIQNSKTPLMLPKDKPCEIKFENVTFGY--HPDRKILEN 461

Query: 528 LNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAV 587
            NF +  G    IVGPSG GKSTI  L+  +Y+P  G+ILIDG+DI +L+ KSLRR I V
Sbjct: 462 ANFTLPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILIDGKDIRELDLKSLRRAIGV 521

Query: 588 VQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLL 647
           V Q+  L + TI +N+ +G     T ++IR    +      I   P   +T +G  G ++
Sbjct: 522 VPQDTPLFNDTIWENVKFGKITA-TDDDIRKAIDKAQLAPLIHSLPQGSETIVGERGLMI 580

Query: 648 SGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRL 707
           SGG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T  +     S T + IAHRL
Sbjct: 581 SGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQALLRTIKENFAGNSRTSIYIAHRL 640

Query: 708 STIRRSENIIVLGNDGSVVEMGKFKELFADPT 739
            TI  ++ I+VL N G V E GK  EL + PT
Sbjct: 641 RTIADADKIVVLEN-GRVKEEGKHAELLSKPT 671

>TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1257

 Score =  198 bits (503), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 151/494 (30%), Positives = 244/494 (49%), Gaps = 26/494 (5%)

Query: 257  SERLVARLRSVVMKHTLHQDSEFF--DVHKVGDLISRLGADSYIVSRSITQKISDGVKSL 314
            SE  + +LR+ VM+    ++ ++F  + HK  ++ + L  D   +    +  +       
Sbjct: 761  SEYWILQLRNQVMQRISFEELDWFQRERHKASEVSALLLNDLRDLRALASDFLIAVSSFA 820

Query: 315  ICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQ 374
            +   VGI   L +   LS V +     +V+ ++++G  ++    + + A   L  +  E 
Sbjct: 821  VVSSVGIIWALIIGWKLSLVCISMFPLIVIFSAVYGMALQRQETQYKSAVVDLENLLYEV 880

Query: 375  LNGVRTVQSFVAEQ---REIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVL 431
              G++T++    E    R+ KR    +R I    +RA           +L   +  + + 
Sbjct: 881  ATGIKTIRRLQLETNFLRQYKRLESHMRVI--ASRRAITTGLGVAVIEALAMSIQAI-LF 937

Query: 432  VYGSYLVLHGSLTIGDL---TAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTD- 487
             Y   LV+ G  T   +      +L+T  T N    L +   +I +G  AA+R+ ++ D 
Sbjct: 938  YYALKLVIDGQYTTKKMFETLTLLLFTIMTCNI---LISQVPDISRGQRAANRILQMLDE 994

Query: 488  RVPTIRP------TLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIV 541
            ++   +P      T   + +     I  +NV+FAYP+ PS  IF SL  ++  G    +V
Sbjct: 995  KLEREKPHQEKKQTTSGSVSESSAVISLQNVTFAYPSAPSIHIFDSLYLELPIGRTFALV 1054

Query: 542  GPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRD 601
            G SG GKST+  LL   Y PTSG +L++ +D+ + N + LRRQ++VV+Q P + SGT+R+
Sbjct: 1055 GQSGSGKSTLVTLLTQLYRPTSGTVLVENKDVNEWNIRDLRRQMSVVEQTPTIFSGTVRE 1114

Query: 602  NITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARAL 661
            N+ YGL  +P + E+  V +    H+FI K P   DT I     LLSGGQ QR+ IARA+
Sbjct: 1115 NLLYGLHHDPLEVEMYDVLRYVGIHDFISKLPLGLDTTIDID--LLSGGQLQRLCIARAI 1172

Query: 662  IKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGN 721
            +K+P ILILDE TSALD  S   IN    +     +   +SI H +  ++  + II L N
Sbjct: 1173 LKRPKILILDECTSALDPFSSHVINNIVRR--GCPAPLTISITHNVDMMKACDEIIFLKN 1230

Query: 722  DGSVVEMGKFKELF 735
             G V   G F  L 
Sbjct: 1231 -GRVAGTGSFDALL 1243

 Score =  138 bits (347), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 128/441 (29%), Positives = 221/441 (50%), Gaps = 22/441 (4%)

Query: 312 KSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVS 371
           +SL+     IG     S  L+ V +C    +++    F ++++  +    + T + +++ 
Sbjct: 142 RSLVTIIALIGTSFYASWSLTLVTLCSAPLIIMCGWFFSRKVQRYADLENEQTSKASQLL 201

Query: 372 EEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVL 431
           +  +   + ++    E REIK F + ++   +      F+    ++S +L   L FL++ 
Sbjct: 202 DWSMTAAQFIRLSGTELREIKSFKNCVQNCTN-----NFVKMCQYSSINL-ATLKFLSLA 255

Query: 432 VY------GSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRL--F 483
           ++      GS ++  G + IGD+          G+ I G       I +G+ A + +  F
Sbjct: 256 MFVQAFWFGSTMIRKGKMNIGDVITCFHSCILLGSTISGTLQQLVIIQKGSVAVNIVSKF 315

Query: 484 ELTDRVPT--IRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIV 541
              D+  T  IR      +   KG+I F+NV F+YP+RP + + +S++   + G    ++
Sbjct: 316 LADDKTATTDIRRWQDVPFPELKGDIRFQNVEFSYPSRPDHNVLRSISLNFRAGKTTFLL 375

Query: 542 GPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRD 601
           G SG GKS+++ LLL +Y   +G I +DG++I  ++   L + I VV+Q   + +GT+++
Sbjct: 376 GKSGSGKSSLSNLLLKFYENYTGVISVDGRNIKHIDQSQLIKNITVVEQRCNVFNGTLKE 435

Query: 602 NITYGL---TEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIA 658
           NI  G+    EE    +++ V +     NFI       +T IG  G  LSGGQ+Q++AIA
Sbjct: 436 NIIIGIDGADEEEILTKLKLVCRISLLENFIHDLSDGLNTLIGSGGISLSGGQQQKVAIA 495

Query: 659 RALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIV 718
           RAL+K P ILILDE+ SALDV   G I        K K+  I++  H L+ I  S +   
Sbjct: 496 RALMKDPQILILDESLSALDVLQRGLILRAIRTHRKEKTTIILT--HELNQI-GSNDFCY 552

Query: 719 LGNDGSVVEMGKFKELFADPT 739
           L   G  +E G  + L  DP+
Sbjct: 553 LIESGQCIEHGLEETLVNDPS 573

>KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.20
           YMR301C
          Length = 695

 Score =  192 bits (489), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 136/390 (34%), Positives = 197/390 (50%), Gaps = 23/390 (5%)

Query: 358 RELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFD----VGKRAAFINA 413
           R    A  +   ++ + L     V+ F  E     ++N+++    D    V +  AF+N+
Sbjct: 275 RSANRADNKGASIALDSLINFEAVKYFNNESYLASKYNNALMTYRDAQIKVSQSLAFLNS 334

Query: 414 K---FFTSTSLVGDLSFLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFY 469
                FTS         LT ++Y G   +L G+LT+GDL             +  L + Y
Sbjct: 335 GQNLIFTSA--------LTAMMYMGCTGILGGNLTVGDLVLINQLVFQLSVPLNFLGSVY 386

Query: 470 SEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKG---EIEFKNVSFAYPTRPSNQIFK 526
            E+ Q       LF+L      I+        P  G   EI F+NV+F Y   P   I K
Sbjct: 387 RELKQSLIDMESLFKLRRNEVVIKNVEQPKMLPADGKPFEIRFENVTFGY--EPDRTILK 444

Query: 527 SLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIA 586
           + +F I  G  + IVGPSG GKSTI  L+  +Y+P  G+ILI+G D+ +++  SLR+ I 
Sbjct: 445 NASFVIAAGKKIAIVGPSGSGKSTILKLVFRFYDPQEGRILINGIDVKEIDLDSLRKVIG 504

Query: 587 VVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTL 646
           VV Q+  L + TI +N+ +G  +  T EE+    ++      I K     DT +G  G +
Sbjct: 505 VVPQDTPLFNDTIWENVRFGRID-ATDEEVWAAVEKAHLSPLISKLSRGTDTIVGERGLM 563

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 706
           +SGG+KQR+AIAR L+K  +I+  DEATSALD  +E  +  T     K+ S T + IAHR
Sbjct: 564 ISGGEKQRLAIARVLLKNADIMFFDEATSALDTHTEQNLLKTIRANFKTGSKTSIYIAHR 623

Query: 707 LSTIRRSENIIVLGNDGSVVEMGKFKELFA 736
           L TI  ++ IIVL  DGSV E G   EL A
Sbjct: 624 LRTIADADKIIVL-EDGSVKEEGTHTELLA 652

>YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}
            STE6Plasma membrane ATP-binding cassette (ABC)
            transporter required for the export of a-factor,
            catalyzes ATP hydrolysis coupled to a-factor transport;
            contains 12 transmembrane domains and two ATP binding
            domains; expressed only in MATa cells
          Length = 1290

 Score =  192 bits (488), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 157/528 (29%), Positives = 260/528 (49%), Gaps = 33/528 (6%)

Query: 231  FLGGFSVALFIGCAA-----NYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFF--DVH 283
            +L  +S+ L +G AA     N+         SE  V  LR+ VM+    ++ ++F  + +
Sbjct: 758  YLAKWSL-LVLGVAAADGIFNFAKGFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENN 816

Query: 284  KVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCF-VIP- 341
            K  + IS L  +     RS+  +    + S +     IG++  L       LVC  + P 
Sbjct: 817  KASE-ISALVLNDLRDLRSLVSEFLSAMTSFVTVST-IGLIWALVSGWKLSLVCISMFPL 874

Query: 342  VVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREI 401
            +++ ++I+G  ++    + + +  QL     + +  ++T++   AE      ++    ++
Sbjct: 875  IIIFSAIYGGILQKCETDYKTSVAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIKM 934

Query: 402  FDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNA 461
              +  + A       + T+++       +  YG  LV+    T  ++        +T  +
Sbjct: 935  QQIASKRAIATGFGISMTNMIVMCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMS 994

Query: 462  IFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPT----------LGKTY--TPGKGEIEF 509
               L +   +I +G  AAS ++ + D                   G TY     K  +  
Sbjct: 995  CTSLVSQIPDISRGQRAASWIYRILDEKHNTLEVENNNARTVGIAGHTYHGKEKKPIVSI 1054

Query: 510  KNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILID 569
            +N++FAYP+ P+  ++K++NF +  G  + I+G SG GKST+ LLL   YN   G+I ID
Sbjct: 1055 QNLTFAYPSAPTAFVYKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKID 1114

Query: 570  GQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFI 629
            G D+   N  SLR++I+VV+Q+P+L +GTIRDN+TYGL +E  + E+    K    H+F+
Sbjct: 1115 GTDVNDWNLTSLRKEISVVEQKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFV 1174

Query: 630  VKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTF 689
            +  P   DT I    TLLSGGQ QR+ IARAL++K  ILILDE TSALD  S   IN   
Sbjct: 1175 ISSPQGLDTRIDT--TLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIIN--- 1229

Query: 690  GQLMKS--KSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELF 735
             +++K    ++  + I H    +R   +I VL  DG VVE G F  L+
Sbjct: 1230 -EIVKKGPPALLTMVITHSEQMMRSCNSIAVL-KDGKVVERGNFDTLY 1275

 Score =  182 bits (462), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 149/528 (28%), Positives = 244/528 (46%), Gaps = 79/528 (14%)

Query: 258 ERLVARLRSVVMKHTLHQDS-EFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKS--- 313
           ER   R+RS +++  L +   E++D ++      +L  D   ++R + +  S   ++   
Sbjct: 101 ERQGFRIRSQILEAYLEEKPMEWYDNNE------KLLGDFTQINRCVEELRSSSAEASAI 154

Query: 314 ------LICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQL 367
                  IC  +G       S+ L  +++C    +   A +F + I + S +    T + 
Sbjct: 155 TFQNLVAICALLGTSFYYSWSLTL--IILCSSPIITFFAVVFSRMIHVYSEKENSETSKA 212

Query: 368 TRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSF 427
            ++    +N  + V+ +  ++ E K+F   I     +     FI + FF + +  G L F
Sbjct: 213 AQLLTWSMNAAQLVRLYCTQRLERKKFKEII-----LNCNTFFIKSCFFVAAN-AGILRF 266

Query: 428 LTVLVY------GSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASR 481
           LT+ ++      GS ++  G L I D+                ++ F+S IM G+   + 
Sbjct: 267 LTLTMFVQGFWFGSAMIKKGKLNINDV----------------ITCFHSCIMLGSTLNNT 310

Query: 482 LFELT---------DRVPTI------RPTLGKTYTP------GKGEIEFKNVSFAYPTRP 520
           L ++          +++ T+      R  L KT            ++ F NVSF+YP+RP
Sbjct: 311 LHQIVVLQKGGVAMEKIMTLLKDGSKRNPLNKTVAHQFPLDYATSDLTFANVSFSYPSRP 370

Query: 521 SNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKS 580
           S  + K+++     G    IVG SG GKST++ LLL +Y+  +G I I+G +I  ++ K 
Sbjct: 371 SEAVLKNVSLNFSAGQFTFIVGKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKL 430

Query: 581 LRRQIAVVQQEPVLMSGTIRDNITYGLTE---------EPTKEEIRTVAKQCFCHNFIVK 631
           L   I VV+Q   L + T+R NI  G T+            +  I+   +      FI+ 
Sbjct: 431 LIENITVVEQRCTLFNDTLRKNILLGSTDSVRNADCSTNENRHLIKDACQMALLDRFILD 490

Query: 632 FPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQ 691
            P   +T IG  G  LSGGQ+QR+AIARA I+   IL LDEA SALD+     +      
Sbjct: 491 LPDGLETLIGTGGVTLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRH 550

Query: 692 LMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPT 739
             K K+  I++  H LS I  S++ + L  +G VVE G   EL ADPT
Sbjct: 551 WRKGKTTIILT--HELSQI-ESDDYLYLMKEGEVVESGTQSELLADPT 595

>NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20
          Length = 702

 Score =  188 bits (478), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 138/393 (35%), Positives = 203/393 (51%), Gaps = 25/393 (6%)

Query: 358 RELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFD----VGKRAAFINA 413
           R+   A  +   V+ + L     V+ F  E+    +++ S+ +  D    V +  A++N+
Sbjct: 284 RDANKADNKGASVALDSLINFEAVKYFNNEKYLADKYHTSLIKYRDSQIKVSQSLAYLNS 343

Query: 414 K---FFTSTSLVGDLSFLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFY 469
                FTS         LT ++Y G   V+ G LT+GDL             +  L + Y
Sbjct: 344 GQNLIFTSA--------LTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVY 395

Query: 470 SEIMQGAGAASRLFELTDRVPTIR----PTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIF 525
            E+ Q       LF+L      I     P + K  + G  EI F+NV+F Y ++   +I 
Sbjct: 396 RELKQSLIDMESLFQLRKNEIKIENGTNPIVLKA-SDGPFEITFENVTFGYDSK--RKIL 452

Query: 526 KSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQI 585
            + +F I  G    +VGPSG GKSTI  L+  +Y+P  G+ILI+G D+ + +  SLRR +
Sbjct: 453 NNASFTIPGGLKTAVVGPSGSGKSTILKLVFRFYDPEQGRILINGVDVKEYDVDSLRRVM 512

Query: 586 AVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGT 645
            VV Q+  L + TI +N+ +G  +  T EE+ TV ++      I K P  Y+T +G  G 
Sbjct: 513 GVVPQDTPLFNDTIWENVKFGRIDA-TDEEVHTVIEKAQLAPLIKKLPQGYETIVGERGM 571

Query: 646 LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
           ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T     +S S T V IAH
Sbjct: 572 MISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLTTIRANFESGSRTSVYIAH 631

Query: 706 RLSTIRRSENIIVLGNDGSVVEMGKFKELFADP 738
           RL TI  ++ IIVL  DG+V E G    L A P
Sbjct: 632 RLRTIADADKIIVL-EDGAVKEEGTHSGLLATP 663

>Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {ON}
           similar to Ashbya gossypii AGL335W
          Length = 696

 Score =  188 bits (477), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 130/387 (33%), Positives = 194/387 (50%), Gaps = 14/387 (3%)

Query: 358 RELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFD----VGKRAAFINA 413
           R+   A  +   V+ + L     V+ F  E+    +++ S+    D    V +  AF+N+
Sbjct: 293 RDANSADNKAASVALDSLINFEAVKYFNNEEYLANKYHKSLLTYRDSQIKVQQSLAFLNS 352

Query: 414 KFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIM 473
                 +L+   +   V+      V+ GSLT+GDL             +  L + Y E+ 
Sbjct: 353 ----GQNLIFTSALTAVMYMACSGVMEGSLTVGDLVLINQLIFQLSLPLNFLGSVYRELK 408

Query: 474 QGAGAASRLFELTDRVPTIRPTLGKTYTPGK--GEIEFKNVSFAYPTRPSNQIFKSLNFK 531
           Q       LF L     TI+  L     P K   +I F+NV+F Y   P  +I K+  F 
Sbjct: 409 QSLIDMESLFRLQKNKITIKNVLNPQMLPEKLPSDIRFENVTFGYD--PERKILKNATFT 466

Query: 532 IKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQE 591
           I  G    IVGPSG GKSTI  L+  +Y P  G+ILIDG+DI +++  SLR+ I VV Q+
Sbjct: 467 IPAGKKTAIVGPSGSGKSTILRLVFRFYEPEQGRILIDGKDIREVDLDSLRKSIGVVPQD 526

Query: 592 PVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQ 651
             L + TI +N+ +G  +   K +I    ++      I   P   +T +G  G ++SGG+
Sbjct: 527 TPLFNDTIWENVKFGRIDASDK-DITNAIERAQLTKLIQNLPKGINTIVGERGLMISGGE 585

Query: 652 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIR 711
           KQR+AI+R L+K   ++  DEATSALD  +E ++  T  +  + +S T V IAHRL TI 
Sbjct: 586 KQRLAISRVLLKDCPLMFFDEATSALDTHTEQSLLKTINENFEGQSKTSVYIAHRLRTIA 645

Query: 712 RSENIIVLGNDGSVVEMGKFKELFADP 738
            ++ IIVL N+  V E G  K L   P
Sbjct: 646 DADKIIVL-NNSRVHEEGDHKTLLKTP 671

>TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa]
           {ON} Anc_5.20 YMR301C
          Length = 725

 Score =  187 bits (476), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 134/391 (34%), Positives = 203/391 (51%), Gaps = 24/391 (6%)

Query: 358 RELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFD----VGKRAAFINA 413
           R+   A  +   ++ + L     V+ F  E+   ++++ ++ +  D    V +  AF+N+
Sbjct: 305 RQANKADNKGASIALDSLINFEAVKYFNNEEYLAQKYHKTLSQYRDSQIKVAQSLAFLNS 364

Query: 414 K---FFTSTSLVGDLSFLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFY 469
                FTS         LTV++Y G   ++ G+LT+GDL             +  L + Y
Sbjct: 365 GQNLIFTSA--------LTVMMYMGCTGIIGGNLTVGDLVLINQLVFQLSVPLNFLGSVY 416

Query: 470 SEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGE----IEFKNVSFAYPTRPSNQIF 525
            E+ Q       LF+L      I+          KG     I F+NV+F Y  +   +I 
Sbjct: 417 RELKQSLIDMEYLFQLKKNPIIIKNVEKPLMLAEKGHMPMTIRFENVTFGYDKQ--RKIL 474

Query: 526 KSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQI 585
           K+ +F+I+ G    IVGPSG GKSTI  LL  +Y+P  G+IL++G D  + +  SLR+ I
Sbjct: 475 KNASFQIESGQKTAIVGPSGSGKSTILKLLFRFYDPEEGRILVNGVDAREYDIDSLRKVI 534

Query: 586 AVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGT 645
            VV Q+  L + TI +N+ +G     + +EI  V  +      +VK P   +T +G  G 
Sbjct: 535 GVVPQDTPLFNDTIWENVRFGRIG-ASDDEITQVINKAQLGPLLVKLPQGRETIVGERGL 593

Query: 646 LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
           ++SGG+KQR+AIAR L+K  +I+  DEATSALD  +E A+  T  +  K  S T V IAH
Sbjct: 594 MISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQALLKTINENFKKGSRTSVYIAH 653

Query: 706 RLSTIRRSENIIVLGNDGSVVEMGKFKELFA 736
           RL TI  ++ IIVL  +G+V E GK  EL A
Sbjct: 654 RLRTIADADKIIVL-QEGTVREEGKHSELLA 683

>NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {ON}
           Anc_5.20 YMR301C
          Length = 730

 Score =  186 bits (471), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 150/463 (32%), Positives = 229/463 (49%), Gaps = 45/463 (9%)

Query: 296 SYIVSRSITQKISDGVK-SLICG------GVGIGMMLELSMDLSSVLVCFVIPVVLSASI 348
           SY++S  +   I  G + S++CG      G     +   +M L S+         +  + 
Sbjct: 257 SYVLSAMLFHIIPIGFEISVVCGILTYQFGASFAGITFTTMLLYSIFT-------IRTTA 309

Query: 349 FGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFD----V 404
           +  Q R   R+   A  +   V+ + L     V+ F  E     +++ S+ +  D    V
Sbjct: 310 WRTQFR---RDANKADNKGASVALDSLINFEAVKYFNNETYLSNKYHDSLLQYRDSTIKV 366

Query: 405 GKRAAFINAK---FFTSTSLVGDLSFLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTGN 460
            +  AF+N+     FTS         LT+++Y G   V+ G+LT+GDL            
Sbjct: 367 AQSLAFLNSGQNLIFTSA--------LTMMMYLGCTGVIEGNLTVGDLVLINQLVFQLSV 418

Query: 461 AIFGLSTFYSEIMQGAGAASRLFELTDRVPTIR-------PTLGKTYTPGKGEIEFKNVS 513
            +  L + Y E+ Q       LF+L      I+       P + K+ + G  EI+F+NV+
Sbjct: 419 PLNFLGSVYRELKQSLIDMESLFQLRKNPIKIQNAKTGPAPIMLKS-SDGPFEIKFENVT 477

Query: 514 FAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDI 573
           F Y T  + +I K+ +F I  G    +VGPSG GKSTI  L+  +Y+P  G++LI+G ++
Sbjct: 478 FGYDT--NRKILKNASFIIPAGLKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLINGINV 535

Query: 574 TKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFP 633
            + +  SLRR + VV Q+  L + TI +N+ +G       EEI+ V ++      I K P
Sbjct: 536 QRYDIDSLRRVMGVVPQDTPLFNDTIWENVKFGRIN-ANDEEIKQVIEKAQLAPLIEKLP 594

Query: 634 YTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLM 693
               T +G  G ++SGG+KQR+AIAR L+K  NI+  DEATSALD  +E A+  T     
Sbjct: 595 QREKTIVGERGLMISGGEKQRLAIARVLLKDANIMFFDEATSALDTHTEQALLNTIRANF 654

Query: 694 KSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFA 736
            S + T + IAHRL TI  ++ IIVL  DG V E G   EL A
Sbjct: 655 PSGTRTSIYIAHRLRTIADADKIIVL-EDGKVKEEGSHNELLA 696

>KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {ON}
           Anc_5.20 YMR301C
          Length = 709

 Score =  184 bits (467), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 123/341 (36%), Positives = 181/341 (53%), Gaps = 15/341 (4%)

Query: 404 VGKRAAFINA--KFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNA 461
           + K  AF+N+      +T+L G      ++  G   V+ G+LT+GDL             
Sbjct: 352 ISKSLAFLNSGQNLIFTTALTG------MMYLGCTGVIGGNLTVGDLVLINQLVFQLSVP 405

Query: 462 IFGLSTFYSEIMQGAGAASRLFELTD---RVPTIRPTLGKTYTPGKGEIEFKNVSFAYPT 518
           +  L + Y E+ Q       LF+L     ++  I          G  EI F+NV+F Y  
Sbjct: 406 LNFLGSVYRELKQSLIDMESLFKLRKNEVKIHNIENPKIILKEDGPFEITFENVTFGY-- 463

Query: 519 RPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNS 578
               +I K+ +F I  G    IVGPSG GKSTI  L+  +Y+P  G+ILI+G D+ ++  
Sbjct: 464 HADRKILKNASFTIPAGWKTAIVGPSGSGKSTILKLVFRFYDPEEGRILINGIDVREIEL 523

Query: 579 KSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDT 638
            SLR+ I VV Q+  L + +I +N+ +G  +     EI  V ++    + I K P +Y+T
Sbjct: 524 DSLRKLIGVVPQDTPLFNDSIWENVKFGRID-ALDSEIYEVIEKAQLDSLIRKLPQSYET 582

Query: 639 YIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSM 698
            +G  G ++SGG+KQR+AIAR L+K  +++  DEATSALD  +E A+  T     K+ S 
Sbjct: 583 IVGERGLMISGGEKQRLAIARVLLKDASVMFFDEATSALDTHTEQALLKTIRANFKTGSR 642

Query: 699 TIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPT 739
           T + IAHRL TI  ++ IIVL  DG+V E G   EL A  T
Sbjct: 643 TSIYIAHRLRTIADADKIIVL-EDGTVREEGTHNELLAKST 682

>Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON}
            (464370..468200) [3831 nt, 1277 aa]
          Length = 1276

 Score =  186 bits (473), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 147/499 (29%), Positives = 243/499 (48%), Gaps = 32/499 (6%)

Query: 257  SERLVARLRSVVMKHTLHQDSEFF--DVHKVGDLISRLGADSYIVSRSITQKISDGVKSL 314
            SE  +  LR+  M+    +  E+F  + +K  ++ + L  D   +   ++Q +S     L
Sbjct: 776  SEYWIMDLRNRAMEEIAQKKLEWFSREENKSPEIAALLMNDLRDLRSLVSQFLSVISTFL 835

Query: 315  ICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQ 374
                VG+   +     LS V +     +V+ + I+G  ++      +     L  +  E 
Sbjct: 836  TVSLVGLIWAIATGWKLSLVCISMFPLIVIFSIIYGTVLKNYETTYKTKVANLENLEYEI 895

Query: 375  LNGVRTVQSFVAEQREIKRFNHSIR-EIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVY 433
            + GV+T++  +  Q   K+  H ++ E+  + ++ A +       T+ +       +  Y
Sbjct: 896  ITGVKTIKC-LQLQNHFKKCYHKLKDEMGQIARKRAIVTGLGIAITTAIATTIQSILYYY 954

Query: 434  GSYLVLHG---SLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVP 490
            G  LV+ G   + T+      +L+T  T N++    +   +I +G  AAS ++ + +   
Sbjct: 955  GLKLVMDGEYSTRTMFQTFTLLLFTVMTCNSLI---SQIPDISRGQRAASWIYRIIEES- 1010

Query: 491  TIRPTLGKTYTPGK------GE--------IEFKNVSFAYPTRPSNQIFKSLNFKIKPGS 536
                T  +T T G+      GE        +   N+ FAYPT     I+ +L+  +  G 
Sbjct: 1011 --EDTKEQTITDGRFDEIHCGEKVDKTQPLVSIHNLEFAYPTALDVNIYDNLSLDLNVGQ 1068

Query: 537  NVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMS 596
             V IVG SG GKST+  LL   Y      I IDG D+ + ++++LRRQI+VV+Q+PVL  
Sbjct: 1069 TVAIVGESGSGKSTLVYLLTKLYQVADNCIDIDGTDVNEWDNETLRRQISVVEQKPVLFP 1128

Query: 597  GTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIA 656
            GT+R+N+ YGL   P + +I  + K    ++FI   P   +T +    +L+SGGQ QR+ 
Sbjct: 1129 GTVRENLIYGLYFSPLEIDIIDILKYVGVYDFIESLPEGLETSVDT--SLISGGQAQRLC 1186

Query: 657  IARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENI 716
            IARAL++KP ILILDE TSALD  S   IN    +     S+  +SI H    + RS N 
Sbjct: 1187 IARALLRKPKILILDECTSALDANSSKIINDIVAK--GPPSLLTISITHN-EQMMRSCNT 1243

Query: 717  IVLGNDGSVVEMGKFKELF 735
            + +  DG + E G F +LF
Sbjct: 1244 VAVLKDGKICETGPFNKLF 1262

 Score =  142 bits (359), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 114/428 (26%), Positives = 200/428 (46%), Gaps = 17/428 (3%)

Query: 321 IGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRT 380
           IG+    S  L+ +++C    +++ A IF + I+  +      +G    +    +N  + 
Sbjct: 166 IGVSFYYSWSLTLIILCGTPLLIILAFIFSRSIQKYAALENTESGLAADLLAWSMNSAQM 225

Query: 381 VQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLH 440
           ++    + +EI+ F     +  D   + +   A   ++   +    F+    +G+  +  
Sbjct: 226 IKLSCTQLKEIESFEELTLKCNDYFIKLSLYVAANISTLRFLSLAMFVQGFWFGNTEIRK 285

Query: 441 GSLTIGD-LTAF--MLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFE--LTDRVPTIRPT 495
           G+L I D +T F   L    T N   G   F    +Q    A R  +  L D    I  +
Sbjct: 286 GNLNISDVITCFSSCLMLGSTLNTTLGYLIF----LQKGQVALRKIQSFLNDNKVEIDES 341

Query: 496 LGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLL 555
             K     K +I F++VSF+YP+RP++ +   ++     G    IVG SG GKST++ LL
Sbjct: 342 ALKQIDISKADISFRHVSFSYPSRPADDVLNDISIDFLSGKTTFIVGRSGSGKSTLSNLL 401

Query: 556 LHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEP---- 611
           L  Y+   G I I    I +++ + L + I VV+Q   L + T+ +NI  G  +E     
Sbjct: 402 LKLYDEYDGYISIGSTHIREIDQQVLIKNITVVEQRCTLFNDTLVNNILLGSQDEDKSSP 461

Query: 612 -TKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILIL 670
             +++++   K     + I       DT +G  G  LSGGQ+QR+A+ARA ++   +LIL
Sbjct: 462 VVQKKLKEAIKMACLESVIDSLSNGLDTILGTGGISLSGGQQQRVALARAYMRDTEVLIL 521

Query: 671 DEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGK 730
           DEA SALD+     +     +  + ++  I++  H LS I   + + V+  +G ++E G 
Sbjct: 522 DEAVSALDIVHREQLMSNITKWRQGRTTIILT--HELSQISIQDYLYVV-EEGRIIESGF 578

Query: 731 FKELFADP 738
             +L  DP
Sbjct: 579 QGQLMYDP 586

>KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1275

 Score =  186 bits (472), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 142/491 (28%), Positives = 238/491 (48%), Gaps = 18/491 (3%)

Query: 257  SERLVARLRSVVMKHTLHQDSEFFDV--HKVGDLISRLGADSYIVSRSITQKISDGVKSL 314
            SE  +  LR  VM+   +   E+F +  +K  ++ +    D   +   +T+ ++     L
Sbjct: 778  SEYWIMDLRKKVMRTITYNKFEWFQLAENKPSEVSALALNDLRDLRTLVTEFLATASTFL 837

Query: 315  ICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQ 374
            +    G+   L     LS V +     +++ + ++G  ++    + + A  QL     E 
Sbjct: 838  VVSTCGLIWALVAGWKLSLVSISMFPLIIVFSGVYGAALQKCETDYKSAVAQLENCLYEV 897

Query: 375  LNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYG 434
            +  ++T++    +     R++   + +  +G+R + I       T  +       +  YG
Sbjct: 898  VVSMKTIRCLQLQTHFQNRYDRRKQRMLSLGRRRSVITGCGIAITHTLTLCIQAILYYYG 957

Query: 435  SYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRP 494
              LV+ G  T   +        +T      L     E+ +G  AA+ ++ +       R 
Sbjct: 958  IKLVIDGKYTSKKMFEVFTLILFTIMTCTNLINQIPEVTRGQRAATYIYRILKEAAATRE 1017

Query: 495  -------TLGKTYTPGKGEIEF-KNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGK 546
                   TL  + T  K  +   K+++FAYP  PS  +++ LN  +K  ++V +VG SG 
Sbjct: 1018 HQDMHNRTLPISNTSEKDTMVLVKDLTFAYPATPSKHVYEHLNLNLKSDTSVALVGESGS 1077

Query: 547  GKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYG 606
            GKSTI  LL   Y+     I +DG D+++ ++ SLR QI+VV+Q   L++GTIR+N+TYG
Sbjct: 1078 GKSTIISLLTKLYDVPEKHIYVDGTDLSEWDTNSLRNQISVVEQSANLLNGTIRENLTYG 1137

Query: 607  LTEEPTKE-EIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKP 665
            L EE T E ++  + K    ++F+ + P   DT +     LLSGGQ QR+ IARAL+K  
Sbjct: 1138 LPEEDTTEVDLIGILKLVSIYDFVSRLPNGIDTIVDRD--LLSGGQAQRLCIARALVKPH 1195

Query: 666  NILILDEATSALDVESEGAINYTFGQLMKSKSMT-IVSIAHRLSTIRRSENIIVLGNDGS 724
             ILILDE TSALD  S    N     + K    T I++I H    +R  E++++L N G+
Sbjct: 1196 RILILDECTSALDALST---NIIIDIVRKGIPNTLIIAITHDEHMMRSCESVLLLKN-GA 1251

Query: 725  VVEMGKFKELF 735
            +VE G F EL 
Sbjct: 1252 IVEQGSFVELM 1262

 Score =  145 bits (365), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 125/456 (27%), Positives = 209/456 (45%), Gaps = 65/456 (14%)

Query: 321 IGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVR- 379
           IG     S  L+ +++C   P++ + +I+  ++   + +  D   + T  + E L     
Sbjct: 155 IGTSFYYSWSLTLIILCST-PIITAIAIYFAKL---TNKYTDLENKETSYAAELLTWSMR 210

Query: 380 ---TVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTS--TSLVGDLS---FLTVL 431
               V+ + A+  EI +F+ S+         + FI A  +++  +S++  L+   F+   
Sbjct: 211 FNDMVKFYTAQNEEISKFDTSVTRC-----NSLFIKACLYSALNSSIIRFLTLCMFVQGF 265

Query: 432 VYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELT----- 486
            +G+ ++    L I D+                ++ F+S +M GA  +  + ++T     
Sbjct: 266 WFGATMIRRNKLDINDV----------------ITCFHSCLMLGATVSEAMSQVTVIQKG 309

Query: 487 ----DRVPTIRPTLGKTY------TPGKGE---IEFKNVSFAYPTRPSNQIFKSLNFKIK 533
                ++       GKT        P KG    I F N+SF YP R SN   ++++ +++
Sbjct: 310 HVANKKLEGFLELEGKTIMQAALKCPPKGNSLSITFNNISFKYPCRTSNSAVENVSLRLE 369

Query: 534 PGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPV 593
            G    I+G SG GKST+A LLL +Y   SG I +D   I  LN + L   I VV+Q   
Sbjct: 370 SGKMTFIIGKSGSGKSTLAKLLLRFYEEYSGSITVDNISICDLNQEWLLSNITVVEQNCT 429

Query: 594 LMSGTIRDNITYGL--TEEPTK-----EEIRTVAKQC---FCHNFIVKFPYTYDTYIGPH 643
           L + T+R+NI  G     EP +     E  R + K C     +  +       DT IG  
Sbjct: 430 LFNDTLRNNILLGSENQSEPARMESIEERERKLRKACNFALLNEMLADLTDGLDTVIGSG 489

Query: 644 GTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSI 703
           G  LSGGQ+QR+A+ARA ++   I+I DE+ SALDV     +        + K  T + +
Sbjct: 490 GVELSGGQRQRVALARAFLRNTPIMIFDESVSALDVAHRKLLMKAIRSWRQGK--TTIVL 547

Query: 704 AHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPT 739
            H LS I  ++ I ++ + G V E G  ++L    T
Sbjct: 548 THELSQINPTDFIYIMEH-GRVCEYGYQEDLLKSET 582

>TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {ON}
           Anc_5.20 YMR301C
          Length = 711

 Score =  183 bits (464), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 131/397 (32%), Positives = 198/397 (49%), Gaps = 33/397 (8%)

Query: 358 RELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFD----VGKRAAFINA 413
           R+   A  +   ++ + L     V+ F  EQ    ++N S++   +    V +  AF+N+
Sbjct: 302 RQANKADNKGASIALDSLINFEAVKYFNNEQYLASKYNTSLKSYTEAQVKVAQSLAFLNS 361

Query: 414 K---FFTSTSLVGDLSFLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFY 469
                FTS         LT ++Y G   +L G+L++GDL             +  L + Y
Sbjct: 362 GQNLIFTSA--------LTAMMYMGCTGILGGNLSVGDLVLINQLVFQLSVPLNFLGSVY 413

Query: 470 SEIMQGAGAASRLFEL--------TDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPS 521
            ++ Q       LF+L         ++ P I      +   G   IEFKNV+F Y   P+
Sbjct: 414 RDLKQSLIDMESLFKLRKNEVKILNNKNPAIL-----SLKDGPFNIEFKNVTFGYD--PN 466

Query: 522 NQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSL 581
            +I ++ +F I  G    +VGPSG GKSTI  L+  +Y+P  G++L++G D+   +  SL
Sbjct: 467 RKILRNASFIIPAGVKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLVNGIDVRDYDLDSL 526

Query: 582 RRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIG 641
           RR I VV Q+  L + TI +N+ +G     T E+I    ++      I K P  Y+T +G
Sbjct: 527 RRAIGVVPQDTPLFNDTIWENVKFG-DVTATDEQILNAVEKAQLGTLIEKLPKKYETIVG 585

Query: 642 PHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIV 701
             G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E  +  T        S T V
Sbjct: 586 ERGLMISGGEKQRLAIARVLLKNAPIMFFDEATSALDTHTEQELLKTIKNNFDKGSRTSV 645

Query: 702 SIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADP 738
            IAHRL T+  S+ IIVL  +GS+ E G    L + P
Sbjct: 646 YIAHRLRTVADSDKIIVL-KEGSIFEEGTHLGLLSKP 681

>TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20
           YMR301C
          Length = 696

 Score =  182 bits (462), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 127/389 (32%), Positives = 198/389 (50%), Gaps = 17/389 (4%)

Query: 358 RELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFD----VGKRAAFINA 413
           R+   A  +   V+ + L     V+ F  E     ++++S+ +  D    + +  AF+NA
Sbjct: 281 RDANKADNKAASVALDSLINFEAVKHFNNENYLAGKYHNSLMKYRDSQVKIAQSLAFLNA 340

Query: 414 -KFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEI 472
            + F  TS +  + ++     G   V+ G LT+GDL             +  L + Y E+
Sbjct: 341 GQNFIFTSALSAMMYM-----GCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYREL 395

Query: 473 MQGAGAASRLFELTDRVPTIRPTLGKTYTP---GKGEIEFKNVSFAYPTRPSNQIFKSLN 529
            Q       LF L +    I         P   G  EI+F+NV+F Y TR   +I ++ +
Sbjct: 396 KQSLIDMEALFNLRNNKIKIHNNDKPLMLPENAGPFEIKFENVTFGYDTR--RKILRNAS 453

Query: 530 FKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQ 589
           F I  G    IVGPSG GKSTI  L+  +Y+P SG++L++G+D+ + +  S R+ I VV 
Sbjct: 454 FTIPAGVKTAIVGPSGSGKSTILKLVFRFYDPESGRVLVNGKDVREYDLDSFRKVIGVVP 513

Query: 590 QEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSG 649
           Q+  L + TI +N+ +G  +  T +E+    ++      I K P    T +G  G ++SG
Sbjct: 514 QDTPLFNDTIWENVKFGRID-ATDDEVTNAIEKAQLAPLIHKLPVGSATIVGERGLMISG 572

Query: 650 GQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLST 709
           G+KQR+AIAR L+K   I+  DEATSALD  +E ++  T  +     S T V +AHRL T
Sbjct: 573 GEKQRLAIARVLLKNSQIMFFDEATSALDTHTEQSLLKTIRENFDRGSRTSVYVAHRLRT 632

Query: 710 IRRSENIIVLGNDGSVVEMGKFKELFADP 738
           I  ++ I+VL  +G V E G   EL + P
Sbjct: 633 IADADKILVL-EEGCVREEGSHTELLSRP 660

>AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR301C (ATM1)
          Length = 691

 Score =  181 bits (458), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 128/385 (33%), Positives = 190/385 (49%), Gaps = 14/385 (3%)

Query: 358 RELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFD----VGKRAAFINA 413
           R+   A  +   V+ + L     V+ F  E+    +++ S+ +  D    V +  AF+N 
Sbjct: 284 RDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYHTSLMKYRDSQIKVSQSLAFLN- 342

Query: 414 KFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIM 473
              T  +L+   +   ++      V+ GSLT+GDL             +  L + Y ++ 
Sbjct: 343 ---TGQNLIFTTALTAMMYMACNGVMQGSLTVGDLVLINQLVFQLSVPLNFLGSVYRDLK 399

Query: 474 QGAGAASRLFELTDRVPTIRPTLGKTYTPGKG--EIEFKNVSFAYPTRPSNQIFKSLNFK 531
           Q       LF+L     TI+ +      P     +I F+NV+F Y   P  +I  +++F 
Sbjct: 400 QSLIDMESLFKLQKNQVTIKNSPNAQNLPIHKPLDIRFENVTFGYD--PERRILNNVSFT 457

Query: 532 IKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQE 591
           I  G    IVGPSG GKSTI  L+  +Y P  G+IL+ G DI  L+  SLR+ I VV Q+
Sbjct: 458 IPAGMKTAIVGPSGSGKSTILKLVFRFYEPEQGRILVGGTDIRDLDLLSLRKAIGVVPQD 517

Query: 592 PVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQ 651
             L + TI +N+ +G       E +R + K       +   P    T +G  G ++SGG+
Sbjct: 518 TPLFNDTIWENVKFGNISSSDDEILRAIEKAQLT-KLLQNLPKGASTVVGERGLMISGGE 576

Query: 652 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIR 711
           KQR+AIAR L+K   ++  DEATSALD  +E A+ +T  Q   S S T V +AHRL TI 
Sbjct: 577 KQRLAIARVLLKDAPLMFFDEATSALDTHTEQALLHTIQQNFSSNSKTSVYVAHRLRTIA 636

Query: 712 RSENIIVLGNDGSVVEMGKFKELFA 736
            ++ IIVL   GSV E G    L A
Sbjct: 637 DADKIIVL-EQGSVREEGTHSSLLA 660

>CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa]
           {ON} similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301c ATM1
          Length = 727

 Score =  181 bits (458), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 127/386 (32%), Positives = 200/386 (51%), Gaps = 15/386 (3%)

Query: 358 RELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFD----VGKRAAFINA 413
           +E   A  +   V+ + L     V+ F  E     ++++S+ +  D    V +  AF+N 
Sbjct: 313 KEANKADNKGASVALDSLINFEAVKYFNNESYLANKYHNSLIKYRDSQVKVAQSLAFLN- 371

Query: 414 KFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIM 473
              +  SL+   +   ++  G   V+ G LT+GDL             +  L + Y E+ 
Sbjct: 372 ---SGQSLIFTTALTGMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELK 428

Query: 474 QGAGAASRLFEL-TDRVPTIRPTLGKTYTPGKG--EIEFKNVSFAYPTRPSNQIFKSLNF 530
           Q       LF+L  ++V     +  K+ +   G  EI+F+NV+F Y  +   +I K+ +F
Sbjct: 429 QSLIDMESLFKLRKNQVKIQNCSQPKSISKSDGPFEIKFENVTFGYDGQ--RKILKNASF 486

Query: 531 KIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQ 590
            I  G    I GPSG GKST+  L+  +Y+P  G++L++G D+ + +   LR+ I VV Q
Sbjct: 487 TIPAGMKTAIAGPSGSGKSTVLKLVFRFYDPEEGRVLVNGVDVREYDIDQLRKAIGVVPQ 546

Query: 591 EPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGG 650
           +  L + TI +N+ +G  E  + EEI  V  +    + I K P    T +G  G ++SGG
Sbjct: 547 DTPLFNDTIWENVKFGRIE-ASDEEITRVIDKAQLSDLIAKLPQGSSTIVGERGLMISGG 605

Query: 651 QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI 710
           +KQR+AIAR L+K  +I+  DEATSALD  +E ++  T  +   S   T V IAHRL TI
Sbjct: 606 EKQRLAIARVLLKDADIMFFDEATSALDTHTEQSLLRTIRRNFNSGEKTSVYIAHRLRTI 665

Query: 711 RRSENIIVLGNDGSVVEMGKFKELFA 736
             ++ IIVL  +G+V E G  +EL A
Sbjct: 666 ADADKIIVL-EEGTVREEGTHQELLA 690

>NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1.527
           YKL209C
          Length = 1293

 Score =  182 bits (463), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 142/504 (28%), Positives = 231/504 (45%), Gaps = 38/504 (7%)

Query: 258 ERLVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKS---- 313
           ER    +R  ++   L +  E++D H       +L  D   V+R + +  S   ++    
Sbjct: 102 ERQGFAIRKRLLNEYLVKPMEWYDCH------DKLLGDFTQVNRCVEELRSSSAEASAIT 155

Query: 314 ---LICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRV 370
               +     IG     S  L+ +++C    ++L A +F   I   +      TG+  ++
Sbjct: 156 FQNFVAMLALIGTSFYYSWSLTLIILCSAPLIILFAILFSHMIHKYTELENSETGKAAQL 215

Query: 371 SEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTS--TSLVGDLS-- 426
               +N  + V+ +  +  EI  F   + +  D+     FI + F+ S  TS++  LS  
Sbjct: 216 LNWSMNSAQLVKLYCTQAYEIHSFKELVGQCNDL-----FIKSCFYVSANTSILRFLSLS 270

Query: 427 -FLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFEL 485
            F+    +G+ +V  G L+I D+          G+ +         + +G  A  ++ + 
Sbjct: 271 MFVQGFWFGAIMVKKGKLSIKDVITCFHSCLMLGSTLNNTLQQIVVLQKGDVALKKILDF 330

Query: 486 ---TDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVG 542
              + R P++ P    +     GEI F+N+SFAYPTRP   + K ++   +PG +  I+G
Sbjct: 331 ISFSQRSPSLEPPYEPSVPISNGEISFQNISFAYPTRPHQTVLKDVSITFQPGRSTFIIG 390

Query: 543 PSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDN 602
            SG GKST+A LLL +YN   G I I   ++ K+N   L   I VV+Q   L + T+R+N
Sbjct: 391 KSGSGKSTLANLLLKFYNDYQGSIKIGNTNVKKINKNWLFENITVVEQRCTLFNDTLRNN 450

Query: 603 ITYGLTEEPTKEE---------IRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQ 653
           +  G++    K E         ++   +       I + P   DT IG  G  LSGGQ+Q
Sbjct: 451 LLLGISNSNQKVEQDDIEISQRLKDACRIAMLEELIRELPDGLDTIIGAGGVSLSGGQQQ 510

Query: 654 RIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRS 713
           R+AIARA IK  ++LILDEA SALD+     I          K+  I++  H LS +   
Sbjct: 511 RVAIARAYIKDSSVLILDEAVSALDIIHRELIMKAIKNWRSGKTTIILT--HDLSQLDYD 568

Query: 714 ENIIVLGNDGSVVEMGKFKELFAD 737
           + + V   DG V E G  + L  D
Sbjct: 569 DFLYVF-EDGEVKESGYQQALLQD 591

 Score =  162 bits (409), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 134/496 (27%), Positives = 230/496 (46%), Gaps = 22/496 (4%)

Query: 257  SERLVARLRSVVMKHTLHQDSEFF--DVHKVGDLISRLGADSYIVSRSITQKISDGVKSL 314
            SE  +  LR+  M   +++  ++F  + +K  +L + L  D   +   +++ +S     +
Sbjct: 793  SELWIMDLRNEAMAAIMNKRLDWFSKEENKSSELSALLLNDLRDLRSLVSEFLSAMTTFI 852

Query: 315  ICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQ 374
            +   VG+   L     LS V +     ++L + I+G  ++      + A  +L     E 
Sbjct: 853  VVSLVGLIWALVSGWKLSLVCISMFPLIILVSGIYGSTLQRYETMYKTAVAELENHEYEI 912

Query: 375  LNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYG 434
            +  ++T++   A +  IK +      +  +  + +       + T+ +       +  YG
Sbjct: 913  MTKIKTIRYLQASKYFIKNYKVLENNLKKIAHKRSIATGFGISITNTIAVCIQSILYYYG 972

Query: 435  SYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRP 494
              LV  G  +   +        +T  +   L +   +I +G  AAS L+ + D     + 
Sbjct: 973  LRLVFKGEYSSKKMFETFTLLLFTIISCTSLVSQIPDISRGQRAASWLYRILDESDDNKE 1032

Query: 495  TLGKTY----------TPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGS-NVCIVGP 543
            ++              T     I  KN+ F+YP+  + +I+K++   +      + IVG 
Sbjct: 1033 SVDSGSRSADIIISGNTNSVPLISIKNLRFSYPSAQTVEIYKNITLHVTSSQKTIGIVGE 1092

Query: 544  SGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNI 603
            SG GKST+  LL   Y   +  I IDG D+ + ++  LR+QI+VV+Q P L  GT+RDN+
Sbjct: 1093 SGSGKSTLMYLLTKLYKTPANSIYIDGTDVNEWDTLKLRKQISVVEQNPTLFEGTVRDNL 1152

Query: 604  TYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIK 663
             YG   + ++ EI  V K    + FI   P   D+ I     L+SGGQ QR+ IARAL++
Sbjct: 1153 VYGTLNDISEIEIYDVLKYLGIYEFIENLPMGLDSRIDTK--LVSGGQAQRLCIARALLR 1210

Query: 664  KPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA--HRLSTIRRSENIIVLGN 721
            KP ILILDE TSALD  S   IN     L+K+   T+++I   H    +    ++ V+  
Sbjct: 1211 KPTILILDECTSALDAASAHLIN----NLVKNGLPTVLTIVITHSKQMMEACNSLAVI-K 1265

Query: 722  DGSVVEMGKFKELFAD 737
            DG + E G F EL  +
Sbjct: 1266 DGRLAEQGNFAELMKN 1281

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score =  180 bits (456), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 127/342 (37%), Positives = 180/342 (52%), Gaps = 23/342 (6%)

Query: 404 VGKRAAFINAK---FFTSTSLVGDLSFLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTG 459
           V +  AF+N+     FTS         LT ++Y G   V+ G+LT+GDL           
Sbjct: 348 VAQSLAFLNSGQNLIFTSA--------LTAIMYLGCTGVIGGNLTVGDLVLINQLVFQLS 399

Query: 460 NAIFGLSTFYSEIMQGAGAASRLFELTDRVPTI----RP-TLGKTYTPGKGEIEFKNVSF 514
             +  L + Y E+ Q       LF+L      I    RP  L    TP   EI+F+NV+F
Sbjct: 400 VPLNFLGSVYRELKQSLIDMESLFKLRKNEIKIQNVHRPLMLPNELTPF--EIKFENVTF 457

Query: 515 AYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDIT 574
            Y      +I K+ +F I  G    +VGPSG GKSTI  L+  +Y+P  G+IL++G DI 
Sbjct: 458 GYD--KERKILKNASFTIPAGWKTAVVGPSGSGKSTILKLVFRFYDPEEGRILLNGTDIK 515

Query: 575 KLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPY 634
           +++  SLR+ I VV Q+  L + TI +N+ +G  E    E ++ + K       I K P 
Sbjct: 516 EIDLASLRKVIGVVPQDTPLFNDTIWENVKFGRIEATDNEILQAIEKAQLAP-LIKKLPK 574

Query: 635 TYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMK 694
             +T +G  G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E ++  T  +   
Sbjct: 575 GRETIVGERGLMISGGEKQRLAIARVLLKNSGIMFFDEATSALDTHTEQSLLRTIKENFD 634

Query: 695 SKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFA 736
             S T V IAHRL TI  ++ IIVL  DG V E G  ++L A
Sbjct: 635 GSSRTSVYIAHRLRTIADADKIIVL-KDGQVEEEGTHRQLIA 675

>ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} similar
           to uniprot|P40416 Saccharomyces cerevisiae YMR301C ATM1
           Mitochondrial inner membrane transporter exports
           mitochondrially synthesized precursors of iron- sulfur
           (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 709

 Score =  178 bits (451), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 126/385 (32%), Positives = 195/385 (50%), Gaps = 15/385 (3%)

Query: 358 RELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFD----VGKRAAFINA 413
           RE   A  +   V+ + L     V++F  E+   +++  S+ +  D    V +  AF+N 
Sbjct: 280 REANKADNKAASVALDSLINFEAVKNFNNEKYLAEKYETSLLKYRDSQVRVAQSLAFLN- 338

Query: 414 KFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIM 473
              +  +L+   +   ++  G   ++ GSLT+GDL             +  L + Y E+ 
Sbjct: 339 ---SGQNLIFTTALTAMMYMGCTGIIGGSLTVGDLVLINQLVFQLSVPLNFLGSVYRELK 395

Query: 474 QGAGAASRLFELTDRVPTI-RPTLGKTYTPGKG--EIEFKNVSFAYPTRPSNQIFKSLNF 530
           Q       LF L +    I  P+  K      G  +I F+NV+F Y   P  +I ++ +F
Sbjct: 396 QSLIDMESLFNLRNNPILIDNPSKPKMLPANAGPFDIVFENVTFGYD--PRRKILQNASF 453

Query: 531 KIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQ 590
            I  G    +VGPSG GKST+  L+  +Y+P  G+IL++G DI + +  SLRR I VV Q
Sbjct: 454 VIPAGWKTAVVGPSGSGKSTLLKLVFRFYDPQEGRILVNGIDIREYDLDSLRRAIGVVPQ 513

Query: 591 EPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGG 650
           +  L + TI +N+ +G  +   +E  R++ K       + + P   +T +G  G ++SGG
Sbjct: 514 DTPLFNDTIWENVKFGRIDADDQEVTRSIEKAHLAP-LVYRLPGGLNTIVGERGLMISGG 572

Query: 651 QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI 710
           +KQR+AIAR L+K  +I+  DEATSALD  +E A+  T        S T V IAHRL TI
Sbjct: 573 EKQRLAIARVLLKNSSIMFFDEATSALDTHTEQALLRTIRANFDRGSKTSVYIAHRLRTI 632

Query: 711 RRSENIIVLGNDGSVVEMGKFKELF 735
             ++ IIVL  +G   E G   EL 
Sbjct: 633 ADADKIIVL-EEGRPREEGTHHELL 656

>SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1310

 Score =  179 bits (455), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 148/496 (29%), Positives = 242/496 (48%), Gaps = 31/496 (6%)

Query: 257  SERLVARLRSVVMKHTLHQDSEFF--DVHKVGDLISRLGADSYIVSRSITQKISDGVKSL 314
            SE  +  LR + ++    QD  +F  D++K  + IS L  +     RS+  +    + +L
Sbjct: 818  SEYWIRDLRMLAIRKITAQDLHWFSLDMNKSSE-ISALVLNDLRDLRSLVSEFLSSISTL 876

Query: 315  I-CGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEE 373
            I    VGI         LS V +      +L +  +G  ++    + +    +L     E
Sbjct: 877  IIVSSVGIVWAFISGWKLSLVCISLFPIFILFSCFYGGLLQRYETDYKTKVAELENQLHE 936

Query: 374  QLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVY 433
               G+ T++    E + ++++ +  +++    K+ A I   F  + S    L+   +L Y
Sbjct: 937  IFRGITTIRYLKLEYQFLEKYYNLEKKMRRASKKRA-ITIGFGVAASNTLTLAVQAILFY 995

Query: 434  -GSYLVLHGSLT---IGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTD-R 488
             G  LV  GS +   + +    +L+T  T  ++ G      +I +G  AA+ +F + D +
Sbjct: 996  YGIKLVTTGSYSTEKMFETFTLLLFTVMTCVSLIGQ---IPDISRGQRAATYIFRIIDNQ 1052

Query: 489  VPTIRPTLGK------TYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVG 542
             P  +    K      T+ P    I  KN+SF+YP+ PS  I+K L   +  G  + +VG
Sbjct: 1053 SPAAKDEKKKIASYKFTHDP---LISVKNLSFSYPSAPSTAIYKGLKLDVFSGETIAVVG 1109

Query: 543  PSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDN 602
             SG GKST+ LL+   Y   +G I IDG DI + ++  LR  I+VV+Q+P    GT+ +N
Sbjct: 1110 ESGSGKSTLTLLISALYEVPNGSIEIDGIDINRWDTNKLRTIISVVEQKPQFFDGTVGEN 1169

Query: 603  ITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALI 662
            + YG++   T+ +++         +F+   P   DT I    +L+SGGQ QR++IARA++
Sbjct: 1170 LLYGISGRVTQIQVKEALCLAGVQDFVFSLPEGLDTRIDT--SLISGGQAQRLSIARAML 1227

Query: 663  KKPNILILDEATSALDVESEGAINYTFGQLMKSK--SMTIVSIAHRLSTIRRSENIIVLG 720
            +KP IL LDE TSALD  +  AI      L+K     +T + I H    +R  E I VL 
Sbjct: 1228 RKPKILFLDECTSALDTSNTHAI----ANLIKKHFCGITTIVITHNEQMMRACERIAVLQ 1283

Query: 721  NDGSVVEMGKFKELFA 736
            N G V E G F +L+A
Sbjct: 1284 N-GKVAEDGSFDDLYA 1298

 Score =  136 bits (342), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 120/423 (28%), Positives = 191/423 (45%), Gaps = 31/423 (7%)

Query: 328 SMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAE 387
           S  L+ V++  V  +++ + I  K I   +R     + +  ++     +    ++ F  +
Sbjct: 177 SWSLTLVIMAGVPIIIVFSVILSKLIERFTRLENMESSRAAQMVSWSFDAAEMIRLFCTQ 236

Query: 388 QREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVY------GSYLVLHG 441
           Q EI++F  S+++         FI    F+S S    L F T+ ++      G+ ++  G
Sbjct: 237 QFEIEKFELSVKKC-----TKYFIRISLFSSAS-YAMLRFFTLCMFIQGFWFGNKMIRQG 290

Query: 442 SLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELT---DRVPTIRPTL-- 496
            LT GD+          GN +         + +G  A  ++   T   +  P  R  +  
Sbjct: 291 VLTTGDVITCFSSCLLLGNTLNNTLQQVITMQKGKVALGKILMFTSEENDFPDHRNEIIS 350

Query: 497 ---------GKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKG 547
                       +  G GEI FKNVSF+YPTRP+  + K+++          IVG SG G
Sbjct: 351 DAFILNHINANKFRCG-GEISFKNVSFSYPTRPNYHVLKNVSLNFPKNKTTFIVGKSGSG 409

Query: 548 KSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGL 607
           KSTI  LLL  Y   +G I +DG DI  + +  L   I +V+Q   L + TI++NI  G 
Sbjct: 410 KSTIGKLLLKSYGGYTGAIEVDGIDIQHIKTSWLAENITLVEQSCTLFNDTIKNNILLGC 469

Query: 608 TEEPTKEE-IRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPN 666
             +   +  +R   +       I   P   DT +G  G  LSGGQKQR+A+ARA ++   
Sbjct: 470 KGKAYGDSLVREACQMALLDRLIFDLPNGLDTVLGSGGVSLSGGQKQRVALARARVRDSP 529

Query: 667 ILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVV 726
           ILILDEA S +D+     +     +    K MT V + H L+ I   E+ +    +G + 
Sbjct: 530 ILILDEAISGMDIIHRDLLVEAIKKW--RKGMTTVIVTHELTQI-SDEDYLYFMEEGQIR 586

Query: 727 EMG 729
           E G
Sbjct: 587 ESG 589

>Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON}
            YKL209C (REAL)
          Length = 1295

 Score =  178 bits (451), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 146/502 (29%), Positives = 240/502 (47%), Gaps = 33/502 (6%)

Query: 257  SERLVARLRSVVMKHTLHQDSEFF--DVHKVGDLISRLGADSYIVSRSITQKISDGVKSL 314
            SE  +  LR+ +M+    ++  +F  + +K  + IS L  +     RS+  +    + S 
Sbjct: 789  SEYWIMDLRNEIMEKVTRKNINWFSGENNKAAE-ISALVMNDLRDLRSLVSEFLSAMTSF 847

Query: 315  ICGGVGIGMMLELSMDLSSVLVCF-VIPVVLSAS-IFGKQIRINSRELQDATGQLTRVSE 372
            I     IG++  L       LVC  + P+++  S I+G  ++    + + +  QL     
Sbjct: 848  ITVST-IGLVWALISGWKLSLVCISMFPLIIIFSVIYGSSLQTYETDYKSSVAQLENCLY 906

Query: 373  EQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLV 432
            + +  ++T++   AE      ++    ++  +  + A       + T+++       +  
Sbjct: 907  QIVTSIKTIKCLQAEFHFQLTYHDMKTKMEGIASKRAIATGFGVSMTNMIAMCIQAILYY 966

Query: 433  YGSYLVLHGSLTIGDLTA---FMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRV 489
            YG  LV+    T   + A    +L+T  +   + G      +I +G  AAS ++ + D  
Sbjct: 967  YGLKLVMVHEYTSKKMFATFTLLLFTIMSCTTLVGQ---IPDISRGQRAASWIYRILDEA 1023

Query: 490  PT----------IRPTLGKTY--TPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSN 537
                        +    G TY     K  +  +N++FAYP+ P+  I+K ++  +  G  
Sbjct: 1024 ECTLEIEDNNGRVLGISGGTYYGNSNKPIVSIQNLTFAYPSAPNISIYKRMDLNMFCGQT 1083

Query: 538  VCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSG 597
            V IVG SG GKST+ LLL   Y    G I IDG D+   N  SLRR+I+VV+Q+P L  G
Sbjct: 1084 VGIVGESGSGKSTLVLLLTGLYACKVGCIEIDGTDVNDWNLTSLRREISVVEQKPSLFDG 1143

Query: 598  TIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAI 657
            +IRDN+TYG   +    E+    K    ++F+   P + DT I  +  LLSGGQ QR+ I
Sbjct: 1144 SIRDNLTYGCLGQMPDFELYDALKYVGIYDFVASLPQSLDTRIDTN--LLSGGQAQRLCI 1201

Query: 658  ARALIKKPNILILDEATSALDVESEGAINYTFGQLMKS--KSMTIVSIAHRLSTIRRSEN 715
            ARAL++K  ILILDE TSALD  S   IN     ++K    ++  + I H    +R   +
Sbjct: 1202 ARALLRKSKILILDECTSALDSVSSRIIN----DIVKKGPPALLTMVITHNEEMMRCCSS 1257

Query: 716  IIVLGNDGSVVEMGKFKELFAD 737
            ++V   DG +VE G F  L+ D
Sbjct: 1258 VVVF-KDGKIVEEGSFDTLYND 1278

 Score =  174 bits (441), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 146/513 (28%), Positives = 237/513 (46%), Gaps = 49/513 (9%)

Query: 258 ERLVARLRSVVMKHTLHQDS-EFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKS--- 313
           ER   R+RS++++  L +   E++D ++       L  D   ++R + +  S   ++   
Sbjct: 102 ERQGFRIRSMLLEAYLKKKPIEWYDANET------LLGDFTQINRCVEELRSSSAEASAI 155

Query: 314 ------LICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQL 367
                  IC  +G       S+ L  +++C    + L A  F + I I +++    TG+ 
Sbjct: 156 TFQNLVAICALIGTSFFYSWSLTL--IILCSSPIIALFAVAFCRMIHIYTKKENTETGKA 213

Query: 368 TRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSF 427
            ++    +N  + V+ +  +  E K+F   +           FI + F+ + +  G L F
Sbjct: 214 AQLLTWSMNAAQLVRLYCTQPLERKKFEEIVSNC-----NTFFIKSCFYLAAN-AGVLRF 267

Query: 428 LTVLVY------GSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASR 481
           LT+ ++      GS ++  G L I D+          G  +         + +G  A  +
Sbjct: 268 LTLTMFVQGFWFGSTMIRKGRLNINDVITCFHSCIMLGTTLNNTLHQIVVLQKGEVALEK 327

Query: 482 LFELTDRVPTIRPTLG--KTYTP----GKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPG 535
           +  L +  P  R T    + Y P      G++ F+NVSFAYP+RP+  I ++   K   G
Sbjct: 328 IMTLLENGPK-RNTSNTIELYQPLIDYATGDLVFENVSFAYPSRPTETILQNAGIKFPGG 386

Query: 536 SNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLM 595
               IVG SG GKSTI+ LLL +Y+   G I I+G++I  +  KSL   I VV+Q   L 
Sbjct: 387 QFTFIVGKSGSGKSTISNLLLKFYDGYDGSISINGRNIQTIPQKSLIENITVVEQRCTLF 446

Query: 596 SGTIRDNITYGLTEEPTKEE---------IRTVAKQCFCHNFIVKFPYTYDTYIGPHGTL 646
           + T+++NI  G T      +         I+   +       I+  P   +T IG  G  
Sbjct: 447 NNTLKNNILLGSTGSIRNADSNTIDNNNLIKEACRMALLDRLILDLPDGLETIIGSGGIT 506

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 706
           LSGGQ+QR+AIARA I+   IL LDEA SALD+     +        K K+  I++  H+
Sbjct: 507 LSGGQQQRVAIARAFIRDTPILFLDEAISALDIVHRNLLMKAIRHWRKGKTTIILT--HQ 564

Query: 707 LSTIRRSENIIVLGNDGSVVEMGKFKELFADPT 739
           LS I  +++ + L  DG V+E G   EL  D T
Sbjct: 565 LSQI-EADDYLYLMQDGKVIESGIQSELLVDST 596

>KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1270

 Score =  177 bits (450), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 154/498 (30%), Positives = 237/498 (47%), Gaps = 33/498 (6%)

Query: 257  SERLVARLRSVVMKHTLHQDSEFF--DVHKVGDLISRLGADSYIVSRSITQKISDGVKSL 314
            SE  +  LR+  M+   +++ E+F  D +K  +L + +  D   +   I++ IS     +
Sbjct: 773  SENWIMDLRNKAMESITNKELEWFYKDENKSSELAALVLNDLRDLRSLISEFISAMSTFI 832

Query: 315  ICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQ 374
            +    G+   L     LS V +     ++L ++I+G  ++      +     L     E 
Sbjct: 833  VVSLAGLIWALTTGWKLSLVCIAMFPLIILFSAIYGSILQRYETTYKTTVADLENCVYEI 892

Query: 375  LNGVRTVQSFVAEQREIKRFNHSIREIFDVG-KRAAFINAKFFTSTSLVGDLSFLTVLVY 433
            + G++T++    EQ  I+R++     +  +G KRA         +T+LV  +  + +  Y
Sbjct: 893  MLGIKTIRCLQLEQHFIQRYSVLEARMKHIGRKRAIATGFGIAITTALVMCIEAI-LFYY 951

Query: 434  GSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYS------EIMQGAGAASRLFEL-- 485
            G  LV      IG+ T   ++  +T   +F + T  S      ++ +G  AASR+F +  
Sbjct: 952  GLKLVF-----IGEYTTMKMFKTFTL-LLFTIMTCTSLINQIPDVTRGQRAASRIFRILD 1005

Query: 486  -TDRVPTIRPTLGKTYTPGKGE-----IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVC 539
             +DR        G+T    K       I   N+ F YP+  S+ +F  LN +I     V 
Sbjct: 1006 ESDRFLEDSDEHGRTRGIPKNNSIKSIITINNLQFHYPSAESSNVFNRLNLQIADNQTVA 1065

Query: 540  IVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTI 599
            +V  SG GKST+  LL   Y      I IDG DI +    SLR  IA+V+Q+P L  G+I
Sbjct: 1066 VVAESGSGKSTLLYLLTRLYKVDFNSIFIDGTDINEWQLTSLRNLIAIVEQKPTLFEGSI 1125

Query: 600  RDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIAR 659
            R N+ YG   E    +I  V KQ    +F+   P   DT +    +LLSGGQ QRI IAR
Sbjct: 1126 RKNLIYGNKLEIMDMDIYDVLKQVGIFDFVTSLPNGIDTNVDT--SLLSGGQAQRICIAR 1183

Query: 660  ALIKKPNILILDEATSALDVESEGAINYTFGQLMKS--KSMTIVSIAHRLSTIRRSENII 717
            AL++K  ILILDE TSALD ES     +    L+KS    +  ++I H    +R   N+I
Sbjct: 1184 ALLRKSKILILDECTSALDAESA----FVIQNLVKSGLPGVLTIAITHSEPMMRACGNVI 1239

Query: 718  VLGNDGSVVEMGKFKELF 735
            VL  DG   + G F EL+
Sbjct: 1240 VL-QDGETAQQGTFDELY 1256

 Score =  134 bits (336), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 133/504 (26%), Positives = 238/504 (47%), Gaps = 58/504 (11%)

Query: 263 RLRSVVMKHTLHQDSEFFDVHK--VGDLISRLGADSYIVSRS-----ITQKISDGVKSLI 315
           R+R  ++   L +  E+FD +   +GD +        + S S     IT +    + +L+
Sbjct: 103 RIRRTILLSYLKKPMEWFDENDQLLGDFVQMHRCVEEVRSGSAEASAITFQNFVAIIALV 162

Query: 316 CGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQL 375
           C           S  L+ +++C    +++ A+ F + I   ++   D TG   +     +
Sbjct: 163 CTS------FYYSWSLTLIILCSSPLLIVLAAFFSRMIENFTKLENDETGIAAQSLTWSM 216

Query: 376 NGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTS--TSLVGDLS---FLTV 430
           N  + V+ +  +  EIK+F   +    D      FINA F+ S  TS++  LS   F+  
Sbjct: 217 NAAQLVKLYCTQDFEIKKFKEIVIRCNDY-----FINAWFYVSANTSILRFLSLAMFVQG 271

Query: 431 LVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFG--LSTFYSEIMQ------GAGAASRL 482
             +GS ++    +++  +      T ++   + G  L+T   +I+       G       
Sbjct: 272 FWFGSTMIKKNKMSVDQVI-----TCFSSCLMLGSILNTTLPQIVLLQKAHVGLNRVQDF 326

Query: 483 FELTDRVPTIR---PTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVC 539
            E    + T R    ++     P    I F  +SF YP+RP + + K+++    P     
Sbjct: 327 LEDKSEMATDRDRQTSINLDNVPIS--ISFDAISFCYPSRPDDMVLKNISMNFDPNKTTF 384

Query: 540 IVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTI 599
           IVG SG GKST++ LLL +YN  +G I ++G ++  ++   + + + +V+Q+  L + T+
Sbjct: 385 IVGKSGSGKSTMSNLLLKFYNGYNGCIKVNGVNVQSIDRHWITKNVTLVEQKCTLFNDTL 444

Query: 600 RDNITYGLTEEPTKEEIRT-VAKQC---FCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRI 655
           R+N+  GL+     E++ + + + C      N I K P   DT +G  G  LSGGQ+QR+
Sbjct: 445 RNNLLIGLSHISAAEDVDSRLQEACRFALLDNVIEKLPSGLDTKVGSGGVSLSGGQQQRV 504

Query: 656 AIARALIKKPNILILDEATSALDVESEGAINYTFGQLMK-----SKSMTIVSIAHRLSTI 710
           A+ARA ++   ++ILDEA SALD  +         QLM+     ++S T + + H L+ I
Sbjct: 505 ALARAYLRDTPVVILDEAISALDARNR-------RQLMENIRIWTRSKTAIILTHELNQI 557

Query: 711 RRSENIIVLGNDGSVVEMGKFKEL 734
             S+ + ++ N G + E G   EL
Sbjct: 558 LPSDFLYLMEN-GQIKEEGYQNEL 580

>Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON}
            YKL209C (REAL)
          Length = 1290

 Score =  177 bits (449), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 140/496 (28%), Positives = 237/496 (47%), Gaps = 25/496 (5%)

Query: 257  SERLVARLRSVVMKHTLHQDSEFF--DVHKVGDLISRLGADSYIVSRSITQKISDGVKSL 314
            SE  +  LR+ +M     ++  +F  + +K  ++ + +  D   +   +++ +S     +
Sbjct: 789  SEYWIMDLRNKIMDKLTRKNINWFSGESNKASEITALVLNDLRDLRSLVSEFLSAMTSFV 848

Query: 315  ICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQ 374
                +G+   L     LS V +     +V+ ++I+G  ++    + + +  QL     + 
Sbjct: 849  TVSTIGLVWALVSGWKLSLVCISMFPLIVIFSAIYGGILQKYETDYKTSVAQLENCLYQI 908

Query: 375  LNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYG 434
            +  ++T++   AE      ++   +++  +  + A       + T+++       +  YG
Sbjct: 909  MTSIKTIKCLQAEFHFQLSYHDLKKKMEQIAYKRAIATGFGISVTNMIAMCIQAILYYYG 968

Query: 435  SYLVL---HGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDR--- 488
              LVL   + S  + +    +L+T  +  ++ G      +I +G  AAS ++ + D    
Sbjct: 969  LKLVLVHEYTSKKMFETFTLLLFTIMSCTSLVGQ---IPDISRGQRAASWIYRILDEEED 1025

Query: 489  VPTIRPTLGKTYTPGKGE---------IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVC 539
               I     +       E         I  +N+SFAYP+ P+  IFK ++  +     + 
Sbjct: 1026 TLEIENNDARALDISGAEYYGDRNIPIISIRNLSFAYPSAPNVPIFKHMDLDMFCEQTIG 1085

Query: 540  IVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTI 599
            IVG SG GKST+ALLL   YN  +  I+IDG D+   N  SLR+QI+VV+Q+P    G+I
Sbjct: 1086 IVGESGSGKSTLALLLTRLYNCEANSIIIDGTDVNDWNLTSLRKQISVVEQKPSFFDGSI 1145

Query: 600  RDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIAR 659
            RDN+TYG   E  + EI  V K    ++F+   P   DT +  +  LLSGGQ QR+ IAR
Sbjct: 1146 RDNLTYGCLGEMLEVEIYDVLKYVGIYDFVASLPQGLDTRVDTN--LLSGGQAQRLCIAR 1203

Query: 660  ALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVL 719
            AL++K  ILILDE TSALD  S   IN    +      +  + I H    +R   +I VL
Sbjct: 1204 ALLRKSKILILDECTSALDSVSSRIINDIVRK--GPPGLLTLVITHSEQMMRCCNSIAVL 1261

Query: 720  GNDGSVVEMGKFKELF 735
             + G VVE G F  L+
Sbjct: 1262 KH-GKVVEEGNFDNLY 1276

 Score =  150 bits (380), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 132/449 (29%), Positives = 207/449 (46%), Gaps = 43/449 (9%)

Query: 315 ICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQ 374
           IC  +G       S+ L  +++C    + + A IF + I   +++    T    ++    
Sbjct: 163 ICALIGTSFYYSWSLTL--IILCSSPVITIFAVIFSRLIHTYTQKENTETSNAAQLFTWS 220

Query: 375 LNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVY- 433
           +N  + V+ +  +  E ++F   I     +     FI +  + + +  G L FLT+ ++ 
Sbjct: 221 MNAAQLVRLYCTQPLERQKFQEII-----LSCNTFFIKSCLYVAAN-AGILRFLTLTMFV 274

Query: 434 -----GSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQ------GAGAASRL 482
                GS ++  G L I D+      T +    + G ST  S + Q      G  A  ++
Sbjct: 275 QGFWFGSTMIRKGKLNINDVI-----TCFHSCIMLG-STLNSTLHQIVVLQKGEVALQKI 328

Query: 483 FELTD-----RVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSN 537
             L +          R  L         ++ F+NVSFAYP+RPS  + +++N K   G  
Sbjct: 329 MALLESGSKQNASNTREHLQPPLNFATSDLVFENVSFAYPSRPSETVLQNVNLKFPSGQF 388

Query: 538 VCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSG 597
             IVG SG GKSTI+ LLL++Y+   G ILI+G++   +  K L   I VV+Q   L + 
Sbjct: 389 TFIVGKSGSGKSTISNLLLNFYDNYDGSILINGRNTQSIQQKLLVSNITVVEQRCTLFND 448

Query: 598 TIRDNITYGLTEEPTKEEIRTV---------AKQCFCHNFIVKFPYTYDTYIGPHGTLLS 648
           T++ NI  G T      +  T+          +       I+  P   +T IG  G  LS
Sbjct: 449 TLKKNILLGSTGSIGNADTNTIGNNNLIKDACRMALLDRLILDLPDGLETLIGSGGVSLS 508

Query: 649 GGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLS 708
           GGQ+QR+AIARA I+   IL LDEA SALD+     +        K K+  I++  H LS
Sbjct: 509 GGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGKTTIILT--HELS 566

Query: 709 TIRRSENIIVLGNDGSVVEMGKFKELFAD 737
            I   +++ V+  +G VVE G   EL AD
Sbjct: 567 QIESDDHLYVM-QEGRVVESGIQSELLAD 594

>NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1.527
          Length = 1288

 Score =  175 bits (444), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 147/503 (29%), Positives = 249/503 (49%), Gaps = 41/503 (8%)

Query: 257  SERLVARLRSVVMKHTLHQDSEFF--DVHKVGDLISRLGADSYIVSRSITQKISDGVKSL 314
            SE  +  LR+  M+  L++D  +F  D +K  +L + L  D   +   +++ +S     +
Sbjct: 786  SENWIMDLRNEAMESILNKDLFWFSKDTNKSSELSALLLNDLRDLRSLVSEFLSAMTTFM 845

Query: 315  ICGGVGIGMMLELSMDLSSVLVCF-VIPVVLS-ASIFGKQIRINSRELQDATGQLTRVSE 372
            +   +G+   L     LS  LVC  + P++++ ++++G  ++      + +   L     
Sbjct: 846  VVSLIGLIWALVSGWKLS--LVCLSMFPLIIAFSAVYGTMLQKYETTYKTSVAALENQEY 903

Query: 373  EQLNGVRTVQSFVAEQREIKRFN---HSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLT 429
            E + G++T++S  AE   IK ++   H++R I    KR+  I   F  S + +  +   +
Sbjct: 904  EIMTGIKTIRSLQAESHFIKNYSGLEHNMRAI--AHKRS--IATGFGISVTNMITICIQS 959

Query: 430  VLVY-GSYLVLHG---SLTIGDLTAFMLYTEYTGNAIFGL----------STFYSEIM-Q 474
            +L Y G  LV  G   S  + +    +L+T  T  ++             +TF   I+ +
Sbjct: 960  ILYYYGIKLVFEGEYSSKKMFETFTLLLFTIMTCTSLVNQIPDISRGQRSATFLYRILDE 1019

Query: 475  GAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKP 534
            G  +    FE   +   + P   K  +     I+ +N++FAYP+  +  +++ LN ++  
Sbjct: 1020 GLASDESEFETHRKAEIVAP---KQESKSNPLIKIQNLTFAYPSETNVNVYEDLNLEMHA 1076

Query: 535  GS-NVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPV 593
                + +VG SG GKST+  LL   Y      I +DG D+      +LR QI+VV+Q+P 
Sbjct: 1077 SEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIYLDGTDVNDWGLMNLRTQISVVEQKPT 1136

Query: 594  LMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQ 653
            L  GT+R+N++YG++ +    E+  + K    + F+   P+  DT I     LLSGGQ Q
Sbjct: 1137 LFDGTVRENLSYGISTDILDMELFDMLKYVGIYEFVESLPFGLDTRIDTK--LLSGGQAQ 1194

Query: 654  RIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKS--KSMTIVSIAHRLSTIR 711
            RI IARAL++KP ILILDE TSALD  S   I      ++K+   ++  + I H    +R
Sbjct: 1195 RICIARALLRKPKILILDECTSALDALSANII----IDIVKNGPPALLTIVITHSEKMMR 1250

Query: 712  RSENIIVLGNDGSVVEMGKFKEL 734
                I VL N G ++E G FKEL
Sbjct: 1251 ACNTIAVLKN-GKIIEKGGFKEL 1272

 Score =  140 bits (353), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 119/434 (27%), Positives = 211/434 (48%), Gaps = 34/434 (7%)

Query: 321 IGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDA-TGQLTRVSEEQLNGVR 379
           IG     S  L+ +++C   P++++ ++F   +     EL++  TG+  +++   ++ ++
Sbjct: 168 IGTSFYYSWSLTLIILC-TAPIIIAFAVFFSHMIHKYTELENTETGKAAQLANWAMDSIQ 226

Query: 380 TVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTS--TSLVGDLS---FLTVLVYG 434
            V+ +  + RE++ F        D+     FI    + S  T+L+  LS   F+    +G
Sbjct: 227 LVKLYCTQFREVRNFRELTSNCNDL-----FIKCCLYVSANTALLRFLSLSMFIQGFWFG 281

Query: 435 SYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFE-LTDRV---- 489
           + +V  G L I ++          G+ +         + +G  A  ++   L+  V    
Sbjct: 282 ATMVRKGKLQISNVVTCFQSCLMLGSTLSNTLQVIVILQKGDVALKKILGFLSTSVDHGA 341

Query: 490 --PTIRPTLGKTYTPGK-GEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGK 546
             P   P      TP +   I F N++F+YP+RPS+ + K+++   +P     I+G SG 
Sbjct: 342 DEPIYEPE-----TPAELCTIAFNNITFSYPSRPSHPVLKNVSLCFEPTKFTFIIGKSGS 396

Query: 547 GKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYG 606
           GKST++ LLL +Y+  +G I + G D+ ++N   L   + VV+Q   L + T+R+NI  G
Sbjct: 397 GKSTLSNLLLKFYDDYNGTITVKGNDVKEINRNWLLNNVTVVEQRCTLFNDTLRNNILLG 456

Query: 607 LTE------EPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARA 660
           +++      E  +++++           +   P+  +T IG  G  LSGGQ+QR+AIARA
Sbjct: 457 VSKDQLEDHESIEQKLKDACSISMLDRLVCDLPHGLNTIIGSGGISLSGGQQQRVAIARA 516

Query: 661 LIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLG 720
            ++   ILILDEA SALD+     +     Q    K  T + + H LS I   +   V+ 
Sbjct: 517 FMRNKPILILDEAVSALDIIHRELLMKNIRQWRSGK--TTILLTHELSQIEPDDYTYVI- 573

Query: 721 NDGSVVEMGKFKEL 734
            +G V E G  K+L
Sbjct: 574 QEGEVKENGYQKDL 587

>ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1273

 Score =  174 bits (440), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 131/419 (31%), Positives = 204/419 (48%), Gaps = 26/419 (6%)

Query: 331  LSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQRE 390
            LS V +     +V+ + I+G  ++    E ++   +L  V  E + G++T++    E   
Sbjct: 852  LSLVCISMFPLLVIFSMIYGILLKKYETEYKNTIAKLENVQYEVVTGMKTIRCLQIEDHF 911

Query: 391  IKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSY-LVLHGSLTIGDLT 449
              +FN   +    +G+R A +   F  + S    +S   +L Y +  LV+HG  T   + 
Sbjct: 912  KAKFNVLKQTAKLMGQRRAIVTG-FGVAVSNGLTMSIQGILYYYAIKLVIHGEYTTKKMF 970

Query: 450  ---AFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPT----------IRPTL 496
                 +L+T  T N    L     +I +G  AAS+++ + + +            I P +
Sbjct: 971  ETFTLLLFTIMTCN---NLVNQIPDIRRGQRAASKIYRILEGIDESECFETEGHRIVPIV 1027

Query: 497  GKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLL 556
                 P    I F ++SFAYPT P+ +I K L+ +I  G  + IVG SG GKST+  ++ 
Sbjct: 1028 ENPTGP---IIRFNDLSFAYPTAPTVKILKHLSMEIYSGDRIAIVGESGCGKSTLVNIIT 1084

Query: 557  HYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEI 616
              Y   S  + +D  D+       LR QIAVV+Q+P L  GTIR+N+ YG        ++
Sbjct: 1085 RLYECPSNSLFVDNTDVNDWALPKLREQIAVVEQKPTLFKGTIRENLVYGSPLGTADVDV 1144

Query: 617  RTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSA 676
              + K    ++F    P   +T I     LLSGGQ QR+ IARAL+++P ILILDE TSA
Sbjct: 1145 FNMLKYVGIYDFFATLPEGLETKI--DSGLLSGGQNQRLCIARALLQRPKILILDECTSA 1202

Query: 677  LDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELF 735
            LD  S   IN    +     +M  +SI H    +R    + VL + G +VEMG  ++L 
Sbjct: 1203 LDTMSSHIINEIIRE--GPPTMLTISITHDEQMVRACNKVAVL-DQGHIVEMGNREDLL 1258

 Score =  154 bits (389), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 123/422 (29%), Positives = 200/422 (47%), Gaps = 23/422 (5%)

Query: 328 SMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAE 387
           S  L+ V +C    +VL A  F + I I S +    T   +++    +   + V+    +
Sbjct: 162 SWSLTLVTMCGAPVIVLCAIFFSRLIHIYSEKENSHTAISSQLLSWSMEAAQLVRLSCMQ 221

Query: 388 QREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVY------GSYLVLHG 441
             E++ F  ++++         F+    + S +    L FLT+ ++      GS ++   
Sbjct: 222 LVEVQNFQLAVKKC-----SKNFMKMCLYASAN-TAILKFLTLTIFVQAFWFGSTMIRKH 275

Query: 442 SLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLG---K 498
            L I D+          G  I G       + +G      + E   +   ++       +
Sbjct: 276 KLRIEDVITCFQSCVLLGATINGTLHQIVILQKGKVGVINVNEFLKKDEYLKEDFKNNRR 335

Query: 499 TYTPG--KGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLL 556
            Y  G    +IE +NV F YP+RP+    K+++  +  G    +VG SG GKS++  LLL
Sbjct: 336 FYLDGGISEKIELRNVQFNYPSRPTVPALKNVSLTLPVGKITYVVGKSGSGKSSLGNLLL 395

Query: 557 HYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGL--TEEPTKE 614
             Y+  +G I IDG DI  ++ KS+ + I +V+Q   L + T+R+NI +G   T+E  ++
Sbjct: 396 KLYDDYNGSISIDGIDIKGIDQKSILKNITLVEQRCTLFNDTLRNNILFGSKETDELVRD 455

Query: 615 E-IRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEA 673
           E ++   +     NFI   P   DT IG  G   SGGQ+QRIAIARA ++   IL+LDEA
Sbjct: 456 ESLKAACRISLLDNFIYDLPEGLDTLIGTGGITPSGGQQQRIAIARAYMRDTPILVLDEA 515

Query: 674 TSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKE 733
            SALD+   G +          K+  I++  H LS I   +++I L  DG VVE G+ + 
Sbjct: 516 VSALDIIHRGLLMNAIRNWRSEKTTIILT--HDLSEI-GPDDMIYLLEDGEVVEQGQQRN 572

Query: 734 LF 735
           L 
Sbjct: 573 LL 574

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score =  173 bits (439), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 133/429 (31%), Positives = 213/429 (49%), Gaps = 20/429 (4%)

Query: 321  IGMMLELSMDLSSVLVCF-VIP-VVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGV 378
            IG++  +++     LVC  +IP VV+   ++G  +       + +   L  +  E + G+
Sbjct: 797  IGLVWAIAIGWKLSLVCIAIIPLVVVLTGLYGTILIKTENRYKTSVANLESIVYEAIIGM 856

Query: 379  RTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLV 438
            +T+QS   +Q   K+FN  I+ +   G   A         T+++  L    +  YG  LV
Sbjct: 857  KTIQSLCLQQYITKKFNCKIKLLEKNGTYRAVATGLGIALTNMLVLLFQSILFYYGFKLV 916

Query: 439  LHGSLTIGDL---TAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELT--DRVPTIR 493
            L G  T   L    A +L+T  T   +  L T   +I +G  + S + ++   D   TI 
Sbjct: 917  LTGEYTHSKLFETIALLLFTIVT---VASLVTQLPDITRGQRSISWIDQILKGDNQQTIE 973

Query: 494  P-----TLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGK 548
            P     T    + P +  IE  N+SF Y    + +   ++N ++       IVG SG GK
Sbjct: 974  PPSNLSTTKGIWNPNQPVIEVSNLSFTYAQVHNKKTLTNINMQLYSNQIYGIVGKSGSGK 1033

Query: 549  STIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLT 608
            ST+  L+   Y+ + G I I   DI K ++K L + +A++QQ PVL   TIR+N+ YGLT
Sbjct: 1034 STLINLICGLYSLSEGSINICSCDINKWSTKELHKTVALLQQNPVLQFDTIRNNLLYGLT 1093

Query: 609  EEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNIL 668
            E    E +  V +     +FI+      D+ +    +LLSGGQ QR+ +AR +++ P +L
Sbjct: 1094 ETVGDEHLLNVLEYVGLKSFIISLNNGLDSKL--DDSLLSGGQSQRLCMAREMLRNPKVL 1151

Query: 669  ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEM 728
            ILDE TSALDV S   IN   G   +S +   + ++H+  TI+  + I  L  DG+V  M
Sbjct: 1152 ILDECTSALDVTSAKKINDIIGS--RSLAPVTIIVSHQKETIKLCDKIFFLV-DGTVAMM 1208

Query: 729  GKFKELFAD 737
            G ++EL  +
Sbjct: 1209 GTYEELMEN 1217

 Score =  163 bits (413), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 128/418 (30%), Positives = 199/418 (47%), Gaps = 23/418 (5%)

Query: 312 KSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQI-RINSRELQDATGQLTRV 370
           +SL+     IG     S  L+ ++ C    +++ A IF K I +   +E  ++     R+
Sbjct: 156 QSLVAVIALIGTAFYFSWSLTLIIFCSTPFIIICAVIFSKYIHKYTEKENTESECAAERL 215

Query: 371 SEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAA-FINAKFFTSTSLVGDLSFLT 429
           +   L  +  V+    +  EI  + H I +  +   +A+ FI+A       L   + F+ 
Sbjct: 216 AW-MLKNIEFVRLHNGDDFEISMYTHYIAQANEYYIKASLFISANISILRLLSLLM-FVQ 273

Query: 430 VLVYGSYLVLHGSLTIGD-LTAF--MLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELT 486
              +GS ++  G L I   +T+F   L      N+  G +     + +G  A  RL ++ 
Sbjct: 274 GFWFGSSMIKQGKLNIDSVITSFHCCLMLGSIINSALGQAVV---LQKGDVAMKRLLKMI 330

Query: 487 DRVPT-----IRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIV 541
           DR P      I    G    P    I F NVSF YP R ++++F  +NF IKP     ++
Sbjct: 331 DRTPRESLAFIDAISGIDLLP----IVFNNVSFCYPERKTDKVFDKMNFIIKPNKMTYVI 386

Query: 542 GPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRD 601
           GPSG GKST+  L+L +Y+   G I++   DI  +N   +   I +V Q P L + TIR+
Sbjct: 387 GPSGSGKSTLFDLILLHYDNYHGSIMLGDLDIRSINRNIILENITLVSQTPTLFNDTIRN 446

Query: 602 NI--TYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIAR 659
           NI      T  P+K E+  + K     N I + P   DT IG  G  LSGGQ Q++A+AR
Sbjct: 447 NILACSNWTNLPSKLEMECICKFALLENLIAELPDGLDTRIGSGGIKLSGGQAQKVALAR 506

Query: 660 ALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENII 717
           A  +  +IL+LDE  SA+D+     +     +    K  T V I H L  IR ++NI+
Sbjct: 507 AFARNTSILLLDEPLSAVDMRQRIVLMENIKRWRNGK--TTVIITHDLEFIRNTDNIL 562

>TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_1.527
            YKL209C
          Length = 1296

 Score =  171 bits (432), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 139/524 (26%), Positives = 242/524 (46%), Gaps = 29/524 (5%)

Query: 222  IMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFD 281
            I+ G+T+ + +  F     +G              SE  +  LR   MK  L +  ++F 
Sbjct: 774  IVIGITIIDGISNFFKGFLLGIC------------SEYWIMDLRDKFMKEILRKKIQWFS 821

Query: 282  VHKVGDL-ISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVI 340
              K     +S L  +     RS+  +    + + I   +  G++  L       LVC  +
Sbjct: 822  DEKYQTAEMSALILNDLRDLRSLVSEFMSAMATFIVVSL-FGLIWALVTGWKLALVCIAM 880

Query: 341  --PVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSI 398
               +++ ++I+G  ++ +  + + +   L  +  + ++ ++T++S   E      +  + 
Sbjct: 881  FPLIIIFSAIYGAVLQKSETDYKSSVANLENIEFDIVSNIKTIKSLQLEGHFYHNYKVAE 940

Query: 399  REIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYT 458
             ++ +V  + +       + T+ +       +  YG  L++ G  T+  +        +T
Sbjct: 941  TKLKNVATKRSIYTGLGISITNTITMCIQAILYYYGFKLIMDGEYTVKQMFTTFTLLLFT 1000

Query: 459  GNAIFGLSTFYSEIMQGAGAASRLFELTDRV--------PTIRPTLGKTYTPGKGEIEFK 510
                  L     ++ +G  AAS ++ +  +         P        T +     ++ K
Sbjct: 1001 VMTCNSLVNQIPDMSRGQRAASWVYSILQQSDDTKEVNDPNSIIVDNNTISNDFPILDIK 1060

Query: 511  NVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG 570
            N++FAY + PS ++   L  K+ PG  + I G SG GK+T+  LL+ +Y+    QI  +G
Sbjct: 1061 NLTFAYESTPSIKVLDGLTLKLFPGDKLAIAGESGCGKTTLLSLLVKFYDVDPNQIYFNG 1120

Query: 571  QDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIV 630
            +DI     +SLR  I +V+Q+P ++SG+IRDN+        +  E+  V K     +FI 
Sbjct: 1121 KDILNYEFESLRDAIVIVEQKPSVLSGSIRDNLLGNNKRLISDYELYDVLKLTGIFDFIE 1180

Query: 631  KFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFG 690
              P   DT I    TLLSGGQ QRI IARAL++KP ILILDE TSALD  S   IN    
Sbjct: 1181 TLPSGIDTIIDT--TLLSGGQAQRICIARALLRKPKILILDECTSALDAMSADIINNLVS 1238

Query: 691  QLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
            + +    +TI+SI H  S +   +N+ VL N G +VE+G +  L
Sbjct: 1239 KEL--NGVTIISITHSESMMTSCQNVAVLKN-GKIVEVGTYDSL 1279

 Score =  167 bits (423), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 134/502 (26%), Positives = 233/502 (46%), Gaps = 35/502 (6%)

Query: 258 ERLVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKS---- 313
           ER   ++R+ ++ + L Q   ++D+++      +L  D   + R + +  S   ++    
Sbjct: 108 ERQGIKVRTKILNNYLTQSMTWYDLNE------QLQGDFTQLHRCVEELRSSSAEASAVT 161

Query: 314 ---LICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRV 370
               I     I      S  L+ +++C    + + +  F   I+  +    + T    ++
Sbjct: 162 FQNCIAIIALIATSFYYSWSLTLIILCSTPIICIFSICFSIMIQKFANLENNETTVSAQI 221

Query: 371 SEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTS--TSLVGDLSFL 428
             E +  ++ ++    + +++ +F  SI +         FI    + S  TS++  L+ L
Sbjct: 222 FTETIQNIQLIKLNNLQLKKLMKFQTSISKC-----NKFFIQMCLYVSLNTSILRTLTLL 276

Query: 429 TVL---VYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFEL 485
             +    +GS ++  G L I ++          G+ I         + +G  A  ++ + 
Sbjct: 277 MFVQGFWFGSTMIRKGHLKIDEVITCFSSCLLLGSIISNTLHQIVVLQKGEVALQKIVDF 336

Query: 486 TDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSG 545
            D             T     I F+N+SFAYP+RP+  I   +N   +  +   IVG SG
Sbjct: 337 LDEADDPLEINSAPITLINSNISFQNISFAYPSRPNENILNQINLYFQNSATTFIVGKSG 396

Query: 546 KGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITY 605
            GKST++ LLL +Y    G ILID  +I  LN K+L   I +V+Q+  L + TIR+NI +
Sbjct: 397 SGKSTLSNLLLKFYETYKGDILIDNINIKNLNQKNLLDNIMIVEQKCTLFNDTIRNNILF 456

Query: 606 GLTEEPTK---------EEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIA 656
           G++    +         E ++         +F++  P   DT IG  G  LSGGQ+QR+A
Sbjct: 457 GVSNFTNQYASNRPNLNERLKNACTFALLDHFLIDLPNGIDTVIGTGGITLSGGQQQRVA 516

Query: 657 IARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENI 716
           +ARA ++ P ILILDEA SALDV     +     +L +S   TI+ + H L+ I   + +
Sbjct: 517 LARAYMRDPPILILDEAVSALDVNIRELLMKAI-KLWRSNKTTII-LTHDLTQIDNDDFL 574

Query: 717 IVLGNDGSVVEMGKFKELFADP 738
            V+ + G ++E GK KEL  DP
Sbjct: 575 YVIKH-GRIIEHGKRKELITDP 595

>KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} similar
            to uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1271

 Score =  166 bits (419), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 136/492 (27%), Positives = 244/492 (49%), Gaps = 21/492 (4%)

Query: 257  SERLVARLRSVVMKHTLHQDSEFFDV--HKVGDLISRLGADSYIVSRSITQKISDGVKSL 314
            SE  + RLR   M     +  ++F +  +   +L S +  D   + R +  +    + +L
Sbjct: 773  SEVWIERLRVDAMAKISSKSLDWFKLPTNNSSELNSLMMNDLRDL-RGLASEFLSAITTL 831

Query: 315  I-CGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEE 373
            +    +G+   L     LS V +      +L + I+G  +++     +    +L     E
Sbjct: 832  VFVASIGLIWALVSGWKLSLVCISLFPAFILFSGIYGSLLQVYETAYKTEIAELETRVHE 891

Query: 374  QLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVY 433
             +  ++T++    +Q     F   + ++  V K+ +         T+ +  +    +  +
Sbjct: 892  LVISMKTIKLLQLQQHFEGSFKTQLAKVRIVCKKRSVAVGFGIAVTNALAMVVQAILFFF 951

Query: 434  GSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIR 493
            G  LV+ G  ++  +        ++      L     EI +G  AA+ +F++ +   ++ 
Sbjct: 952  GIKLVIQGEYSVAQMFETFTLLLFSIMTCVSLINQVPEISRGQRAATYIFKVLEDSGSVD 1011

Query: 494  -----PTLGKTY--TPGKGE-IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSG 545
                 P+  +++  T G  E I+  N+SFA+ + P N+IF SL+ +I     V IVG SG
Sbjct: 1012 TSKPDPSQNQSFFSTAGNRETIKISNLSFAFSSAPMNKIFNSLSCEICLNETVGIVGESG 1071

Query: 546  KGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITY 605
             GKST++LLL   Y   SG++ I G DI K +  +LRR I++V+Q+P    GT+R+N+ Y
Sbjct: 1072 SGKSTLSLLLTRLYPVPSGKVYIGGIDINKWDEYALRRTISIVEQKPKFFDGTVRENLVY 1131

Query: 606  GLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKP 665
            GL    +  E+R+V K     +F+   P   +T +  H  L+SGGQ QR++IAR L+++P
Sbjct: 1132 GLKRNVSNSELRSVLKSVDLLSFVQTLPNDLNTRV--HDGLMSGGQAQRLSIARTLLRQP 1189

Query: 666  NILILDEATSALDVESEGAINYTFGQLMKS--KSMTIVSIAHRLSTIRRSENIIVLGNDG 723
             I+ILDE TSALD  +  AI     +L+++  K++T++ I H    ++  + ++VL   G
Sbjct: 1190 KIIILDECTSALDAANSFAI----AELIRTVLKNVTVIVITHSEQLMQICDRVLVL-KKG 1244

Query: 724  SVVEMGKFKELF 735
             V E G + ELF
Sbjct: 1245 KVKEEGSYAELF 1256

 Score =  159 bits (403), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 88/234 (37%), Positives = 139/234 (59%), Gaps = 4/234 (1%)

Query: 505 GEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG 564
           G+IEF++VSFAYPTRP + + K+++ KIK G+   IVG SG GKST+A LLL  Y   +G
Sbjct: 355 GDIEFRDVSFAYPTRPDDYVLKNVSIKIKSGATCFIVGKSGSGKSTLASLLLKMYGEYTG 414

Query: 565 QILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCF 624
           +I     +I  L+   L   I +V+Q   L +GT++DN+T  + +  +  E++   +   
Sbjct: 415 EIKFGEYEIDSLDDSWLVENITLVEQRCTLFNGTLKDNLTI-VNKYASCTEVKQACQFAL 473

Query: 625 CHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGA 684
            +  ++  P   DT +G HG  LSGGQ+QR+A+ARA ++   +LILDE+ SALD+ S   
Sbjct: 474 LNTVLLNLPNGIDTLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSREL 533

Query: 685 INYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADP 738
           I        K K+  I++  H  + I+  E + ++ ++G+VVE G   +L  +P
Sbjct: 534 IVEAIRHWRKGKTTIILT--HEYTQIKDDEYVYLM-SEGTVVESGFKYDLLENP 584

>AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKL209C (STE6)
          Length = 1284

 Score =  165 bits (418), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 140/489 (28%), Positives = 236/489 (48%), Gaps = 18/489 (3%)

Query: 257  SERLVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLIC 316
            SE+ V +LR  +M+  L +D  +   +K  + I+ L  +     R++T  +   + S +C
Sbjct: 789  SEQCVRQLRGNMMQLVLKRDLHWISQNKSSE-ITALTMNDLRDLRNVTSILLSSLTS-LC 846

Query: 317  GGVGIGMMLELSMDLSSVLVCF-VIPVVLSA-SIFGKQIRINSRELQDATGQLTRVSEEQ 374
                +G++  + +     LVC  ++P+ +   +++G  ++ +  + + A  QL  +  E 
Sbjct: 847  VLASVGLIWAIVIGWKLTLVCLSLLPLFIGVITLYGMFVQKSEVQYKTAVSQLENLLSEI 906

Query: 375  LNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYG 434
            + GV+T++    E     R+    + +    +R + +       TS +  L    +  YG
Sbjct: 907  VKGVKTIKCLQLEPYFQGRYATMEKYLKKQMRRRSILYGSGLAITSCLVILLQTILYYYG 966

Query: 435  SYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRP 494
              LV+ G      L        +T  +  GL +      +G  A + +F + +  P   P
Sbjct: 967  IRLVVTGEYDSKQLFQTFTLILFTTMSSVGLLSALPSSSRGQRAGTFVFGMLEE-PLPEP 1025

Query: 495  -----TLGKTYT---PGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGK 546
                  L K  T     +  +  + ++FAYP     QI+K+ N +I  G+ V IVG SG 
Sbjct: 1026 DNYSAVLRKAPTNHFSREPLVVLRALNFAYPAAKDVQIYKNFNLRINQGTKVAIVGESGS 1085

Query: 547  GKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYG 606
            GKST+  L+   Y      + IDG DI      +LR+ IAVV+Q+P   +GTIR+N+ YG
Sbjct: 1086 GKSTLFYLICGLYPVKPASLFIDGTDICNWEMSALRKIIAVVEQKPRFFNGTIRENLVYG 1145

Query: 607  LTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPN 666
            L    T  EI  V  +    NF+   P   +T +  +  L+SGGQ QR++I RAL+++P 
Sbjct: 1146 LEGTITDNEIYEVLAEVRIINFVRSLPEGLETRVDTN--LVSGGQLQRLSIVRALLRRPT 1203

Query: 667  ILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVV 726
            +LILDE TSALD  +  AI       +    +T++ I H    ++  + I+VL N G+V 
Sbjct: 1204 LLILDECTSALDAANANAIANVVRNSL--HDITVIVITHSKQMMKMCDRIVVLKN-GAVA 1260

Query: 727  EMGKFKELF 735
            E G F +LF
Sbjct: 1261 EDGSFDDLF 1269

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 100/387 (25%), Positives = 173/387 (44%), Gaps = 39/387 (10%)

Query: 375 LNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLS-------- 426
           LN    V+ F  +  E+++FN ++            ++ K+F  T +   ++        
Sbjct: 218 LNSATMVKLFGTQDLELRKFNKAVN-----------LSKKYFVRTLICSSINQAAMRFLS 266

Query: 427 ---FLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLF 483
              F+    YGS L+    +    +      +    ++I  + +    + +G  A  ++ 
Sbjct: 267 LMMFVQAFWYGSILIQRDEVETAAVITVFSASVLLSSSINAMLSKVVLLQKGKVACRQIA 326

Query: 484 ELTDRVPTIRPT-LGKTYTPGK--------GEIEFKNVSFAYPTRPSNQIFKSLNFKIKP 534
           E  +  P  RP      Y  G          EI F  VSF YP RP  +    ++   +P
Sbjct: 327 EAVNVEPEGRPNQYAFPYEVGHIIALEDQPSEIVFDQVSFNYPARPDTKALDGVSLTFRP 386

Query: 535 GSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVL 594
                IVG SG GKST+  LLL +Y+   G I ++  ++  ++   L + I +V+Q   L
Sbjct: 387 NQITFIVGKSGSGKSTLGNLLLKFYSDYEGIITVNSTNLRGIDRSWLLQNITLVEQSCTL 446

Query: 595 MSGTIRDNITYGLTEEPTKEEIRTVAKQC---FCHNFIVKFPYTYDTYIGPHGTLLSGGQ 651
            +GT+ +NIT  L+ +P  +    V + C        +   P    T +G  G  +SGGQ
Sbjct: 447 FNGTLFENIT--LSAKPVNKTAGAVKRACQMALLEKLVFDLPEGLHTKVGSGGISMSGGQ 504

Query: 652 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIR 711
           +QR+A+ARA+++   +LILDEA SALD+     +          K+  I++  H LS + 
Sbjct: 505 QQRVALARAILRDAPVLILDEAISALDIIHRDLLMEVIRSWRADKTTIILT--HELSHV- 561

Query: 712 RSENIIVLGNDGSVVEMGKFKELFADP 738
             ++ + +   G V+E G   EL ++P
Sbjct: 562 LDDDYLYMMEHGQVIEQGYKSELLSNP 588

>Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON}
           YKL209C (REAL)
          Length = 1316

 Score =  164 bits (416), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 126/445 (28%), Positives = 205/445 (46%), Gaps = 31/445 (6%)

Query: 315 ICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQ 374
           IC  +G       S+ L  +++C    +   A  F + + + S++  + T +  ++    
Sbjct: 188 ICALLGTSFYYSWSLTL--IILCSSPIITFFAVAFSRMVHMYSQKENEETSKAAQLFAWS 245

Query: 375 LNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVY- 433
           +N  + V+ +  +  E K+F   I     +     FI +  F + +  G L FLT+ ++ 
Sbjct: 246 MNAAQLVRLYCTQPLERKKFQRII-----LSCNTFFIKSCLFVAAN-AGILRFLTLTMFV 299

Query: 434 -----GSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDR 488
                GS ++  G L I D+          G+ +         + +G  A  ++  L + 
Sbjct: 300 QGFWFGSTMIKQGKLNINDVITCFHSCILLGSTLNNTLHQIVVLQKGEVALQKIMNLLEN 359

Query: 489 VPTIRP--TLGKTYTP---GKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGP 543
            P   P   +     P      ++ F NVSF+YP+RPS  + ++ + K   G    IVG 
Sbjct: 360 GPKCNPPNEIELHQYPLDYANSDLVFDNVSFSYPSRPSEIVLENASLKFPAGQFTFIVGK 419

Query: 544 SGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNI 603
           SG GKST++ LLL +Y+   G I I+G++I  +  K L + I VV+Q   L + T+R NI
Sbjct: 420 SGSGKSTLSSLLLKFYDGYDGSISINGRNIQAIPQKLLIKNITVVEQRCTLFNDTLRKNI 479

Query: 604 TYGLTEEPTKEE---------IRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQR 654
             G TE     +         I+   +       I+  P   +T IG  G  LSGGQ+QR
Sbjct: 480 LLGSTELAKNADYSTNKNTNLIKDACRMALLDRLILDLPDGLETLIGSGGVTLSGGQQQR 539

Query: 655 IAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSE 714
           +A+ARA I+   IL LDEA SALD+     +        K K+  I++  H L  +  S+
Sbjct: 540 VAMARAFIRDTPILFLDEAVSALDIIHRNLLMKAIRHWRKGKTTIILT--HELGQV-ESD 596

Query: 715 NIIVLGNDGSVVEMGKFKELFADPT 739
           + + L  +G V+E G   EL AD T
Sbjct: 597 DHLYLMQEGKVIESGTQSELLADST 621

 Score =  162 bits (410), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 147/521 (28%), Positives = 249/521 (47%), Gaps = 32/521 (6%)

Query: 238  ALFIGCAA-----NYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFF--DVHKVGDLIS 290
             + +G AA     N+         SE  +  LR+ VM+    +   +F  + +K  + +S
Sbjct: 790  CIVLGVAAADGIFNFAKGFLLGYCSEYWIMDLRNEVMEKLTKKSMNWFSGEDNKASE-VS 848

Query: 291  RLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCF-VIP-VVLSASI 348
             L  +     RS+  +    + S I     IG++  L+      LVC  + P +++ ++I
Sbjct: 849  ALVLNDLRDLRSLVSEFLSAITSFITVSF-IGLVWALASGWKLSLVCISMFPLIIIFSAI 907

Query: 349  FGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRA 408
            +G  ++ +  + + +  QL     + +  ++T++   AE      ++    ++  +  + 
Sbjct: 908  YGSILQKHETDYKTSVVQLENCLYQIVTNIKTIKYLQAEFHFQLSYHKLKTKMEQIASKR 967

Query: 409  AFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTF 468
            A       + T+++       +  YG  LV+    T   +        +T  +   L + 
Sbjct: 968  AIATGFGISMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFTTFTLLLFTIMSCTSLVSQ 1027

Query: 469  YSEIMQGAGAASRLFELTDRVPTIRPT----------LGKTYTPGKGE--IEFKNVSFAY 516
              +I +G  AAS ++ + D                  +G+TY   +    +  +N++FAY
Sbjct: 1028 IPDISRGQRAASWIYRILDEKQVTLEIEDNNARSIGIIGETYHEKQTTPMLSIQNLTFAY 1087

Query: 517  PTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKL 576
            P+ PS  I+K++N  +  G  + IVG SG GKST+ LLL   Y+   G I +DG D+   
Sbjct: 1088 PSAPSVLIYKNMNLNMFCGQTIGIVGGSGSGKSTLVLLLTRLYDCEVGSIKLDGTDVNDW 1147

Query: 577  NSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTY 636
            N   LRR+I+VV+Q+P+L +GTIRDN+TYG   E  + EI    K    ++F+   P   
Sbjct: 1148 NLTVLRREISVVEQKPLLFNGTIRDNLTYGCLGEILEIEIYDALKYVGIYDFVASLPLGL 1207

Query: 637  DTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKS- 695
             T I  +  LLSGGQ QR+ IARAL++KP ILILDE TSALD  S   I     +++K  
Sbjct: 1208 GTRIDTN--LLSGGQAQRLCIARALVRKPKILILDECTSALDSMSSHVIK----EIVKKG 1261

Query: 696  -KSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELF 735
              ++  + I H    +R  ++I V   DG V+E G F  L+
Sbjct: 1262 PPALLTLVITHDEQMMRCCDSIAVF-KDGKVIEEGSFDTLY 1301

>TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1253

 Score =  164 bits (415), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 123/431 (28%), Positives = 210/431 (48%), Gaps = 23/431 (5%)

Query: 321  IGMMLELSMDLSSVLVCF-VIPVVLSAS-IFGKQIRINSRELQDATGQLTRVSEEQLNGV 378
            +G++  ++      LVC  + P+++  S I+G  ++      + A   L  +  E +  +
Sbjct: 814  MGLIWAIATGWKLSLVCISMFPLIIIFSMIYGTVLQNYETSYKSAVADLENLQYEMITSI 873

Query: 379  RTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLV 438
            +T++        +  ++   +++  + K+   +     +  + +       +  YG  LV
Sbjct: 874  KTIKCLRLNDHFLGLYSELEKKMKRIAKKRTIVTGLGLSMLTTITTCIQSILYYYGLKLV 933

Query: 439  LHG---SLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPT 495
            L G   S T+      +L+T  T N+   L +   ++ +G  AAS +  + D     +  
Sbjct: 934  LTGEYTSKTMFQTFTLVLFTVTTCNS---LVSQIPDVSRGQRAASWVLRIIDENEYTKEV 990

Query: 496  LGKTYTPGKGE--------IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKG 547
             G+       E        IE +N++F YP  P   +++ LN KI  G  + +VG SG G
Sbjct: 991  NGEDCRVETIEHENDSDPLIEIENLNFHYPNTPGVNVYQDLNLKINSGETIGLVGQSGSG 1050

Query: 548  KSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGL 607
            KST+  LL   Y+    +ILI+G DI   +   LR +I VV+Q+P L  GTIR+NITYG+
Sbjct: 1051 KSTLMYLLTKLYDVQDNRILINGTDINDWSYDILRAEICVVEQKPNLFHGTIRENITYGV 1110

Query: 608  TEE-PTKE-EIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKP 665
            +E+ P  E E++ + +    H F+   P   DT +     LLSGGQ QR+ I R L++KP
Sbjct: 1111 SEKNPVSETEVQELLQLVDMHEFVEALPKALDTVVDIG--LLSGGQAQRLCIVRTLLRKP 1168

Query: 666  NILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA--HRLSTIRRSENIIVLGNDG 723
             +LILDE TS+LD ++   +      L       I++I   H    ++    ++VL + G
Sbjct: 1169 KVLILDECTSSLDAQTTQIVIALIKDLNTKLGWDILTIVITHNRQMMQCCSRLVVL-DVG 1227

Query: 724  SVVEMGKFKEL 734
             VVE G+F +L
Sbjct: 1228 RVVEDGQFDDL 1238

 Score =  152 bits (384), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 135/504 (26%), Positives = 246/504 (48%), Gaps = 45/504 (8%)

Query: 258 ERLVARLRSVVMKHTLHQDSEFFDVHK--VGDL------ISRLGADSYIVSRSITQKISD 309
           ER   R+RS +++  L +  E++D+ +   GD       +  L + S   S ++T +   
Sbjct: 95  ERQGFRVRSKLLEEYLEKPMEWYDLKENLAGDFTQLNRCMEELRSGSAEAS-AVTYQNCV 153

Query: 310 GVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTR 369
            + +LIC      +    S  L+ +++C    +++ A+ F + I+  +      T     
Sbjct: 154 AIIALIC------VSFYYSWQLTLIILCTSPFIIVCAACFSRFIQKYASFENKETAAAAD 207

Query: 370 VSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLT 429
           +    ++  +TV+    + +EIK+F   + +  D      FI    FT+ + +G L FLT
Sbjct: 208 LLMWTMDSSQTVKLSCTQSKEIKKFETLVSKCNDY-----FIRTSLFTAAN-IGILRFLT 261

Query: 430 V------LVYGSYLVLHGSLTIGD-LTAFMLYTEYTGNAIFGLSTFYSEIMQ-GAGAASR 481
           +        +GS ++  G L I D +T F  Y+     +I   +  +   +Q G  A ++
Sbjct: 262 LSMFVQGFWFGSTMIRKGKLNISDVITCF--YSCLMLGSILNTTLHHVIFIQKGQVALAK 319

Query: 482 LFELTDRVPTIRPTLGKTYTPG-----KGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGS 536
           + +  +  P + P+  KT T         +I   N++FAYP+RP+  + K+++ KIK   
Sbjct: 320 IQKFINESPEL-PS--KTLTSSGLVYSHVDISIDNLTFAYPSRPTENVLKNVSLKIKSAR 376

Query: 537 NVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMS 596
              IVG SG GKSTI  L++ +Y    G I++  +DI  +    L + I +V+Q   L +
Sbjct: 377 TTFIVGKSGSGKSTITNLIMKFYEDYKGNIIVGDKDIRSVPIDELLQNITLVEQRCTLFN 436

Query: 597 GTIRDNITYG--LTEEPTKEEIRTVAKQCFCHNFIV-KFPYTYDTYIGPHGTLLSGGQKQ 653
            T+++NI  G   T +   + + +      C + ++   P   +T +G  G  LSGGQ+Q
Sbjct: 437 DTLKNNILLGSKYTSQTINDGLLSSICSLACLDSVISSLPDGIETRLGTDGITLSGGQQQ 496

Query: 654 RIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRS 713
           R+A+ARA ++  +ILILDEA SALD+     +     ++ ++K+  I++  H L+ I  +
Sbjct: 497 RVALARAFLRDTDILILDEAVSALDIMQREILMRNISKVRQNKTTIILT--HDLNQINDN 554

Query: 714 ENIIVLGNDGSVVEMGKFKELFAD 737
           + I +  N+  + E G  K L  D
Sbjct: 555 DYIYLFENN-EIKENGFKKTLMND 577

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score =  160 bits (405), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 124/427 (29%), Positives = 204/427 (47%), Gaps = 20/427 (4%)

Query: 322  GMMLELSMDLSSVLVCF-VIPV-VLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVR 379
            G++  L+      LVC  +IP  +L    +G  ++      + A   +       +  ++
Sbjct: 866  GLIWALASGWKLSLVCISLIPAFILFTGAYGGLLQKCEANYKSAVASMEDQLYSAVRRIK 925

Query: 380  TVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLT---VLVYGSY 436
            T++    E+R IK +     +    G++ A +   F    +L   L+ +T   +L YG  
Sbjct: 926  TIRCLQVEERVIKEYEVLEGKAKLAGRKRA-LGTGF--GVALSNALTLITQSILLYYGMK 982

Query: 437  LVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTI---- 492
            LV+ G  +   +   +    +T      L     EI +G  AA+ LF + D         
Sbjct: 983  LVITGEYSSERMFQTLTLLLFTIMTCMSLIAQIPEISRGQRAATYLFRILDSETQFADAN 1042

Query: 493  ---RPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKS 549
                  L       +  I  K++ F+Y    +  +++ LN  +K G  V +VG SG GKS
Sbjct: 1043 LEGESALTSRGCSNEALIFIKDLRFSYSFLNNPMVYRGLNLSVKAGETVALVGLSGSGKS 1102

Query: 550  TIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTE 609
            T+  L+   Y   SG I  DG D+ +    +LR++IAVV+Q P L  G+I DN+TYGL+ 
Sbjct: 1103 TLWHLITRLYRVPSGSIWFDGLDVNEWEEWALRKRIAVVEQRPSLFRGSIFDNLTYGLST 1162

Query: 610  EPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILI 669
               + EIR + +     +F+   P    ++I     +LSGGQ QR+AI RAL++KP +L+
Sbjct: 1163 SVDEREIRELLELVGMMDFVNSNPLGLQSFIDTD--VLSGGQLQRLAIVRALLRKPQLLV 1220

Query: 670  LDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMG 729
            LDE TSALD +  G I   F +   S+S T + + H    +R    I+   N G+++E G
Sbjct: 1221 LDECTSALDAQ-HGFIMSEFVR-QGSQSTTTLVLTHSEQMMRACNRILTFAN-GNIIEDG 1277

Query: 730  KFKELFA 736
             F+ L++
Sbjct: 1278 SFERLYS 1284

 Score =  140 bits (353), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 130/510 (25%), Positives = 222/510 (43%), Gaps = 51/510 (10%)

Query: 258 ERLVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKS---- 313
           ER   RLR  +++  L +   ++D ++      ++  D   ++R + +  S   +S    
Sbjct: 101 ERQAFRLRRKMLQSYLDKSMAWYDANE------QISGDFTQLNRCVEELRSSSAESSAIV 154

Query: 314 ---LICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRV 370
              ++     +G  L  S  L+ +++     V+  A  F +++   ++     T      
Sbjct: 155 FQNVVTVAALLGSALYYSWSLTLIIMANSPLVIGFAVFFSRKVEKYAKRENSETSSAADA 214

Query: 371 SEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTV 430
               L+  + V+    + RE+ RF   +++      R  F     F+S +    L FLT+
Sbjct: 215 MAWSLDAAKMVRLLGTQDRELARFEACVQKC-----RQHFNKMSLFSSLN-YSVLRFLTL 268

Query: 431 LV------YGSYLVLHGSLTIGD-LTAFMLYTEYTGNAIFGLSTFYSEIMQ------GAG 477
            +      YG+  +  G L  GD +T F        + +   ST  S + Q      GA 
Sbjct: 269 CMFVQGFWYGNSRINIGKLKPGDVVTCF-------SSCVLLASTLNSTLHQIIILQKGAV 321

Query: 478 AASRLFELTDRVPTIRPTLGKT--------YTPGKGEIEFKNVSFAYPTRPSNQIFKSLN 529
              ++    +          K             +  I F+NV FAYPTRP + + K ++
Sbjct: 322 GLQKIMAFVNSRDASESQKNKVEISFRRLPLCWERASITFQNVHFAYPTRPDDFVLKGVS 381

Query: 530 FKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQ 589
                G    ++G SG GKSTI  LLL +Y   SG I ++GQD+ ++N   L R I +V+
Sbjct: 382 LDFPSGETTFVIGKSGSGKSTIGNLLLGFYGIGSGTINVNGQDVKEINQSELARNIMLVE 441

Query: 590 QEPVLMSGTIRDNITYGLTEEPTKE-EIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLS 648
           Q   L + T+ +N+T G       E  ++   +     N I       +T IG  G  LS
Sbjct: 442 QTTSLFTETLANNVTIGEAGVDDDEIRLKQACQMAMLGNIIRDLAKGLETTIGCSGLDLS 501

Query: 649 GGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLS 708
           GG++QR+A+ARA  +   ILILDEA SA D   +  +     +    K+  I++  H LS
Sbjct: 502 GGEQQRVALARAYFRNAPILILDEALSAQDRIHKSLLMEAIRKWRADKTTIILT--HELS 559

Query: 709 TIRRSENIIVLGNDGSVVEMGKFKELFADP 738
            I  ++ + V+ +DG + E G    L ++P
Sbjct: 560 DILDTDYVYVM-SDGQIREHGYKSGLLSNP 588

>TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8.303
            YDR135C
          Length = 1523

 Score =  156 bits (395), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 145/487 (29%), Positives = 232/487 (47%), Gaps = 57/487 (11%)

Query: 279  FFDVHKVGDLISRLGADSY----IVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSV 334
            FF+   +G +++R   D Y    I+ RS +Q   + ++        +   + +    +  
Sbjct: 1034 FFETTPIGRILNRFSNDVYKIDEILGRSFSQFFQNTIR--------VSFTIVVICSTTWQ 1085

Query: 335  LVCFVIPVVLSASIFGKQIRINSRELQ--DATGQ--LTRVSEEQLNGVRTVQSFVAEQRE 390
             +  +IP+      + +     SREL+  D+T +  L    +E L GV T++ F  + R 
Sbjct: 1086 FIFLIIPMAFLYIYYQQYFLRTSRELRRLDSTTRSPLYAHFQETLCGVSTIRGFAQQDR- 1144

Query: 391  IKRFNHSIREIFDVGKRAAF--INAKFFTSTSL--VGDLSFLTVLVYGSYLVLHGSLTIG 446
               F H  +   D    A +  IN+  + +  L  +G L  L       + + +GSLT G
Sbjct: 1145 ---FIHINQSRVDSNMMAYYPSINSNRWLAFRLEFLGSLIILGAATLSIFRLKNGSLTAG 1201

Query: 447  DLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFE---LTDRVPTI----RPTLGKT 499
             +   M Y      ++  +     ++     +  R+ E   L    P I    RP+    
Sbjct: 1202 MIGLSMSYALQVTQSLNWIVRMTVDVESNIVSVERIEEYSHLPSEAPLIIENNRPS---E 1258

Query: 500  YTPGKGEIEFKNVSFAYPTRPS-NQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHY 558
              P KG IEFKN S  Y  RP  + + K++N KI P   V IVG +G GKS++ L L   
Sbjct: 1259 EWPSKGAIEFKNYSTRY--RPELDLVLKNINLKILPKEKVGIVGRTGAGKSSLTLALFRI 1316

Query: 559  YNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRT 618
               +SG I IDG +I +L    LR +++++ Q+  +  G+IR+NI    T++ +++EI  
Sbjct: 1317 IEASSGSIEIDGVNINELGLYDLRHKLSIIPQDSQVFEGSIRENI--DPTQQFSEQEIWN 1374

Query: 619  VAKQCFCHNFIVKF----PYT-----------YDTYIGPHGTLLSGGQKQRIAIARALIK 663
              +       I+K     P +            D  I   G+ LS GQ+Q I +ARAL+ 
Sbjct: 1375 ALEMAHLKPHILKMNEISPESENSDTNQSSNPLDAKITEGGSNLSVGQRQLICLARALLV 1434

Query: 664  KPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDG 723
              N+LILDEAT+A+DVE++  I +T     K +  TI++IAHR++TI  S+ IIVL N G
Sbjct: 1435 PSNVLILDEATAAVDVETDELIQHTIRTAFKDR--TILTIAHRINTIMDSDKIIVLDN-G 1491

Query: 724  SVVEMGK 730
             V E  K
Sbjct: 1492 EVAEFDK 1498

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 116/491 (23%), Positives = 213/491 (43%), Gaps = 47/491 (9%)

Query: 264 LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGM 323
           L SV+ +  L   +E  +V   GD+++ +  D   V R   Q +S  +  L  G   + +
Sbjct: 369 LTSVIYQKALLLSNEATEVSTTGDIVNLMSVD---VQR--LQDLSQWINILWSGPFQLTL 423

Query: 324 -------MLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLN 376
                  +L  SM +   ++  +IP+        K+++ +  + +D   + T +  E LN
Sbjct: 424 CLISLYNLLGHSMWIGVFILGIMIPINSYIMRIQKKLQKDQMKYKD---ERTGLVNEILN 480

Query: 377 GVRTVQSFVAEQ-----REIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVL 431
            +++++ +  E+      E  R    ++ +  +G   A I  +F     LV   +F  + 
Sbjct: 481 NIKSLKLYAWEKPFQEKLEFVRNEKELKNLKKIGVFNAMIAFQFNIVPFLVSCCTF-AIF 539

Query: 432 VYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPT 491
           V+     L   L    LT F L        +  +    S  ++ + + SRL+        
Sbjct: 540 VWVEDKPLTTDLVFPALTLFNL----LNFPLVAVPITISAFIEASVSISRLYSYLTNEEL 595

Query: 492 IRPTLGKT-YTPGKGEIEFK---NVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGPSGK 546
            +  + +  +    GE   K   N +F +  +P  ++  K++NF+ + G   CIVG  G 
Sbjct: 596 QKDAIQRLPFVKQNGETTVKIGDNATFLWKRKPEYKVALKNINFEARKGELACIVGKVGS 655

Query: 547 GKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYG 606
           GKS     +L       G   I G              +A V Q   +M+GT++DNI +G
Sbjct: 656 GKSAFIQSILGDLFRVKGFASIHGN-------------VAYVSQLAWIMNGTVKDNIIFG 702

Query: 607 LTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPN 666
              +P   E +T+ K C     +   P    T +G  G  LSGGQK R+++ARA+  + +
Sbjct: 703 HRYDPEFYE-KTI-KACALTIDLSILPDGDQTLVGEKGISLSGGQKARLSLARAVYARAD 760

Query: 667 ILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSV 725
           I +LD+  +A+D   S+  I    G     KS T +   +++  +  +++I +L N G +
Sbjct: 761 IYLLDDPLAAVDEHVSKHLIQNVLGAKGLLKSKTRILTTNKIPVLSIADSITLLEN-GEI 819

Query: 726 VEMGKFKELFA 736
            E G + ++ A
Sbjct: 820 TEQGTYFDVMA 830

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score =  155 bits (391), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 145/504 (28%), Positives = 234/504 (46%), Gaps = 48/504 (9%)

Query: 257  SERLVARLRSVVMKHTLHQDSEFF--DVHKVGDLISRLGADSYIVSRSITQKISDGVKSL 314
            SE  +  LR   M    +QD  +F  D++K  + IS L  +     R +       V +L
Sbjct: 818  SELWIMSLRIKAMDRISNQDVHWFSLDINKPSE-ISALILNDLRDLRYLVSGFLSAVTTL 876

Query: 315  I-CGGVGIGMMLELSMDLSSVLVCF-VIPVVLSAS-IFGKQIRINSRELQDATGQLTRVS 371
            I    +G+         LS  LVC   IP+ +  + I+G  ++    + + A  +L    
Sbjct: 877  IFVSAIGLAWAFVSGWKLS--LVCISTIPLFIGVTGIYGGVLQKYETDYKTAVAELENNM 934

Query: 372  EEQLNGVRTVQSFVAEQREIKRFN-------HSIREIFDVGKRAAFINAKFFTSTSLVGD 424
             E + G++TV+    E     ++        H  R      +RA         S +LV  
Sbjct: 935  FEFVKGIKTVRCLQLESHFSNKYTMLEEGMKHQSR------RRAVVTGFGVALSNALVIG 988

Query: 425  LSFLTVLVYGSYLVLHGSLTIGDLT---AFMLYTEYTGNAIFGLSTFYSEIMQGAGAASR 481
            +  + +  YG  LV+ G  T  +L      +++T  T +A+      +S   +G  AA+ 
Sbjct: 989  VQAI-LYYYGIKLVVDGEYTPDNLLQTFTLLVFTIMTCSALMYEVPSFS---RGRRAATY 1044

Query: 482  LFELTDRVPTIRPTLGKTYTPGKGE-----------IEFKNVSFAYPTRPSNQIFKSLNF 530
            +F    R+   R          + E           I  ++++FAYP+    +++K L+ 
Sbjct: 1045 VF----RILNTRSDFLSIDDDFRTEPIEKPSHMNPLIRIQDLTFAYPSALDVEVYKKLSL 1100

Query: 531  KIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQ 590
             I  G N+ IVG SG GKST+ L+L   Y      + ID  DI K N  SLR+ I++V+Q
Sbjct: 1101 TINFGENLAIVGESGSGKSTMGLILCGLYPVNGNTVFIDDTDICKWNLSSLRKHISMVEQ 1160

Query: 591  EPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGG 650
            +     G+IRDN+ YGL    T  +I  V       +F+ + P   +T I  +  L+SGG
Sbjct: 1161 KAKFFDGSIRDNLIYGLDRIVTDSQIFEVLSLVGIADFVKELPQGLNTRIDTN--LISGG 1218

Query: 651  QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI 710
            Q QRI+I RAL+++P +LILDE TS+LD ++  AI    G  +    +T + I H  + +
Sbjct: 1219 QAQRISIGRALLRQPKLLILDECTSSLDAKNAQAIASLVGSSL--YGITTIVITHN-TQM 1275

Query: 711  RRSENIIVLGNDGSVVEMGKFKEL 734
             +S N I+   +G + E G F+EL
Sbjct: 1276 MKSCNRILFFKNGRISEEGTFQEL 1299

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 122/523 (23%), Positives = 225/523 (43%), Gaps = 39/523 (7%)

Query: 240 FIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIV 299
           F G    +          ER   R+R  ++   L +   ++D ++       L  D   +
Sbjct: 86  FGGLPLCWATLSSWMLLGERQGFRVRRRLLGAYLSKTMAWYDTNE------NLEGDFTQI 139

Query: 300 SRSITQKISDGVKS---LICGGVGIGMMLELSMDLSSVLVCFVI---PVVLSASIFGKQI 353
            R + +  S   +S        V +  +L  S+  S  L   ++   P++++ +I   ++
Sbjct: 140 HRGVEELRSSAAESSAVTFLNAVTVVTLLTTSLYFSWSLTLVILASTPLIIALAIIFSKL 199

Query: 354 RINSRELQDA-TGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIRE----IFDVGKRA 408
                EL++  T     +    +   + ++ F  EQ E+++F+ S+++      ++ K A
Sbjct: 200 VEKYTELENTETSHAASILTWSMEAPQLIRLFGTEQVELQKFSISVKKCSKFFINLSKYA 259

Query: 409 AFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTF 468
           A  N       SL+    F+    +G+ ++  G L  G +          G  +      
Sbjct: 260 A-ANQASLRGLSLI---MFVQGFWFGNTMIKRGKLNSGQVITCFSACILLGTTLNNTLQH 315

Query: 469 YSEIMQGAGAASRLFELTD-RVPTIRPTLGKTY----TPGKG---------EIEFKNVSF 514
              + +G  A  ++  + +     +R   G+T+    +P  G         +I F+NVSF
Sbjct: 316 IVIMQKGKVALQKILSMVESESDALRGRRGETFEIFPSPISGMFVSPVFPKQITFENVSF 375

Query: 515 AYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDIT 574
           +YP+RP+     +++    P     IVG SG GKST++ LLL  Y+   G I +   DI 
Sbjct: 376 SYPSRPNEYALDNVSLTFYPEKITFIVGKSGSGKSTLSNLLLKLYSDYEGTIKVGTLDIR 435

Query: 575 KLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKE-EIRTVAKQCFCHNFIVKFP 633
                 L   I +V+Q   L + ++ +N+     ++   E  I+   +       +   P
Sbjct: 436 ATKDSWLLENITLVEQSCTLFNDSLLNNLLLTAKDDNKNEASIKRACQMALLEKLLFDLP 495

Query: 634 YTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLM 693
               T IG +G  LSGGQ+QR+A+ARA+++   +LILDE+ SALD+     +        
Sbjct: 496 DGLSTVIGSNGISLSGGQQQRVALARAILRDTPVLILDESISALDIIHRDLLMEVIRNWR 555

Query: 694 KSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFA 736
             K+  I++  H LS I   ++ + L  DG V E G  ++L +
Sbjct: 556 AGKTTIILT--HELSHI-LDDDYLYLMEDGKVGEHGYKRDLLS 595

>YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}
            VMR1Vacuolar membrane protein involved in multiple drug
            resistance and metal sensitivity; ATP-binding cassette
            (ABC) family member involved in drug transport; potential
            Cdc28p substrate; induced under respiratory conditions
          Length = 1592

 Score =  154 bits (388), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 150/514 (29%), Positives = 247/514 (48%), Gaps = 73/514 (14%)

Query: 268  VMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLI-CGGVGIGMMLE 326
            ++   LH    FFDV  VG +++R   D   V + +   +   +  LI C  +   + + 
Sbjct: 1078 LLDLVLHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPYLEVTIFCLIQCASIIFLITVI 1137

Query: 327  LSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQ--DATGQ--LTRVSEEQLNGVRTVQ 382
                L+  ++ FV+   +     GK     SREL+  D+  +  + +   E L GV T++
Sbjct: 1138 TPRFLTVAVIVFVLYFFV-----GKWYLTASRELKRLDSITKSPIFQHFSETLVGVCTIR 1192

Query: 383  SFVAEQREIKRFNHSIREIFDVGKRAAF---INAKFFT-STSLVGDLSFLTVLVYGSYLV 438
            +F  E+R I    + I    D   RA F   +  K+F+    ++G  +F+ VL  GS+++
Sbjct: 1193 AFGDERRFILENMNKI----DQNNRAFFYLSVTVKWFSFRVDMIG--AFI-VLASGSFIL 1245

Query: 439  LH-----GSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTD------ 487
            L+       L    LT  +L+T+        L   YS       +  RL E +       
Sbjct: 1246 LNIANIDSGLAGISLTYAILFTD----GALWLVRLYSTFEMNMNSVERLKEYSSIEQENY 1301

Query: 488  ------RVPTIRPTLGKTYTPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGSNVCI 540
                  R+      L +   P  GEIE +N+S  Y P  P   + ++++FK+ P S + I
Sbjct: 1302 LGHDEGRILL----LNEPSWPKDGEIEIENLSLRYAPNLPP--VIRNVSFKVDPQSKIGI 1355

Query: 541  VGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIR 600
            VG +G GKSTI   L     P +G I IDGQDI+K++  +LRR I ++ Q+P+L +GTI+
Sbjct: 1356 VGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIPQDPILFAGTIK 1415

Query: 601  DNIT-YGLTEEPTKEEIRTVAKQCFCHNF------IVKFPYTYDTYIGPH------GTLL 647
             N+  Y   +E    +  +       H F        +F  T++ ++  H      G  L
Sbjct: 1416 SNVDPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFLNLHTEIAEGGLNL 1475

Query: 648  SGGQKQRIAIARALIKKPNILILDEATSALDVES----EGAINYTFGQLMKSKSMTIVSI 703
            S G++Q + IAR+L+++P I++LDEATS++D +S    +G I   F +       TI++I
Sbjct: 1476 SQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRSEFNK------STILTI 1529

Query: 704  AHRLSTIRRSENIIVLGNDGSVVEMGKFKELFAD 737
            AHRL ++   + IIV+ + G V E  +  EL  D
Sbjct: 1530 AHRLRSVIDYDRIIVM-DAGEVKEYDRPSELLKD 1562

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 127/479 (26%), Positives = 212/479 (44%), Gaps = 44/479 (9%)

Query: 285 VGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLEL-----SMDLSSVLVCFV 339
           +G +I+ +  DS+ VS  +   +   V+++I   V +G++           +S +LV F 
Sbjct: 445 LGTIINLISIDSFKVSE-LANYLYVTVQAVIMIIVVVGLLFNFLGVSAFAGISIILVMFP 503

Query: 340 IPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQR---EIKRFNH 396
           +  +L A++ GK      ++    T Q      E L  +R V+ F  E+    EIK    
Sbjct: 504 LNFLL-ANLLGKF----QKQTLKCTDQRISKLNECLQNIRIVKYFAWERNIINEIKSIRQ 558

Query: 397 -SIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYT 455
             +R +       +  +  +F + +LV  ++F  +  +  +  L+  L    L+ F L  
Sbjct: 559 KELRSLLKKSLVWSVTSFLWFVTPTLVTGVTF-AICTFVQHEDLNAPLAFTTLSLFTLLK 617

Query: 456 EYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFA 515
                 +  LS   S I Q   +  R+ +   R+         T +P K +IEFKN +  
Sbjct: 618 ----TPLDQLSNMLSFINQSKVSLKRISDFL-RMDDTEKYNQLTISPDKNKIEFKNATLT 672

Query: 516 YPTRPSN-QIFK--SLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG-- 570
           +    S+   FK   LN K + G    I+G +G GKS + L LL   N  SG I++    
Sbjct: 673 WNENDSDMNAFKLCGLNIKFQIGKLNLILGSTGSGKSALLLGLLGELNLISGSIIVPSLE 732

Query: 571 --QDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNF 628
              D+   + + L    A   Q   L++ T+++NI +       ++    V   C     
Sbjct: 733 PKHDLIP-DCEGLTNSFAYCSQSAWLLNDTVKNNIIFD--NFYNEDRYNKVIDACGLKRD 789

Query: 629 IVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--N 686
           +   P    T IG  G  LSGGQKQRI++ARA+      ++LD+  SA+D  +   I  N
Sbjct: 790 LEILPAGDLTEIGEKGITLSGGQKQRISLARAVYSSAKHVLLDDCLSAVDSHTAVWIYEN 849

Query: 687 YTFGQLMKSKSMTIVSIAHRLS-TIRRSENIIVL-----GNDGSVVEM---GKFKELFA 736
              G LMK++  T + + H +S T+R +   IVL      N G++ E+   G FKE + 
Sbjct: 850 CITGPLMKNR--TCILVTHNVSLTLRNAHFAIVLENGKVKNQGTITELQSKGLFKEKYV 906

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON}
           YKL209C (STE6) - ABC transporter, glycoprotein,
           component of a-factor secretory pathway [contig 290]
           FULL
          Length = 1297

 Score =  151 bits (382), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 120/383 (31%), Positives = 184/383 (48%), Gaps = 34/383 (8%)

Query: 375 LNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLV-- 432
           LN  + V+    +  EI +F  S+ +      R  F     F+S +    L FLT+ +  
Sbjct: 223 LNAAKMVRLLGTQDYEIAKFRASVLKC-----RMNFNKMSLFSSLN-YSILRFLTLCMFV 276

Query: 433 ----YGSYLVLHGSLTIGD-LTAFMLYTEYTGNAIFGLSTFYSEIMQ------GAGAASR 481
               YG+  +  G+L  GD +T F        + I   ST  S + Q      GA    +
Sbjct: 277 QGFWYGNVRIKSGNLKPGDVMTCF-------SSCILLASTLNSTLHQVVTLQKGAVGLKK 329

Query: 482 LFEL--TDRVPTIRPTLGKTYTP---GKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGS 536
           + E   +D V      +   + P    + +I F+NVSFAYP+R  + + K+LN K+  G 
Sbjct: 330 IQEFLTSDVVQGKECVVNSMHLPLLWEQAQISFENVSFAYPSRSKHPVIKNLNLKVPGGR 389

Query: 537 NVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMS 596
              IVG SG GKSTI+ LLL  Y P SG I ++  DI ++N + L R I +V+Q   L  
Sbjct: 390 FTFIVGKSGSGKSTISNLLLKLYRPCSGLIKVNDVDIREINQQDLFRSITLVEQNSPLFE 449

Query: 597 GTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIA 656
            +I++NI     E      +    +       I       DT IG  G  LSGG++QR+A
Sbjct: 450 DSIKNNIQLTSDEHRDDGRLSQACQAAMLEGVIRDLAKGLDTIIGSSGVDLSGGEQQRVA 509

Query: 657 IARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENI 716
           +ARA ++   ILILDEA SA D   +  +        K ++  I++  H L+ I   ++ 
Sbjct: 510 LARAFVRDSPILILDEALSAQDRMHKDLLMEAIRFWRKGRTTIILT--HELNDILE-DDF 566

Query: 717 IVLGNDGSVVEMGKFKELFADPT 739
           ++L  DG+V+E G+  +L +D T
Sbjct: 567 VLLMEDGNVIERGQKSDLLSDST 589

 Score =  151 bits (381), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 125/436 (28%), Positives = 204/436 (46%), Gaps = 40/436 (9%)

Query: 322  GMMLELSMDLSSVLVCF-VIPV-VLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVR 379
            G++  L       LVC  +IP+ VL + I+G  ++      +    +L     + +  ++
Sbjct: 865  GLLWALVAGWKLSLVCISLIPMFVLFSGIYGGLLQNYEARYKTCIAELENELYKAIRCMK 924

Query: 380  TVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGD--LSFLT---VLVYG 434
            T++    E +  + +     E+ +V  + A       T   +     L+F+T   +L +G
Sbjct: 925  TIKCLQMENKVARSY-----EMLEVTSKGAARKRAMGTGFGVASSNALTFITQSILLYFG 979

Query: 435  SYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFEL--------- 485
              LV+ G  T G +   +    +T      L +   EI +G  AA+ LF+L         
Sbjct: 980  MKLVITGEYTPGKMLETLTLLLFTIMTCMTLMSQVPEISRGQRAATYLFKLFGNEHEEGA 1039

Query: 486  ----TDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIV 541
                    P I+    +T       I  K++ F+Y    +  ++K+L+ K+  G  V ++
Sbjct: 1040 SVLKERHAPIIKTCSKQTL------ISIKHLKFSYSNINNPMVYKNLSLKVDRGEIVGLI 1093

Query: 542  GPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRD 601
            G SG GKST+  LL   Y   +G I IDG DI + + K+LR  IAVV+Q+P+  SG+I +
Sbjct: 1094 GTSGSGKSTLWSLLTRLYPVENGSISIDGTDINQWDRKALRSCIAVVEQKPLFFSGSIIE 1153

Query: 602  NITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARAL 661
            N+TYGL  + + EE+  +        F+   P    + I     LLSGGQ QR+AI RAL
Sbjct: 1154 NLTYGLMRKVSDEEVNELLLTLGMLEFVNSTPKRLHSVIDTQ--LLSGGQVQRLAIVRAL 1211

Query: 662  IKKPNILILDEATSALDVESEGAINYTFGQLMKSK--SMTIVSIAHRLSTIRRSENIIVL 719
            ++KP +L+LDE TSALD       ++   + +K      T + + H    +R    I+  
Sbjct: 1212 LRKPQLLVLDECTSALDARH----SFIMSEFVKHHLYHTTTLVVTHSEQMMRSCHRILTF 1267

Query: 720  GNDGSVVEMGKFKELF 735
             N G +VE G    LF
Sbjct: 1268 -NKGEIVEEGSIDNLF 1282

>KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1515

 Score =  149 bits (375), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 141/497 (28%), Positives = 230/497 (46%), Gaps = 45/497 (9%)

Query: 264  LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSY----IVSRSITQKISDGVKSLICGGV 319
            L  ++    L     FF+   +G +++R   D Y    I+ R+ +Q   + VK +    V
Sbjct: 1024 LHDLMTDAVLKAPMSFFETTPIGRILNRFSNDIYKIDSILGRTFSQFFVNAVKVVFVMAV 1083

Query: 320  GIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVS-----EEQ 374
                  +         +  +IP+ +    + +     SREL+     +TR       +E 
Sbjct: 1084 ICATTWQF--------IFVIIPLGVFYIYYQQYYLRTSRELR-RLDSITRSPVYSHFQET 1134

Query: 375  LNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAF--INAKFFTS--TSLVGDLSFLTV 430
            L G+ T++ +  E    KRF H  +   D    A +  INA  + +    L+G +  L  
Sbjct: 1135 LGGITTIRGYNQE----KRFGHINQCRVDNNMSAFYPSINANRWLAFRLELIGSIIILGA 1190

Query: 431  LVYGSYLVLHGSLT---IGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTD 487
                 + +  G+LT   +G   ++ L    T N I  ++      +          +L  
Sbjct: 1191 ATLSIFRLKEGTLTPGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERVKEYAQLES 1250

Query: 488  RVPTI----RPTLGKTYTPGKGEIEFKNVSFAYPTRPS-NQIFKSLNFKIKPGSNVCIVG 542
              P I    RP       P +G+I+F+N S  Y  RP  + + K++N  I+P   V IVG
Sbjct: 1251 EAPRIVEEKRP---DEMWPTEGDIKFENYSTRY--RPELDLVLKNINVHIRPTEKVGIVG 1305

Query: 543  PSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDN 602
             +G GKS++ L L      T+G I+IDG  I ++    LR +++++ Q+  +  GT+R+N
Sbjct: 1306 RTGAGKSSLTLALFRIIEATAGNIIIDGIPINEIGLYDLRHKLSIIPQDSQVFEGTLREN 1365

Query: 603  ITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYT-YDTYIGPHGTLLSGGQKQRIAIARAL 661
            I    T   T EEI  V +       ++       D  +   G+ LS GQ+Q + +ARAL
Sbjct: 1366 I--DPTNLFTDEEIWRVLELSHLKEHVLSMGADGLDVQLTEGGSNLSVGQRQLMCLARAL 1423

Query: 662  IKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGN 721
            +    IL+LDEAT+A+DVE++  +  T     K +  TI++IAHRL+TI  S+ IIVL +
Sbjct: 1424 LIPSKILVLDEATAAVDVETDKIVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVL-D 1480

Query: 722  DGSVVEMGKFKELFADP 738
             G +VE     EL A P
Sbjct: 1481 KGEIVEFDTPDELLAKP 1497

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 100/428 (23%), Positives = 192/428 (44%), Gaps = 41/428 (9%)

Query: 324 MLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQS 383
           +L  SM +  +++ F+I   L++ +   Q ++  +++Q    + T V  E LN +++++ 
Sbjct: 440 LLGHSMWVGFIILVFMI--FLNSYLVRIQRKLQKQQMQ-FKDERTGVISEILNNIKSLKL 496

Query: 384 FVAEQREIKRFNH-----SIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLV 438
           +  E     + NH      +  +  +G   A  + +F     LV   +F  V VY     
Sbjct: 497 YAWEVPYQTKLNHVRNDKELHNLTKLGCYMAVTSFQFNIVPFLVSCATF-AVFVYTENKP 555

Query: 439 LHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGK 498
           L   L    LT F L +      +  +    +  ++ + + +RLF         + ++ +
Sbjct: 556 LTTDLVFPALTLFNLLS----FPLMVVPNVITSFVEASVSVNRLFSFLTNEELQKDSIQR 611

Query: 499 T-YTPGKGEIEFK---NVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGPSGKGKSTIAL 553
                 KG++      N +F +  +P  ++  K++NF+ K G   CIVG  G GKS +  
Sbjct: 612 LPKVENKGDVAINLGDNATFLWKRKPEYKVALKNINFQAKKGDLTCIVGKVGSGKSALIQ 671

Query: 554 LLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTK 613
            +L       G   + G              +A V Q P +M+GT+++NI +G   +  +
Sbjct: 672 SILGDLFRVKGFATVHGN-------------VAYVSQVPWIMNGTVKENILFG--HKYDQ 716

Query: 614 EEIRTVAKQCFCHNFIVKFPYTYD---TYIGPHGTLLSGGQKQRIAIARALIKKPNILIL 670
           E      K C      +      D   T +G  G  LSGGQK R+++ARA+  + +  +L
Sbjct: 717 EFYEKTIKAC---ALTIDLGILVDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLL 773

Query: 671 DEATSALDVE-SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMG 729
           D+  +A+D   S+  + +  G      S T V   +++S +  +++I +L N G +V+ G
Sbjct: 774 DDPLAAVDEHVSKHLVEHVLGPTGLLHSKTKVLCTNKISVLSIADSITLLEN-GEIVQQG 832

Query: 730 KFKELFAD 737
            ++E+ +D
Sbjct: 833 SYEEVNSD 840

>NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {ON}
            Anc_8.303
          Length = 1512

 Score =  146 bits (368), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 135/490 (27%), Positives = 235/490 (47%), Gaps = 59/490 (12%)

Query: 279  FFDVHKVGDLISRLGADSY----IVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSV 334
            FF+   +G +++R   D Y    ++ R+ +Q   + VK                +  + +
Sbjct: 1038 FFETTPIGRILNRFSNDVYKVDSVLGRTFSQFFVNAVK----------------VSFTII 1081

Query: 335  LVCF--------VIPVVLSASIFGKQIRINSRELQ--DATGQLTRVS--EEQLNGVRTVQ 382
            ++CF        +IP+ +    + +     SREL+  D+  +    S  +E L G+ T++
Sbjct: 1082 VICFTTWQFIFIIIPLGVFYIYYQQYFLRTSRELRRLDSITKSPIFSHFQETLGGITTIR 1141

Query: 383  SFVAEQREIKRFNHSIREIFDVGKRAAF--INAKFFTSTSL--VGDLSFLTVLVYGSYLV 438
             +  + R    F H  +   D    A +  +NA  + +  L  +G L  L       + +
Sbjct: 1142 GYQQQHR----FTHINQCRVDNNMSAFYPSVNANRWLAYRLETIGSLIILGAATLSVFRL 1197

Query: 439  LHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTD---RVPTI--- 492
              G+LT G +   + Y      ++  +     E+     +  R+ E +D     P +   
Sbjct: 1198 RQGTLTAGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSDLKSEAPAVIED 1257

Query: 493  -RPTLGKTYTPGKGEIEFKNVSFAYPTRPS-NQIFKSLNFKIKPGSNVCIVGPSGKGKST 550
             RP   +T+ P +G+I+F++ S  Y  RP  + I K +N  IKP   V IVG +G GKS+
Sbjct: 1258 HRP--AETW-PDEGDIKFEHYSTRY--RPELDLILKDINVHIKPKEKVGIVGRTGAGKSS 1312

Query: 551  IALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEE 610
            + L L      +SG+I+ID   I ++    LR +++++ Q+  +  GT+R+NI    T E
Sbjct: 1313 LTLALFRIIEASSGRIVIDNVPINEIGLYDLRHKLSIIPQDSQVFEGTVRENI--DPTNE 1370

Query: 611  PTKEEIRTVAKQCFCHNFIVKF-PYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILI 669
             T E+I  V       + I+       +  +   G  LS GQ+Q + +ARAL+    IL+
Sbjct: 1371 YTDEQIWNVLALSHLKDHIISMGDEGLNNQLTEGGNNLSVGQRQLLCLARALLVPSKILL 1430

Query: 670  LDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMG 729
            LDEAT+A+DVE++  I  T     K +  TI++IAHR++TI  S+ IIVL N G++ E  
Sbjct: 1431 LDEATAAVDVETDKVIQETIRTAFKDR--TILTIAHRINTIMDSDRIIVLDN-GTIKEFD 1487

Query: 730  KFKELFADPT 739
              ++L  +P+
Sbjct: 1488 SPEKLLENPS 1497

 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 111/502 (22%), Positives = 214/502 (42%), Gaps = 67/502 (13%)

Query: 264 LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVK----------S 313
           L SV+ +  L   +E       GD+++ +  D         QK+ D  +           
Sbjct: 378 LTSVIYQKALVLSNEASATSSTGDIVNLMSVD--------VQKLQDMCQFIQLLWSAPFQ 429

Query: 314 LICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEE 373
           +I   V +  +L  SM +  +++  +IP+        K+++ +    +D   + TRV  E
Sbjct: 430 VILCLVSLYKLLGKSMWVGVLILVIMIPINSYLVRVQKKLQKSQMTYKD---ERTRVISE 486

Query: 374 QLNGVRTVQSFVAE-----QREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFL 428
            LN +++++ +  E     + E  R N  ++ +  +G   A ++ +F     LV   +F 
Sbjct: 487 MLNNIKSLKLYAWEVPYRQKLENVRNNKELKNLTKLGCYMALMSFQFNVVPFLVSCCTF- 545

Query: 429 TVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDR 488
              +Y     L   L    LT F L        +  +    + I++ + +  RLF     
Sbjct: 546 AAFIYTENRPLTTDLVFPALTLFNL----LHFPLMVIPNVLTMIIETSVSIGRLFSFLTN 601

Query: 489 VPTIRPT---LGKTYTPGKGEIEF-KNVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGP 543
               +     L K    G   I    + +F +  +P  ++  K++NF+ K G   CIVG 
Sbjct: 602 EELQKDAVQRLPKVTNIGDVAINVGDDATFLWQRKPEYKVALKNINFQAKKGELTCIVGK 661

Query: 544 SGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNI 603
            G GKS +   +L       G   I G              +A V Q   +M+GT+++NI
Sbjct: 662 VGSGKSAMIQSILGDLFRVKGFATIHGN-------------VAYVSQVAWIMNGTVKENI 708

Query: 604 TYG--LTEEPTKEEIRTVAKQCFCHNFIVKFPYTYD---TYIGPHGTLLSGGQKQRIAIA 658
            +G    E+  ++ I+  A         +      D   T +G  G  LSGGQK R+++A
Sbjct: 709 LFGHKYDEDFYQKTIKACA-------LTIDLAVLMDGDQTLVGEKGISLSGGQKARLSLA 761

Query: 659 RALIKKPNILILDEATSALDVE-SEGAINYTFGQ--LMKSKSMTIVSIAHRLSTIRRSEN 715
           RA+  + +  +LD+  +A+D   +   + +  G   L+ +K+  + +  +++S +  +++
Sbjct: 762 RAVYSRADTYLLDDPLAAVDEHVARHLVEHVLGPNGLLHTKTKVLAT--NKVSVLSIADS 819

Query: 716 IIVLGNDGSVVEMGKFKELFAD 737
           + +L N G +V+ G + E+  D
Sbjct: 820 VSLLEN-GEIVQQGTYDEIMKD 840

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score =  145 bits (366), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 145/502 (28%), Positives = 230/502 (45%), Gaps = 68/502 (13%)

Query: 268  VMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLEL 327
            ++   LH    FFD   +G +++R   D      SI Q+I   ++S+    + +   L L
Sbjct: 1129 LLDRVLHARVRFFDSTPIGRIMNRFSKDI----ESIDQEIPPNIQSVFYSAIEVFATLLL 1184

Query: 328  SMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSE--------EQLNGVR 379
               ++       I +VL  SI G      SREL+    +L  +S+        E L GV 
Sbjct: 1185 ISYITPAFFPVAIIIVLGYSIVGFFYLTTSRELK----RLDSISKSPIFQHFSETLVGVT 1240

Query: 380  TVQSFVAEQREIKRFNHSIREIFDVGKRAAF----INAKFFTSTSLVGDLSFLTVLVYGS 435
            T+++F  EQR IK  N S+    D      F    +N        L+G L    +   G 
Sbjct: 1241 TIRAFGDEQRFIKE-NLSM---IDQNSMPFFYLWVVNRWLSFRIDLIGAL---VIFSSGV 1293

Query: 436  YLVLH-----GSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELT--DR 488
            +++L+       L    LT  + +TE    A   L   YSE+     +  R+ E    ++
Sbjct: 1294 FILLNINNIDAGLAGISLTYAISFTE----AALWLVRQYSELEMNMNSVERVLEYMNIEQ 1349

Query: 489  VPTIR-PTLGKT---YTPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGSNVCIVGP 543
             P I  P    T     P  G++E  N+S  Y P  P   + K + F I+P   V IVG 
Sbjct: 1350 EPLIADPANAVTPPPQWPDSGKVEVNNLSLKYAPHLP--YVIKDVTFTIEPLEKVGIVGR 1407

Query: 544  SGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNI 603
            +G GKSTI   L  +    +G I +DG +I  ++ K LRR I ++ Q+P L +G+IR N+
Sbjct: 1408 TGAGKSTIITALFRFLEADTGSIKLDGVNIANIDLKRLRRSITIIPQDPTLFAGSIRSNL 1467

Query: 604  TYGLTEEPTKEEIRTVAK-----------------QCFCHNFIVKFPYTYDTYIGPHGTL 646
                 +E + EEI T  K                 Q      + KF    ++ I   G+ 
Sbjct: 1468 --DPYDEYSDEEIFTALKRVNLVSTEEMEASTSEIQSNSSKNVNKF-LNLESEIAEGGSN 1524

Query: 647  LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 706
             S GQ+Q + +AR+L++ P +++LDEAT+++D  S+  I  T  Q  +  + T+++IAHR
Sbjct: 1525 FSQGQRQLMCLARSLLRMPKVILLDEATASIDYNSDAKIQETIRQ--EFNNSTVLTIAHR 1582

Query: 707  LSTIRRSENIIVLGNDGSVVEM 728
            L +I   + I+V+ + G V E 
Sbjct: 1583 LRSIVDYDKILVM-DAGEVKEF 1603

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 113/235 (48%), Gaps = 9/235 (3%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           + F+NV+  + +   + + ++L+ +   G    IVG +G GK++I + LL     + G+I
Sbjct: 706 LAFENVTLRWDSDKDSFVLRNLDIEFMTGKLNVIVGATGSGKTSILMGLLGEMQLSEGKI 765

Query: 567 LIDG---QDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQC 623
           ++     +   +  +  +   IA   Q   L++ T+R+NI +    +  + +   V + C
Sbjct: 766 IVPSLSPRHEYQSQAGVINDSIAYCSQAAWLLNDTVRNNILFNAPFDQARYD--AVVEAC 823

Query: 624 FCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEG 683
                         T IG  G  LSGGQKQR+++ARAL      L+LD+  SA+D  +  
Sbjct: 824 SLKRDFQILKAGDSTEIGEKGITLSGGQKQRVSLARALYSSAGHLLLDDCLSAVDSHTAL 883

Query: 684 AI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFA 736
            I      G LM+ +  T + + H ++   ++ + +V+  DG V E G   EL A
Sbjct: 884 WIYDKCISGPLMEGR--TCILVTHNIALTMKNADFVVMIEDGKVKEKGTPIELLA 936

>TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_4.52
            YLL015W
          Length = 1535

 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 148/549 (26%), Positives = 252/549 (45%), Gaps = 65/549 (11%)

Query: 228  LYEFLGGFS-VALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFDVHKVG 286
            +++F+G ++ + +F     N          + R  A+L   + K  L     FF+   VG
Sbjct: 993  VWKFVGIYAAIGVFSAAFNNLRTIVLLLFCTIRGAAQLHDTMAKTVLRSPMSFFETTPVG 1052

Query: 287  DLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLSA 346
             +I+R  +D   V  ++    +   +S++   V + +   +S ++   L+  V  V+L  
Sbjct: 1053 RIINRFSSDVQAVDSTLQWVFAFFFRSILNYAVTVIL---ISYNMPWFLI--VNAVLLII 1107

Query: 347  SIFGKQIRIN-SRELQD----ATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREI 401
             I+ +   I  SREL+     +T  +  +  E L G   + +F    +   RF     + 
Sbjct: 1108 YIYYQAFYITLSRELKRLTSVSTSPIMSLFSETLGGHAVINAF----KHFDRF-----DF 1158

Query: 402  FDVGKRAAFINAKF-FTSTSLVGDLSFLTVLVYGSYLVLHGSL----TI--------GDL 448
             +       IN  F F ST+    +   T+   G+++VL  +L    TI        G +
Sbjct: 1159 INFNNVQFNINCSFNFRSTNRWLSVRLQTI---GAFIVLATALLALSTINSERRLSPGMV 1215

Query: 449  TAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVP-------TIRPTLGKTYT 501
               M Y     +++  +     +I     +  R++E  +  P       + RP   KT+ 
Sbjct: 1216 GLLMSYALQVTSSLMWIVRMSVQIETNIVSVERIYEYCNLTPEAPEVIESCRPK--KTW- 1272

Query: 502  PGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNP 561
            P +GEI FKN S  Y T+  +   K +N  IKP   + +VG +G GKST++L L      
Sbjct: 1273 PSEGEIIFKNYSTKYKTK-GDLALKGINLSIKPQEKIGVVGRTGAGKSTLSLALFRLLEA 1331

Query: 562  TSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAK 621
            T G I IDG DI+K+  K LR  + ++ Q+     GT+R N+     E+ + EE+    +
Sbjct: 1332 TEGTIEIDGLDISKMGLKDLRSHLGIIPQDAQAFEGTVRSNL--DPFEQYSTEELWASIE 1389

Query: 622  QCFCHNFIV---------KFPYT----YDTYIGPHGTLLSGGQKQRIAIARALIKKPNIL 668
                   IV         + P +     D  I  +G  LS GQ+Q + ++RAL+    +L
Sbjct: 1390 LSHLKPHIVEMFRKEDNSELPASKEKMLDVKISENGGNLSVGQRQLLCLSRALLNTSKVL 1449

Query: 669  ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEM 728
            +LDEAT+A+D+E++  I  T    +K K  TI++IAHR+ T+  S+ IIVL + G V E 
Sbjct: 1450 VLDEATAAVDMETDKIIQETIRSELKEK--TILTIAHRIDTVLDSDKIIVL-DAGQVKEF 1506

Query: 729  GKFKELFAD 737
               + L ++
Sbjct: 1507 DTPENLLSN 1515

 Score =  102 bits (253), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 102/398 (25%), Positives = 182/398 (45%), Gaps = 43/398 (10%)

Query: 369 RVSEEQLNGVRTVQSFVAEQREIKRFNHSIR---EIFDVGKRAAFINAKFFT--STSLVG 423
           + + E LN +++++ +  E+  +KR +H +R   E+ +  +     N  +F      L+ 
Sbjct: 464 KTTTEILNSMKSIKLYAWEEAMLKRLDH-VRNGLELENYKRIGVVSNLIYFAWNCVPLMV 522

Query: 424 DLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLF 483
             S   +  + +   L   +    L+ F +      +AI+ L    + I++   + +R+ 
Sbjct: 523 TCSTFAIFSFFNKTPLSPEVVFPSLSLFNIL----NDAIYSLPNTINSIIETKVSINRIK 578

Query: 484 EL-----------------TDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQI-F 525
           E                  +D+V  +   +  T+     +I F   S       S+Q+  
Sbjct: 579 EFLLSEELDDSFIEIDKTPSDKVSPVVEIINATFLWKSPKILFSEGSDEESRIESSQVAL 638

Query: 526 KSLN-FKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQ 584
           +++N F+ K G   CIVG  G GKST+   +L       GQ+      +  L  K L R 
Sbjct: 639 ENINGFQAKKGELTCIVGRVGSGKSTMLRAIL-------GQLPCVNASVGGLEPKVLIRA 691

Query: 585 --IAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGP 642
             +A   QEP +M+ +I+DNIT+G   + T        K C     +   P   +T +G 
Sbjct: 692 STVAYCPQEPWIMNASIKDNITFGFRYDETY--YNATIKACQLLPDLDILPERDNTLVGE 749

Query: 643 HGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMK-SKSMTI 700
            G  LSGGQK RI++ARA+  + ++ +LD+  SA+D E S+  +     + M   ++ T+
Sbjct: 750 KGISLSGGQKARISLARAVYSRADLFLLDDILSAVDAEVSKNIVEMVLDKKMGLLRNKTV 809

Query: 701 VSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADP 738
           V   + +S + RS+ I +L   GS+VE G F E+ + P
Sbjct: 810 VLTTNAISVLNRSQKIYML-EGGSIVEEGSFTEVTSSP 846

>NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10
          Length = 1506

 Score =  144 bits (364), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 151/550 (27%), Positives = 249/550 (45%), Gaps = 66/550 (12%)

Query: 224  FGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFDVH 283
            F + LY F   FS   +I   + +         S + +  LR+V  K  LH    + D  
Sbjct: 965  FYMGLYSFFVFFS---YILTTSQFTLLCCIGVLSSKWL-NLRAV--KRILHTPMSYLDTT 1018

Query: 284  KVGDLISRLGADSYIVSRSITQKISDGVKSLI---CGGVGIGMMLELSMDLSSVLVCFV- 339
             +G +++R   D+     S+  ++++ V+ L+      VG+ +M  + +   ++ + F+ 
Sbjct: 1019 PLGRILNRFTKDT----DSLDNELTESVRMLLYQFANIVGVCIMCIIYLPWFAIAIPFLF 1074

Query: 340  IPVVLSASIF---GKQI-RINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFN 395
            +  VL A  +   G++I R+ + +          V    L G+ T++S+ +E R I + +
Sbjct: 1075 VGFVLIADHYQSSGREIKRLEAIQRSFVYNNFNEV----LGGMDTIKSYRSENRFIAKSD 1130

Query: 396  HSIREIFDVGKRAAFIN---AKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFM 452
              I ++ + G     +    A F    ++   L    + V  ++ +   + ++G L  ++
Sbjct: 1131 FLIDKMNEAGYLVVAVQRWVAIFLDVIAVCFALIITLLCVTRAFPI--SAASVGVLLTYV 1188

Query: 453  LYTEYTGNAIFGLSTFYSEIMQGAG-----AASRLFELTDRVPTIRPTLGKTYTPGKGEI 507
            L      N +    T     M  A      A     E   R P + P       P KGEI
Sbjct: 1189 LQLPGLLNGVLRSLTQTENDMNSAERLVTYATELPLEADYRKPEVSPP---EEWPTKGEI 1245

Query: 508  EFKNVSFAY-PTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
             F+NV F+Y P  P+  + K+L+  IK G  + I G +G GKSTI   L      +SG++
Sbjct: 1246 HFENVDFSYRPGLPT--VLKNLSLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISSGKM 1303

Query: 567  LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDN----------------ITYGLTEE 610
            +ID  DI+ +    LRR++A++ Q+PVL  GTIR N                +  G  E+
Sbjct: 1304 IIDDVDISTIGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEHQDEHLWNALVRGGAIEQ 1363

Query: 611  PTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILIL 670
                EI+   K     N    + +  D  +   G   S G++Q +A+ RAL+++  ILIL
Sbjct: 1364 KELNEIKA-QKPDEKGNHSEMYKFHLDQLVEEEGANFSLGERQLLALTRALVRQARILIL 1422

Query: 671  DEATSALDVESEGAINY----TFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVV 726
            DEATS++D E++G I       FG        TI+ IAHRL TI   + I+VL   G V 
Sbjct: 1423 DEATSSVDYETDGKIQARIVEEFGHC------TILCIAHRLKTILTYDRILVL-EKGEVA 1475

Query: 727  EMGKFKELFA 736
            E    K LFA
Sbjct: 1476 EFDTPKTLFA 1485

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 110/211 (52%), Gaps = 20/211 (9%)

Query: 525 FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQ 584
           F  LNF+IK G  + +VGP G GK+++      + N  SG+I I+G              
Sbjct: 649 FHDLNFEIKKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQINGD------------- 695

Query: 585 IAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHG 644
             ++   P + + +++DNI +G      K +   V + C   + +   P    T IG  G
Sbjct: 696 -LLLCGYPWIQNASVKDNIIFG--SPYNKAKYDEVIRVCSLKSDLDILPAGDLTEIGERG 752

Query: 645 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 703
             LSGGQK RI +AR++ K+ +I + D+  SA+D    +  ++  F  L+K K+  + + 
Sbjct: 753 ITLSGGQKARINLARSVYKQKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKDKTRILAT- 811

Query: 704 AHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
            H+LS + R+  +IVLGNDGS  ++G  +EL
Sbjct: 812 -HQLSLLERASRVIVLGNDGS-FDIGTVEEL 840

>Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar to
            Ashbya gossypii AGR047W
          Length = 1505

 Score =  144 bits (362), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 143/501 (28%), Positives = 230/501 (45%), Gaps = 47/501 (9%)

Query: 262  ARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSY----IVSRSITQKISDGVKSLICG 317
            ARL   + K  L     FF+   VG +++R   D Y    ++ RS +Q      K     
Sbjct: 1015 ARLHDAMAKAVLRAPMSFFETTPVGRILNRFSNDIYKVDELLGRSFSQFFIHVTK----- 1069

Query: 318  GVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVS------ 371
             V   M++  S+      + F++P+ +    + +     SREL+    +L  V+      
Sbjct: 1070 -VVFTMIVICSITWQ--FIFFILPLSVLYLFYQQYYLRTSRELR----RLASVTKSPVYA 1122

Query: 372  --EEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSL--VGDLSF 427
              +E L GV TV+SF  + R I   N S    +      + INA  + +  L  +G +  
Sbjct: 1123 HFQETLTGVTTVRSFKKQDRFI-HINQSRINTYMCAYYLS-INANRWLAFRLEFMGSIVI 1180

Query: 428  LTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTD 487
            L   V   + +  G LT G L   + Y      ++  +     E+     +  R+ E TD
Sbjct: 1181 LAAAVLSVFRLKQGKLTAGMLGLGLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYTD 1240

Query: 488  R-------VPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPS-NQIFKSLNFKIKPGSNVC 539
                    +PT RP   K + P  G+I+F++ S  Y  RP  + I + +N  I P   V 
Sbjct: 1241 LKPEAPMIIPTSRPP--KNW-PANGDIKFEHFSTRY--RPELDLILEDINLHIHPREKVG 1295

Query: 540  IVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTI 599
            IVG +G GKS++ + L       +G+ILID   I  +    LR  ++++ Q+  +  GT 
Sbjct: 1296 IVGRTGAGKSSLTVSLFRLIEAAAGRILIDDLPIDSIGLNDLRSSLSIIPQDSEVFEGTF 1355

Query: 600  RDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYT-YDTYIGPHGTLLSGGQKQRIAIA 658
            R+NI      + T +EI    +       ++       +T +   G+ LS GQ+Q + +A
Sbjct: 1356 RENI--DPCNKFTDDEIWNALELAHLKQHVMTLGTEGLNTSLKEGGSNLSVGQRQLMCLA 1413

Query: 659  RALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIV 718
            RAL+    IL+LDEAT+A+DVE++  I  T     K +  TI++IAHRL+TI  S+ I+V
Sbjct: 1414 RALLVPSKILVLDEATAAIDVETDKLIQRTIRTAFKDR--TILTIAHRLNTIMDSDKIVV 1471

Query: 719  LGNDGSVVEMGKFKELFADPT 739
            L + G + E      L  D T
Sbjct: 1472 L-DKGRIAEFDTPCNLLKDET 1491

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 94/407 (23%), Positives = 181/407 (44%), Gaps = 32/407 (7%)

Query: 339 VIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNH-- 396
           VI + L++ I G Q ++   ++++   + TR+  E LN +++++ +  EQ    + ++  
Sbjct: 443 VITIPLNSLIMGIQKKLQGVQMKNKDKR-TRIISEILNNIKSLKLYAWEQPYKAKLDYVR 501

Query: 397 ---SIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFML 453
               ++ +  +G        +F     +V   +F T ++      L   L    L  F L
Sbjct: 502 NEKELKNLVKIGITNTISVFQFSVVPFMVSCATFGTFVLTQKDKALSTDLIFPALALFNL 561

Query: 454 YTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPT---LGKTYTPGKGEIEFK 510
            +   G      ++F    ++ + +  RL          R     L K    G   +   
Sbjct: 562 LSFPLGFIPMAATSF----IEASVSIKRLHSFLTSGEIQRDAIQHLPKVEEIGDISVNIS 617

Query: 511 -NVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI 568
            + ++ +  +P  ++  K++NF+ + G   CIVG  G GKS +   +L            
Sbjct: 618 GDATYLWQRQPEYKVALKNINFQARKGELSCIVGKVGTGKSALIQAML------------ 665

Query: 569 DGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNF 628
            G       S +L   +A V Q   +M+GTI+DNI +G   +    E +T+ K C     
Sbjct: 666 -GDLFRVKGSATLHGSVAYVSQVSWIMNGTIKDNILFGYKYDAEFYE-KTI-KACALSLD 722

Query: 629 IVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINY 687
           +   P    T++G  G  LSGGQK R+A+ARA+  K ++  LD+  +A+D   S+  + Y
Sbjct: 723 LNTLPDGDQTFVGERGISLSGGQKARLALARAVYAKADVYFLDDPLAAVDEHVSKHLVKY 782

Query: 688 TFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
             G     K+ T +   +++  +  +++I +L N G +V+ G + ++
Sbjct: 783 VIGPTGLLKTKTRILTTNKIHVLSVADSITLLDN-GVIVQQGSYDQV 828

>Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  143 bits (361), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 135/494 (27%), Positives = 229/494 (46%), Gaps = 41/494 (8%)

Query: 264  LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSY----IVSRSITQKISDGVKSLICGGV 319
            L +++    L     FF+   +G +++R   D Y    ++ R+ +Q   + VK +    V
Sbjct: 1026 LHNLMANSVLRAPMAFFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVIFTITV 1085

Query: 320  GIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRI-NSRELQDATGQLTRVS-----EE 373
                  +    +  + VC+         I+ +Q  +  SREL+     +TR       +E
Sbjct: 1086 ICATTWQFIFIIIPLGVCY---------IYYQQYYLRTSRELR-RLDSITRSPIYSHFQE 1135

Query: 374  QLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAF--INAKFFTS--TSLVGDLSFLT 429
             L G+ TV+ +  +    KRF+H  +   D    A +  INA  + +    L+G +  L 
Sbjct: 1136 TLGGLATVRGYSQQ----KRFSHINQCRIDNNMSAFYPSINANRWLAYRLELIGSIIILG 1191

Query: 430  VLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTD-- 487
                  + +  G+LT G     + Y       +  +     E+     +  R+ E  D  
Sbjct: 1192 AATLSVFRLKQGTLTAGMAGISLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLK 1251

Query: 488  -RVP-TIRPTLGKTYTPGKGEIEFKNVSFAYPTRPS-NQIFKSLNFKIKPGSNVCIVGPS 544
               P TI   +     P +G+I+F N S  Y  RP  + + K +N  IKP   + IVG +
Sbjct: 1252 SEAPLTIEGHMPPKEWPSQGDIKFNNYSTRY--RPELDLVLKHINIHIKPNEKIGIVGRT 1309

Query: 545  GKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNIT 604
            G GKS++ L L      ++G I+IDG  I ++    LR +++++ Q+  +  G++R+NI 
Sbjct: 1310 GAGKSSLTLALFRMIEASAGNIVIDGIAINEIGLYDLRHRLSIIPQDSQVFEGSLRENI- 1368

Query: 605  YGLTEEPTKEEIRTVAKQCFCHNFIVKFPYT-YDTYIGPHGTLLSGGQKQRIAIARALIK 663
               T + T E I    +       ++       D  +   G  LS GQ+Q + +ARA++ 
Sbjct: 1369 -DPTNQYTDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLV 1427

Query: 664  KPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDG 723
               ILILDEAT+A+DVE++  +  T     K +  TI++IAHRL+TI  S+ IIVL N G
Sbjct: 1428 PSKILILDEATAAVDVETDKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-G 1484

Query: 724  SVVEMGKFKELFAD 737
            +V E     +L ++
Sbjct: 1485 TVAEFDSPSQLLSN 1498

 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 107/493 (21%), Positives = 217/493 (44%), Gaps = 49/493 (9%)

Query: 264 LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQK---ISDGVKSLICGGVG 320
           L +++ + +L   +E   +   GD+++ +  D   + + +TQ    I  G   +I     
Sbjct: 382 LTALIYQKSLVLSNEASGLSSTGDIVNLMSVDVQKI-QDLTQWLNLIWSGPFQIIICLYS 440

Query: 321 IGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRT 380
           +  +L  SM +  +++  ++P  L++ +   Q ++   +++    + TRV  E LN +++
Sbjct: 441 LYKLLGNSMWVGVIILVIMMP--LNSFLMRIQKKLQKSQMK-YKDERTRVISEILNNIKS 497

Query: 381 VQSFVAEQ-----REIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGS 435
           ++ +  E+      E  R N  ++ +  +G   A  + +F     LV   +F  V VY  
Sbjct: 498 LKLYAWEKPYREKLEDIRNNKELKNLTRLGCYMAVTSFQFNIVPFLVSCCTF-AVFVYTE 556

Query: 436 YLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFEL---TDRVPTI 492
              L   L    LT F L +      +  +    +  ++ + +  RLF      +  P  
Sbjct: 557 DRALTTDLVFPALTLFNLLSF----PLMIIPMVLNSFIEASVSIGRLFTFFTNEELQPDS 612

Query: 493 RPTLGKTYTPGKGEIEF-KNVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGPSGKGKST 550
              L K    G   I    + +F +  +P  ++  K++NF+ K G   C+VG  G GK+ 
Sbjct: 613 VQRLPKVENFGDVAINVGDDATFLWQRKPEYKVALKNINFQAKKGELTCVVGKVGSGKTA 672

Query: 551 IALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEE 610
           +   +L       G   + G              +A V Q P +M+GT+ +NI +G    
Sbjct: 673 LLSCMLGDLFRVKGFATVHGS-------------VAYVSQVPWIMNGTVMENILFG---- 715

Query: 611 PTKEEIRTVAKQCFCHNFIVKFPYTYD---TYIGPHGTLLSGGQKQRIAIARALIKKPNI 667
             K ++    K        +      D   T +G  G  LSGGQK R+++ARA+  + + 
Sbjct: 716 -HKYDVEFYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYSRADT 774

Query: 668 LILDEATSALDVE-SEGAINYTFGQ--LMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGS 724
            +LD+  +A+D   +   I +  G   L+ +K+  + +  +++S +  ++++ +L N G 
Sbjct: 775 YLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTRLLAT--NKVSALSIADSVALLDN-GE 831

Query: 725 VVEMGKFKELFAD 737
           +++ G + E+  D
Sbjct: 832 IIQKGTYDEITKD 844

>NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10
          Length = 1491

 Score =  143 bits (361), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 143/541 (26%), Positives = 244/541 (45%), Gaps = 58/541 (10%)

Query: 231  FLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFDVHKVGDLIS 290
            ++G +S  +F G                R    L    +   LH    + D   +G +++
Sbjct: 951  YMGLYSFFVFAGYLFTSSQFTLLCAIGIRASKWLNLKAVHRILHTPMSYLDTTPLGRILN 1010

Query: 291  RLGADSYIVSRSITQKISDGVKSLI---CGGVGIGMMLELSMDLSSVLVCFVIPVVLSAS 347
            R   D+     S+  ++++ ++ ++      VG+ +M  + +   ++ + F+    +  +
Sbjct: 1011 RFTKDT----DSLDNELTESIRLMLFQTANIVGVCVMCIIYLPWFAIAIPFLF---IGFT 1063

Query: 348  IFGKQIRINSRELQDATG-QLTRVSE---EQLNGVRTVQSFVAEQREIKRFNHSIREIFD 403
            +     +   RE++     Q + V     E L G+ T++S+ +E+R + + ++ I ++ +
Sbjct: 1064 LITDHYQSTGREVKRLEAIQRSFVYNNFNEILGGMDTIKSYGSEERFLAKSDYLINKMNE 1123

Query: 404  VGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLH-GSLTIGDLTAFMLYTEYTGNAI 462
             G  +  +         LV     L + +       H  ++++G L  ++L      N +
Sbjct: 1124 AGYLSVALQRWVAIFLDLVAVCFALIITLLCVTRAFHISAVSVGVLLTYVLQLPGLLNGV 1183

Query: 463  FGLSTFYSEIMQGA----GAASRL-FELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYP 517
                T     M  A      A+ L  E   R P + P       P +G+IEFK+V F+Y 
Sbjct: 1184 LRALTQTENDMNSAERLVSYATELPLEAAYRRPEVSP---PENWPSEGKIEFKHVDFSY- 1239

Query: 518  TRPSNQI-FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKL 576
             RP   I  K L+  IK G  + I G +G GKSTI   L      + G+ILID  DI+KL
Sbjct: 1240 -RPGLPIVLKDLDLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISQGEILIDNVDISKL 1298

Query: 577  NSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEE---------IRTVAKQCFCHN 627
                LRR++A++ Q+PVL  GTIR N+      +P  E          +R  A +    N
Sbjct: 1299 GLYDLRRKLAIIPQDPVLFRGTIRKNL------DPFNEHDDDLLWDSLVRGGAIERAALN 1352

Query: 628  FIVK------------FPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATS 675
             I              F +  D  +   G   S G++Q +A+ RAL+++  +LILDEATS
Sbjct: 1353 KIKNQKVDKDGTHADMFKFHLDQLVEEEGANFSLGERQLLALTRALVRQAKVLILDEATS 1412

Query: 676  ALDVESEGAINYTFGQLMKS-KSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
            ++D E++G I     +++K     TI+ IAHRL+TI   + I+VL   G V E  K K L
Sbjct: 1413 SVDYETDGKIQ---ARIVKEFGDCTILCIAHRLNTILNYDRILVL-EKGEVAEFEKPKVL 1468

Query: 735  F 735
            F
Sbjct: 1469 F 1469

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 100/201 (49%), Gaps = 19/201 (9%)

Query: 525 FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQ 584
           F  +   IK G  + +VGP G GK++    L  + N T G+I ++G              
Sbjct: 627 FHDITLDIKKGEFIIMVGPIGTGKTSFLNALAGFMNKTEGRIQVNGD------------- 673

Query: 585 IAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHG 644
             ++   P + + T+RDNI +G   +  K E   V + C     +   P    T IG  G
Sbjct: 674 -LLLCGYPWIQNATVRDNILFGSPYDKKKYE--EVLRCCSLEADLDILPAGDSTEIGERG 730

Query: 645 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 703
             LSGGQK RI +AR + KK +I + D+  SA+D    +  ++  F  L+K+++  + + 
Sbjct: 731 ITLSGGQKARINLARCVYKKKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKNETRILAT- 789

Query: 704 AHRLSTIRRSENIIVLGNDGS 724
            H+LS + R+  +IVLG DGS
Sbjct: 790 -HQLSLLERASRVIVLGTDGS 809

>NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] {ON}
            Anc_8.303
          Length = 1517

 Score =  143 bits (360), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 138/500 (27%), Positives = 241/500 (48%), Gaps = 49/500 (9%)

Query: 264  LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSY----IVSRSITQKISDGVKSLICGGV 319
            L +++    L     FF+   +G +++R   D Y    ++ R+ +Q   + VK     GV
Sbjct: 1028 LHTLMTNAVLRAPMSFFETTPIGRILNRFSNDIYKVDSVLGRTFSQFFVNAVKVSFTIGV 1087

Query: 320  GIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRI-NSRELQDATGQLTRVS-----EE 373
                     + +++    FVI  +    I+ +Q  +  SREL+     +TR       +E
Sbjct: 1088 ---------ICVTTWQFIFVIVPLGVFYIYYQQYYLRTSRELR-RLDSITRSPVYSHFQE 1137

Query: 374  QLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAF---INAKFFTS--TSLVGDLSFL 428
             L G+ T++ +  +Q+   + N    +       +AF   +NA  + +    L+G +  L
Sbjct: 1138 TLGGIVTIRGY-GQQKRFSQINQCRVD----NNMSAFYPSVNANRWLAYRLELIGSIIIL 1192

Query: 429  TVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTD- 487
                     +  G+LT G +   + Y      ++  +     E+     +  R+ E  D 
Sbjct: 1193 GAATLSVMRLKQGTLTAGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYADL 1252

Query: 488  --RVPTI----RPTLGKTYTPGKGEIEFKNVSFAYPTRPS-NQIFKSLNFKIKPGSNVCI 540
                P I    RP   +T+ P +G+I+F++ S  Y  RP  + + K +NF IKP   + I
Sbjct: 1253 KSEAPEIIEDHRPQ--ETW-PEEGDIKFEHYSTRY--RPELDLVLKDINFHIKPKEKIGI 1307

Query: 541  VGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIR 600
            VG +G GKS++ L L      + G I+ID  DI+ +    LR +++++ Q+  +  GTIR
Sbjct: 1308 VGRTGAGKSSLTLALFRIIEASEGNIIIDNVDISDIGLYDLRHKLSIIPQDSQVFEGTIR 1367

Query: 601  DNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYT-YDTYIGPHGTLLSGGQKQRIAIAR 659
            +NI    T + T E+I  V +     + I        DT +   G+ LS GQ+Q + +AR
Sbjct: 1368 ENI--DPTNQYTDEQIWRVLELSHLRDHIATMGGDGLDTKLNEGGSNLSVGQRQLMCLAR 1425

Query: 660  ALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVL 719
            AL+    IL+LDEAT+A+DVE++  +  T     K +  TI++IAHR++TI  ++ I+VL
Sbjct: 1426 ALLVPSKILVLDEATAAVDVETDKVLQETIRTSFKDR--TILTIAHRINTIMDNDRIMVL 1483

Query: 720  GNDGSVVEMGKFKELFADPT 739
             N GS+ E  + K+L  + +
Sbjct: 1484 DN-GSIKEFDEPKKLLENKS 1502

 Score = 89.4 bits (220), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 113/493 (22%), Positives = 218/493 (44%), Gaps = 49/493 (9%)

Query: 264 LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYI---VSRSITQKISDGVKSLICGGVG 320
           L SV+ +  L   +E   +   GD+++ +  D      +S+ I    S   + ++C  + 
Sbjct: 380 LTSVIYEKALVLSNEASGISSTGDIVNLMSVDVQKLQDISQFINLLWSAPFQIVLCL-IS 438

Query: 321 IGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRT 380
           +  +L  SM +  +++  ++P  L++ +   Q ++   ++Q    + TRV  E LN +++
Sbjct: 439 LYKLLGHSMWVGVIILVIMMP--LNSFLMKTQKKLQKSQMQ-FKDERTRVISEILNNIKS 495

Query: 381 VQSFVAE-----QREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGS 435
           ++ +  E     + E  R N  ++ +  +G   A ++ +F     LV   +F  V VY  
Sbjct: 496 LKLYAWETPYKAKLENVRNNKELKNLTKLGCYMALMSFQFNVVPFLVSCSTF-AVFVYTE 554

Query: 436 YLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPT 495
              L   L    LT F L        +  +    + +++ + +  RLF         + +
Sbjct: 555 DRPLTTDLVFPALTLFNLL----HFPLMVIPNVLTALIECSVSVGRLFSFLTNEELQKDS 610

Query: 496 ---LGKTYTPGKGEIEF-KNVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGPSGKGKST 550
              L K    G   I    + +F +  +P  ++  K++NF+ K G   CIVG  G GKS 
Sbjct: 611 VQRLPKVTEIGDVAINVGDDATFLWQRKPEYKVALKNVNFQAKKGELTCIVGRVGSGKSA 670

Query: 551 IALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEE 610
           +   +L       G   I G              +A V Q   +M+GT++DNI +G   +
Sbjct: 671 LIQSILGDLFRVKGFATIHGN-------------VAYVSQVAWIMNGTVKDNILFG--HK 715

Query: 611 PTKEEIRTVAKQCFCHNFIVKFPYTYD---TYIGPHGTLLSGGQKQRIAIARALIKKPNI 667
              E      K C      +      D   T +G  G  LSGGQK R+++ARA+  + + 
Sbjct: 716 YDAEFYEKTIKAC---ALTIDLSVLVDGDQTLVGEKGISLSGGQKARLSLARAVYSRADT 772

Query: 668 LILDEATSALDVE-SEGAINYTFGQ--LMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGS 724
            +LD+  +A+D   +   I +  G   L+ +K+  + +  +++S +  ++++ +L N G 
Sbjct: 773 YLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTKVLAT--NKVSVLSVADSVSLLEN-GE 829

Query: 725 VVEMGKFKELFAD 737
           +V+ G + E+  D
Sbjct: 830 IVQQGSYDEIMKD 842

>YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter mediates export of many different
            organic anions including oligomycin; similar to human
            cystic fibrosis transmembrane receptor (CFTR)
          Length = 1477

 Score =  142 bits (358), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 151/545 (27%), Positives = 247/545 (45%), Gaps = 56/545 (10%)

Query: 224  FGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFDVH 283
            F + LY F   F  A FI     +         + + +  LR+V  K  LH    + D  
Sbjct: 933  FYMGLYSF---FVFAAFIFMNGQFTILCAMGIMASKWL-NLRAV--KRILHTPMSYIDTT 986

Query: 284  KVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPV- 342
             +G +++R   D+  +   +T+ +   + S     VG+ +M  + +   ++ + F++ + 
Sbjct: 987  PLGRILNRFTKDTDSLDNELTESLR-LMTSQFANIVGVCVMCIVYLPWFAIAIPFLLVIF 1045

Query: 343  VLSASIF---GKQI-RINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSI 398
            VL A  +   G++I R+ + +       L  V    L G+ T++++ +++R + + +  I
Sbjct: 1046 VLIADHYQSSGREIKRLEAVQRSFVYNNLNEV----LGGMDTIKAYRSQERFLAKSDFLI 1101

Query: 399  REIFDVGKRAAFIN--AKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTE 456
             ++ + G     +      F     +     +T+L       +  + ++G L  ++L   
Sbjct: 1102 NKMNEAGYLVVVLQRWVGIFLDMVAIAFALIITLLCVTRAFPISAA-SVGVLLTYVLQLP 1160

Query: 457  YTGNAIFGLSTFYSEIMQGAG-----AASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKN 511
               N I    T     M  A      A     E + R P + P       P  GEI F+N
Sbjct: 1161 GLLNTILRAMTQTENDMNSAERLVTYATELPLEASYRKPEMTPP---ESWPSMGEIIFEN 1217

Query: 512  VSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG 570
            V FAY  RP   I  K+LN  IK G  + I G +G GKSTI   L      T+G+ILID 
Sbjct: 1218 VDFAY--RPGLPIVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELTAGKILIDN 1275

Query: 571  QDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIR-------TVAKQC 623
             DI++L    LRR++A++ Q+PVL  GTIR N+      E T +E+         +AK  
Sbjct: 1276 VDISQLGLFDLRRKLAIIPQDPVLFRGTIRKNL--DPFNERTDDELWDALVRGGAIAKDD 1333

Query: 624  F------------CHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILD 671
                          H  + KF    D  +   G+  S G++Q +A+ RAL+++  ILILD
Sbjct: 1334 LPEVKLQKPDENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILD 1391

Query: 672  EATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKF 731
            EATS++D E++G I     +  +    TI+ IAHRL TI   + I+VL   G V E    
Sbjct: 1392 EATSSVDYETDGKIQTRIVE--EFGDCTILCIAHRLKTIVNYDRILVL-EKGEVAEFDTP 1448

Query: 732  KELFA 736
              LF+
Sbjct: 1449 WTLFS 1453

 Score = 95.1 bits (235), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 68/214 (31%), Positives = 107/214 (50%), Gaps = 22/214 (10%)

Query: 525 FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQ 584
           FK LNF IK G  + I GP G GKS++   +      T G++ ++G              
Sbjct: 604 FKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEVNGD------------- 650

Query: 585 IAVVQQEPVLMSGTIRDNITYGLTEEP-TKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPH 643
             ++   P + + ++RDNI +G    P  KE+   V + C     +   P    T IG  
Sbjct: 651 -LLMCGYPWIQNASVRDNIIFG---SPFNKEKYDEVVRVCSLKADLDILPAGDMTEIGER 706

Query: 644 GTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVS 702
           G  LSGGQK RI +AR++ KK +I + D+  SA+D    +  ++     ++ +K+  + +
Sbjct: 707 GITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANKTRILAT 766

Query: 703 IAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFA 736
             H+LS I R+  +IVLG DG  V++G   EL A
Sbjct: 767 --HQLSLIERASRVIVLGTDGQ-VDIGTVDELKA 797

>KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4.6
            YHL035C
          Length = 1717

 Score =  141 bits (356), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 135/509 (26%), Positives = 233/509 (45%), Gaps = 71/509 (13%)

Query: 263  RLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIG 322
            ++ ++++   +H    FFD   +G +++R   D   V + +T  ++    S +     I 
Sbjct: 1193 KIFAMLLNKVIHSKLRFFDTTPIGRIMNRFSKDIESVDQELTPYLTGAFYSFVECFSTII 1252

Query: 323  MMLELSMDLSSVLVCFVIPVVLSASIF--GKQIRINSRELQD----ATGQLTRVSEEQLN 376
            ++  ++         FV+ +++S   +  G      SREL+         + +   E L 
Sbjct: 1253 LISWITPQF------FVVAILISIMYYLVGYFYMAGSRELKRLDSITKSPIYQHFSETLV 1306

Query: 377  GVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSY 436
            GV T+++F  E R +K        +F + +     N  FF        LSF   ++ GS+
Sbjct: 1307 GVTTIRAFGDEMRFLKE------NLFKIDEN----NKPFFYLWVANRWLSFRIDMI-GSF 1355

Query: 437  LVL-HGSLTIGDL---------TAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRL---- 482
            +V   G   + D+          +      +T  A++ L  FYSE+     +  R+    
Sbjct: 1356 VVFGAGVFILADIKNIDSGMAGISLTYAISFTEGALW-LVRFYSEVEMNMNSVERIKEYM 1414

Query: 483  ------FELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGS 536
                  +++ D +    PT+     P +G+IE  ++S  Y      ++ K+++F ++P S
Sbjct: 1415 SVEQEPYDIKDEIVRTPPTVW----PDEGKIEVNDLSLRYAANLP-RVIKNVSFTVEPNS 1469

Query: 537  NVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMS 596
             V +VG +G GKSTI   L  + +P SG I ID  DIT +    LRR I ++ Q+P L +
Sbjct: 1470 KVGVVGRTGAGKSTIITALFRFLDPESGYIKIDNMDITTIPLTRLRRAITIIPQDPTLFA 1529

Query: 597  GTIRDN-----------ITYGLTE------EPTKEEIRTVAKQCFCHNFIVKFPYTYDTY 639
            GT++ N           I   LT       E    E   V+ Q   H+            
Sbjct: 1530 GTLKFNLDPYDEYNDKDIFAALTRVNLVSGEELNGETTAVSDQGSMHSNNENRFLDLSNE 1589

Query: 640  IGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTF-GQLMKSKSM 698
            I   G  LS GQ+Q I +AR+L++ P IL+LDEAT+++D ES+  +  T  G+   S   
Sbjct: 1590 ITEGGGNLSQGQRQLICLARSLLRNPKILLLDEATASIDYESDARLQATIRGEFGNS--- 1646

Query: 699  TIVSIAHRLSTIRRSENIIVLGNDGSVVE 727
            TI++IAHRL ++   + I+V+ + G V+E
Sbjct: 1647 TILTIAHRLRSVIDYDKILVM-DAGEVIE 1674

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 117/483 (24%), Positives = 214/483 (44%), Gaps = 36/483 (7%)

Query: 270 KHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLEL-- 327
           + +++ D E     K+G +I+ +  D+Y +S  I   +    ++++   + + ++  L  
Sbjct: 525 EESINADEESGSNAKLGTIINLMAIDAYKISE-ICAYLHFFAEAIVMTVIALVLLYRLIG 583

Query: 328 -SMDLSSVLVCFVIPVVLS-ASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFV 385
            +  L +V++  ++PV    A++ G   ++   E      +L     E L  +R ++ F 
Sbjct: 584 NAAILGTVIILVLLPVNFKLATLLGDYQKLTLGETDKRIHKLN----EALQSIRIIKFFS 639

Query: 386 AE---QREIKRFNHSIREIFDVGKRA-AFINAKF--FTSTSLVGDLSFLTVLVYGSYLVL 439
            E   +R+I       RE+  + KR  A++   F  F + S+V   SF        Y+ +
Sbjct: 640 WENNFERDIMEIRE--RELQMLIKRTLAWVMGGFVWFVTPSIVTTASF------AWYIYV 691

Query: 440 HGSL--TIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLG 497
            G +  T    TA  L+T    + +  +S   S  +Q   +  R+        T +    
Sbjct: 692 QGEVLTTPVAFTALSLFT-LLRDPLDRVSDMLSFAIQSKVSLERVGAFLSEAETEKYEQL 750

Query: 498 KTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLH 557
                GK ++ F N + ++ T  S    ++LN   K G    ++G +G GK+++ + LL 
Sbjct: 751 TVDNEGK-KLAFDNSTTSWDTNGSGFKLRNLNIDFKVGKLNVVIGATGSGKTSLLMALLG 809

Query: 558 YYNPTSGQILI---DGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKE 614
             +   G+I++   + +     NS      IA   Q   L++ T+R+NI +  + +  + 
Sbjct: 810 EMHICQGRIIVPSLEPRSSLTANSDGFTNSIAYCSQAAWLLNDTVRNNILFNSSFDENR- 868

Query: 615 EIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEAT 674
               V + C              T IG  G  LSGGQKQRI++ARAL      L+LD+  
Sbjct: 869 -YHKVVEACGLKRDFDILKAGDLTEIGEKGITLSGGQKQRISLARALYSDSKHLLLDDCL 927

Query: 675 SALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFK 732
           SA+D  +   I  N   G LM  ++  +VS  H ++   R+  ++V+  DG V + G   
Sbjct: 928 SAVDSHTASWIYDNCITGPLMVGRTCILVS--HNIALTLRNAELVVILEDGRVKDQGDPL 985

Query: 733 ELF 735
            LF
Sbjct: 986 NLF 988

>KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] {ON} 
          Length = 1537

 Score =  141 bits (356), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 128/498 (25%), Positives = 229/498 (45%), Gaps = 48/498 (9%)

Query: 269  MKHTL-HQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLEL 327
            M H + +   +FF+   +G +++R  AD   V  ++        KS+    + + +++ +
Sbjct: 1044 MAHAIVYSSMQFFETTPIGRILNRFSADIDTVDSTLQMVFMVFFKSIFSYLITV-ILITI 1102

Query: 328  SMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATG----QLTRVSEEQLNGVRTVQS 383
            SM L  V   F++ + +    + K   + SREL+  T      +  +  E L G+  +++
Sbjct: 1103 SMPLFLVFCLFLMVIYIY---YQKLFIVQSRELKRMTSISYSPIMSLVGESLGGLAVIRA 1159

Query: 384  F----VAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVL 439
            +    + +    +R   +I  +FD      +++ +  T  +L   +  +T ++  S +  
Sbjct: 1160 YKHFSMFKYLNNERVQFNINCVFDYRSTNRWLSIRLQTIGAL---MVLITGMLSLSTISS 1216

Query: 440  HGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKT 499
               LT G +   M Y      ++  +      I  G  +  R+ E  + +P+    +   
Sbjct: 1217 SKPLTAGMVGLLMSYVLQVTTSLMWIVRSSVMIETGIVSVERIMEYCE-LPSEAEQIVDD 1275

Query: 500  YTPG-----KGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALL 554
            Y P      KG I+FKN S  Y     + + K+++  I PG  V IVG +G GKST+ L 
Sbjct: 1276 YRPASNWPSKGAIQFKNYSTRYRAN-LDPVLKNISININPGEKVGIVGRTGAGKSTLTLA 1334

Query: 555  LLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDN------------ 602
            L     P  G I+IDG DI+K+    LR  +A++ Q+     GT+R N            
Sbjct: 1335 LFRLLEPIEGTIIIDGMDISKIGISDLRSHLAIIPQDAQAFEGTVRSNLDPFNMFSDKEL 1394

Query: 603  ---ITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIAR 659
               IT    +   K+ +     +   ++++       +  I   G+ LS GQ+Q + +AR
Sbjct: 1395 DTAITLSHLKPHLKKLMEESGSELPLNDYL-------ELGIKESGSSLSVGQRQLLCLAR 1447

Query: 660  ALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVL 719
            AL+ +  IL+LDEAT+++DVE++  I  T  +    +  TI++IAHR+ T+  S+ I+VL
Sbjct: 1448 ALLNRSKILVLDEATASVDVETDKIIQATIRESFSDR--TIITIAHRIDTVLDSDRILVL 1505

Query: 720  GNDGSVVEMGKFKELFAD 737
               G V E      L AD
Sbjct: 1506 -EQGEVKEFNSPASLLAD 1522

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 95/404 (23%), Positives = 178/404 (44%), Gaps = 56/404 (13%)

Query: 369 RVSEEQLNGVRTVQSFVAEQREIKRFNHSIR---EIFDVGKRAAFINAKFFTSTSLVGDL 425
           + + E LN +++++ +  E+  +KR ++ IR   E+ ++ K     N  +F    +    
Sbjct: 473 KTTSEMLNSMKSIKLYAWEKPMLKRLSY-IRNDLELANLKKIGIATNLIYFAWNCV---- 527

Query: 426 SFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYT-----GNAIFGLSTFYSEIMQGAGAAS 480
               ++V  S   ++  +T   LT  +++   +      +AI+ +    S+I++   +  
Sbjct: 528 ---PLVVTCSTFAIYSLITDNPLTPELVFPSLSLFNILNDAIYTIPATISQIIETNVSIG 584

Query: 481 R-----LFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQI----------- 524
           R     L E  DR  +    +   +      +E  N +F + ++ S Q            
Sbjct: 585 RVKKFLLGEELDR--SFIEEIADKHDESPFAVEILNATFLWKSKASLQAGDGTDEETSIG 642

Query: 525 -----FKSLNF-KIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG-QILIDGQDITKLN 577
                 K ++F + K     C+VG  G GK+T+   +L     TSG Q  I  + I +  
Sbjct: 643 STVVALKDIDFFRAKKNVLTCVVGRVGSGKTTLLKSILGQLPCTSGSQKAIPPKLIIRGE 702

Query: 578 SKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYD 637
           S      +A   QE  +M+ +I++NI +G   + T   +    K C         P   +
Sbjct: 703 S------VAYCPQEAWIMNDSIKENILFGHRYDETFYNL--TVKACELRPDFKILPDGDN 754

Query: 638 TYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQ----LM 693
           T +G  G  LSGGQK R+++ARA+  + +I +LD+  SA+D     +I +        L+
Sbjct: 755 TLVGEKGITLSGGQKARLSLARAVYSRSDIYLLDDVLSAVDAGVRKSIIHRVLDSDTGLL 814

Query: 694 KSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFAD 737
           K+K+  I+   + +S +  S+ I VL  DG ++E   + E   D
Sbjct: 815 KNKA--IILTTNDISVLEHSDRIYVL-QDGRIIEESTYAEAIED 855

>Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR281W
            (REAL)
          Length = 1477

 Score =  141 bits (355), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 148/543 (27%), Positives = 250/543 (46%), Gaps = 54/543 (9%)

Query: 224  FGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFDVH 283
            F + LY F   F  A FI     Y         + + +  L++V  K  LH    + D  
Sbjct: 933  FYMGLYSF---FVFAAFIFMNGQYTILCVMGIMASKWL-NLKAV--KRILHTPMSYIDTT 986

Query: 284  KVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPV- 342
             +G +++R   D+  +   +T+ +   + S     VG+ +M  + +   ++ + F++ + 
Sbjct: 987  PLGRILNRFTKDTDSLDNELTESLR-LLTSQFANIVGVCVMCIVYLPWFAIAIPFLLVIF 1045

Query: 343  VLSASIF---GKQI-RINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSI 398
            VL A  +   G++I R+ + +       L  V    L G+ T++++ +++R + + +  I
Sbjct: 1046 VLIADHYQSSGREIKRLEAVQRSFVYNNLNEV----LGGMDTIKAYRSQERFLAKSDFLI 1101

Query: 399  REIFDVGKRAAFIN---AKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYT 455
             ++ + G     +      F    ++V  L    + V  ++ +   + ++G L  ++L  
Sbjct: 1102 NKMNEAGYLVVVLQRWVGVFLDMVAIVFALIVTLLCVTRAFPI--SAASVGVLLTYVLQL 1159

Query: 456  EYTGNAIFGLSTFYSEIMQGA----GAASRL-FELTDRVPTIRPTLGKTYTPGKGEIEFK 510
                N I    T     M  A      A+ L  E   R P + P       P KGEI  +
Sbjct: 1160 PGLLNTILRAMTQTENDMNSAERLVSYATELPLEADYRKPEMTP---PESWPSKGEIVLE 1216

Query: 511  NVSFAY-PTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILID 569
            NV F+Y P  P   + K+LN  I+ G  + I G +G GKSTI   L      ++G+ILID
Sbjct: 1217 NVCFSYRPGLPV--VLKNLNLNIESGEKIGICGRTGAGKSTIMSALYRLNELSAGKILID 1274

Query: 570  GQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIR-------TVAKQ 622
              DI+KL    LRR++A++ Q+PVL  GTIR N+     +E T +E+         +AK 
Sbjct: 1275 DVDISKLGLFDLRRKLAIIPQDPVLFRGTIRKNLDP--FDERTDDELWDALVRGGAIAKN 1332

Query: 623  CFCHNFIVK----------FPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDE 672
                  + K            +  D  +   G+  S G++Q +A+ RAL+++  ILILDE
Sbjct: 1333 DLSEAKLQKPDKNGTHGRMHKFHLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDE 1392

Query: 673  ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFK 732
            ATS++D E++G I     +  +    TI+ IAHRL TI   + I+VL   G V E     
Sbjct: 1393 ATSSVDYETDGKIQARIVE--EFGDCTILCIAHRLQTIVNYDRILVL-EKGEVAEFDTPW 1449

Query: 733  ELF 735
             LF
Sbjct: 1450 TLF 1452

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/214 (31%), Positives = 106/214 (49%), Gaps = 22/214 (10%)

Query: 525 FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQ 584
           FK LNF+IK G  + I GP G GKS++   +      T G+I ++G              
Sbjct: 604 FKDLNFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNGD------------- 650

Query: 585 IAVVQQEPVLMSGTIRDNITYGLTEEP-TKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPH 643
             ++   P + +  +RDNI +G    P  KE+   V + C     +   P    T IG  
Sbjct: 651 -LLMCGYPWIQNAPVRDNIIFG---SPFIKEKYNEVIRVCSLKADLDILPAGDMTEIGER 706

Query: 644 GTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVS 702
           G  LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++     ++ +K+  + +
Sbjct: 707 GITLSGGQKARINLARSVYKRKEIYLFDDVLSAVDSRVGKHIMDECLTGMLANKTRILAT 766

Query: 703 IAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFA 736
             H+LS I R+  +IVLG DG  V++G   EL A
Sbjct: 767 --HQLSLIERASRVIVLGTDGQ-VDIGTVDELKA 797

>KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1442

 Score =  141 bits (355), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 134/498 (26%), Positives = 234/498 (46%), Gaps = 44/498 (8%)

Query: 269  MKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELS 328
            ++  LH    + D   +G +++R   D+  +   +T+ I   + S +   +G+ +M  + 
Sbjct: 938  VERILHTPMSYLDTTPLGRILNRFTKDTDSLDNELTESIR-LMLSQVGNLIGVIVMCIVY 996

Query: 329  MDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATG-QLTRVSE---EQLNGVRTVQSF 384
            +   ++ V F++ + +   +     +   RE++     Q + V     E L G+ T++++
Sbjct: 997  LPWFAIAVPFLLIIFV---LICDHYQSTGREIKRLEAVQRSFVYNNFNEVLGGMDTIKAY 1053

Query: 385  VAEQREIKRFNHSIREIFDVGKRAAFIN---AKFFTSTSLVGDLSFLTVLVYGSYLVLHG 441
             +++R + + ++ I ++ + G     +    A    S ++V  L    + V  ++ +  G
Sbjct: 1054 GSQERFLAKTDYLINKMNEAGYLIVAVQRWVAILLDSVAVVFALIITLLCVTRAFPISAG 1113

Query: 442  SLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAG-----AASRLFELTDRVPTIRPTL 496
            S  +G L  ++L      N I    T     M  A      A     E   R P + P  
Sbjct: 1114 S--VGVLLTYVLQLPGLLNTILRALTQTENDMNSAERLVTYATELPLEAAYRKPEVSP-- 1169

Query: 497  GKTYTPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLL 555
                 P KG+I+F +V+FAY P  P   + K++N KI  G  + I G +G GKSTI   L
Sbjct: 1170 -PESWPEKGDIDFIDVNFAYRPGLPV--VLKNMNLKINNGEKIGICGRTGAGKSTIMSAL 1226

Query: 556  LHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDN------------- 602
                  + G+I+IDG DI K+    LR+++ ++ Q+PVL  GTIR N             
Sbjct: 1227 YRLNELSDGKIVIDGVDIRKIGLYDLRKKLTIIPQDPVLFRGTIRKNLDPFKECSDDLLW 1286

Query: 603  ---ITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIAR 659
               I  G+ E     +I+ + K    +++     +  D  +   G+  S G++Q +A+ R
Sbjct: 1287 DALIRTGVVERENLNDIK-LEKPDENNSYSNMHKFHLDELVEEEGSNFSLGERQMLALTR 1345

Query: 660  ALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVL 719
            AL++   ILILDEATS++D E++G I      + +    TI+ IAHRL TI   + I+VL
Sbjct: 1346 ALVRNSKILILDEATSSVDYETDGKIQSRI--VSEFGDCTILCIAHRLKTILSYDKILVL 1403

Query: 720  GNDGSVVEMGKFKELFAD 737
               G + E  K  ELF D
Sbjct: 1404 -EKGVIAEYEKPWELFND 1420

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/212 (30%), Positives = 106/212 (50%), Gaps = 22/212 (10%)

Query: 525 FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQ 584
           F  LN +I  G  + + GP G GK+++   +  +   TSG++ ++G+             
Sbjct: 581 FTDLNLEIFKGEFIIVTGPIGTGKTSLLNAMAGFMKQTSGRVEVNGE------------- 627

Query: 585 IAVVQQEPVLMSGTIRDNITYGLT-EEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPH 643
             ++   P +++ T+RDNI +G   EE    EI  V   C     +   P    T IG  
Sbjct: 628 -LLLCGYPWILNATVRDNILFGSPYEEARYNEIVEV---CSLDADLKILPAGDRTEIGER 683

Query: 644 GTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVS 702
           G  LSGGQK RI +ARA+ K  +I + D+  SA+D    +  ++     ++K K+  + +
Sbjct: 684 GITLSGGQKARINLARAVYKNKDIFLFDDVLSAVDSRVGKHIMDDCLLGILKGKTRILAT 743

Query: 703 IAHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
             H+LS I R++ IIV+G +GS  + G   EL
Sbjct: 744 --HQLSVIERADRIIVVGPNGS-FDFGTLDEL 772

>CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1659

 Score =  141 bits (355), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 153/553 (27%), Positives = 254/553 (45%), Gaps = 71/553 (12%)

Query: 223  MFGLTLYEFLGGFSVALFIGCAA--NYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFF 280
            ++ L++Y F  G + ALF G     N+         S R+  +L S V    LH    F 
Sbjct: 1107 LYYLSIY-FAIGITQALFAGTKTVINF---VAGINASRRIFKKLLSKV----LHSRLRFI 1158

Query: 281  DVHKVGDLISRLGADSYIVSRSITQKISDGVKSLI-C-GGVGIGMMLELSMDLSSVLVCF 338
            D   +G +++R   D   V + +T  +      L+ C   + +   +       +VLVC 
Sbjct: 1159 DSTPIGRIMNRFSKDIEAVDQELTPFLEAAFFCLVQCISTIILITFITPQFLFVAVLVCV 1218

Query: 339  VIPVVLSASIFGKQIRINSRELQD----ATGQLTRVSEEQLNGVRTVQSFVAEQREIKRF 394
            +  +V      G      SREL+         + +   E L GV T+++F  E R I   
Sbjct: 1219 LYYLV------GYFYINTSRELKRIESITKSPIYQHFSETLTGVATIRAFGDEIRFIM-- 1270

Query: 395  NHSIREIFDVGKRAAFI---NAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGD---- 447
             H++ +I +  K   ++   N        ++G L     +++GS + +  +L   D    
Sbjct: 1271 -HNLEKIDENNKPFFYLWVANRWLAFRIDMIGAL-----IIFGSGVFILLNLNRIDSGMA 1324

Query: 448  ---LTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTD--RVPTIRPTLG-KTYT 501
               LT  + +TE        L  FYS +     +  RL E  D  + P    T+   T  
Sbjct: 1325 GISLTYAISFTE----GALWLVRFYSTVEMNMNSVERLKEYMDVPQEPYNEGTITTSTNW 1380

Query: 502  PGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNP 561
            P +G+IE K++S  Y      ++ K ++F I+P + V IVG +G GKSTI   L  +  P
Sbjct: 1381 PTEGKIEVKDLSLRYAENLP-RVIKEVSFDIEPHNMVGIVGRTGAGKSTIITALFRFLEP 1439

Query: 562  TSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNIT-YGLTEEPTKEEIRTVA 620
             +G I IDG DIT ++ ++LRR I ++ Q+P L +GTIR N+  +G  + P +E  R + 
Sbjct: 1440 ETGSIKIDGIDITSIDLQTLRRSITIIPQDPTLFTGTIRSNLDPFG--KYPDEEIFRVLH 1497

Query: 621  KQCFCHN----------------FIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKK 664
            +     +                 + KF    +  I   G  LS GQKQ + +ARAL++ 
Sbjct: 1498 RVNLIDDDEMTAQSSDNNSLSSDNVNKF-LNLENEITEGGNNLSQGQKQLMCLARALLRN 1556

Query: 665  PNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGS 724
            P +++LDEAT+++D  S+  I  T   +      T+++IAHRL ++   + I+V+ + G 
Sbjct: 1557 PKVILLDEATASIDYASDAKIQQTIRNVFDKS--TVLTIAHRLRSVIDYDKILVM-DAGE 1613

Query: 725  VVEMGKFKELFAD 737
            V+E  +   L  D
Sbjct: 1614 VIEYDQPYTLLLD 1626

 Score =  109 bits (272), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 117/467 (25%), Positives = 206/467 (44%), Gaps = 30/467 (6%)

Query: 285 VGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLEL---SMDLSSVLVCFVIP 341
           +G +I+ +  D++ VS  I   +   +++++   V   ++ +L   +  +  ++V  +IP
Sbjct: 494 IGAIINLMAVDAFKVSE-ICAYLHTFIEAMVMSVVAFSLLYKLLGYAAIVGILIVIGMIP 552

Query: 342 VVLS-ASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQR---EIKRFNHS 397
           V     S+ GK      ++    T +  +   E L  +R ++ F  E     EI     +
Sbjct: 553 VNFKLVSLMGKY----QKKALGITDKRIQKLNEALQAIRIIKFFSWEDNFFSEIDEIREA 608

Query: 398 -IREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTE 456
            I+   +     AF    +F + ++V   SF TV +Y    VL   +    L  F L  +
Sbjct: 609 EIQMYINKAYAWAFSAFIWFLTPTIVTGASF-TVYIYVQKQVLTAPVAFTALALFQLLKQ 667

Query: 457 YTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAY 516
                +  LS   S ++Q   +  R+    D   T +    K   P   ++ F+N + A+
Sbjct: 668 ----PLDQLSNMLSYVIQSKVSLDRVQNFLDEEDTQKYNQLKV-APDGNKLAFENATIAW 722

Query: 517 PTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI---DGQDI 573
                +   K L+   K G    ++GP+G GK+++ L LL      SG+I++   D +  
Sbjct: 723 SNNNQDFKLKDLDINFKIGKLNVVIGPTGSGKTSLLLALLGEMQLLSGRIVVPSLDARHE 782

Query: 574 TKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEE-IRTVAKQCFCHNFIVKF 632
             ++S  +   IA   Q   L++ T+R+NI   L   P  E+  + V   C        F
Sbjct: 783 MLIDSDGMTNSIAYCSQSAWLLNDTVRNNI---LFYSPYNEDRYKEVIIACGLKRDFELF 839

Query: 633 PYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTFG 690
                T IG  G  LSGGQKQRI++ARAL      L+LD+  SA+D  +   I  N   G
Sbjct: 840 DAGDQTEIGEKGITLSGGQKQRISLARALYSNCRHLLLDDCLSAVDSHTAAWIYDNCITG 899

Query: 691 QLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFAD 737
            LM+ ++  +VS  H ++   ++  ++V+  +G +   G    L  D
Sbjct: 900 PLMEGRTCVLVS--HNIALTLKNAELVVMLENGRITNRGDPISLLKD 944

>Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON}
            YGR281W (REAL)
          Length = 1477

 Score =  140 bits (354), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 150/545 (27%), Positives = 249/545 (45%), Gaps = 56/545 (10%)

Query: 224  FGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFDVH 283
            F + LY F   F  A FI     +         + + +  LR+V  +  LH    + D  
Sbjct: 933  FYMGLYSF---FVFAAFIFMNGQFTILCAMGIMASKCL-NLRAV--RRILHTPMSYIDTT 986

Query: 284  KVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPV- 342
             +G +++R   D+  +   +T+ +   + S     VG+ +M  + +   ++ + F++ V 
Sbjct: 987  PLGRILNRFTKDTDSLDNELTESLR-LMTSQFANIVGVCVMCIVYLPWFAIAIPFLLVVF 1045

Query: 343  VLSASIF---GKQI-RINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSI 398
            VL A  +   G++I R+ + +       L  V    L G+ T++++ +++R + + +  I
Sbjct: 1046 VLIADHYQSSGREIKRLEAVQRSFVYNNLNEV----LGGMDTIKAYRSQERFLAKSDFLI 1101

Query: 399  REIFDVGKRAAFIN--AKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTE 456
             ++ + G     +      F     +     +T+L       +  + ++G L  ++L   
Sbjct: 1102 NKMNEAGYLVVVLQRWVGIFLDMVAIAFALIITLLCVTRAFPISAA-SVGVLLTYVLQLP 1160

Query: 457  YTGNAIFGLSTFYSEIMQGA----GAASRL-FELTDRVPTIRPTLGKTYTPGKGEIEFKN 511
               N I    T     M  A      A++L  E   R P + P       P KG+I F+N
Sbjct: 1161 GLLNTILRAMTQTENDMNSAERLVSYATKLPLEADYRKPEMTPP---ESWPSKGKIVFEN 1217

Query: 512  VSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG 570
            V FAY  RP   I  K+ N  IK G  + I G +G GKSTI   L      T+GQI ID 
Sbjct: 1218 VDFAY--RPGLPIVLKNFNLDIKSGEKIGICGRTGAGKSTIMSALYRLNELTAGQIFIDD 1275

Query: 571  QDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIR-------TVAKQC 623
             DI++L    LR+++A++ Q+PVL  GTIR N+     +E T +E+         +AK  
Sbjct: 1276 VDISQLGLFDLRKKLAIIPQDPVLFRGTIRKNL--DPFDERTDDELWDALVRGGAIAKND 1333

Query: 624  F------------CHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILD 671
                          H  + KF    D  +   G+  S G++Q +A+ RAL+++  ILILD
Sbjct: 1334 LPEVRLQKPDENGTHGRMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILD 1391

Query: 672  EATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKF 731
            EATS++D E++G I     +  +    TI+ IAHRL TI   + I+VL   G V E    
Sbjct: 1392 EATSSVDYETDGKIQTRIVE--EFGDCTILCIAHRLKTIVNYDRILVL-EKGEVAEYDTP 1448

Query: 732  KELFA 736
              LF+
Sbjct: 1449 WALFS 1453

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/214 (31%), Positives = 106/214 (49%), Gaps = 22/214 (10%)

Query: 525 FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQ 584
           FK LNF I+ G  + I GP G GKS++   +        G+I ++G              
Sbjct: 604 FKDLNFDIQKGEFIMITGPIGTGKSSLLNAMAGSMRKVDGKIEVNGD------------- 650

Query: 585 IAVVQQEPVLMSGTIRDNITYGLTEEP-TKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPH 643
             ++   P + + T+RDNI +G    P  KE+   V   C     +   P    T IG  
Sbjct: 651 -LLMCGYPWIQNATVRDNIIFG---SPFNKEKYDEVIHVCSLKADLDILPAGDMTEIGER 706

Query: 644 GTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVS 702
           G  LSGGQK RI +AR++ KK +I + D+  SA+D    +  ++     ++ +K+  + +
Sbjct: 707 GITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLSNKTRILAT 766

Query: 703 IAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFA 736
             H+LS I R+  +IVLG DG  V++G  +EL A
Sbjct: 767 --HQLSLIERASRVIVLGTDGK-VDIGTVEELKA 797

>Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR281W
            (REAL)
          Length = 1478

 Score =  140 bits (353), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 148/546 (27%), Positives = 252/546 (46%), Gaps = 58/546 (10%)

Query: 224  FGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFDVH 283
            F + LY F   F  A FI     Y         + + +  L++V  K  LH    + D  
Sbjct: 934  FYMGLYSF---FVFAAFIFMNGQYTILCAMGIMASKWL-NLKAV--KRILHTPMSYIDTT 987

Query: 284  KVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPV- 342
             +G +++R   D+  +   +T+ +   + S     VG+ +M  + +   ++ + F++ + 
Sbjct: 988  PLGRILNRFTKDTDSLDNELTESLR-LMTSQFANIVGVCVMCIVYLPWFAIAIPFLLIIF 1046

Query: 343  VLSASIF---GKQI-RINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSI 398
            VL A  +   G++I R+ + +       L  V    L G+ T++++ +++R + + +  I
Sbjct: 1047 VLIADHYQSSGREIKRLEAVQRSFVYNNLNEV----LGGMDTIKAYRSQERFLAKSDFLI 1102

Query: 399  REIFDVGKRAAFINAK---FFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYT 455
             ++ + G     +      F    ++V  L    + V  ++ +   + ++G +  ++L  
Sbjct: 1103 NKMNEAGYLVVVLQRWVGIFLDMVAIVFALIITLLCVTRAFPI--SAASVGVMLTYVLQL 1160

Query: 456  EYTGNAIFGLSTFYSEIMQGA----GAASRL-FELTDRVPTIRPTLGKTYTPGKGEIEFK 510
                N +    T     M  A      A+ L  E   R P + P       P KGEI FK
Sbjct: 1161 PGLLNTLLRALTQTENDMNSAERLVSYATELPLEADYRKPEMAPP---ESWPSKGEIAFK 1217

Query: 511  NVSFAY-PTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILID 569
            NV F+Y P  P   + K+LN  IK G  + I G +G GKSTI   L      + G+ILID
Sbjct: 1218 NVDFSYRPGLPV--VLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELSGGEILID 1275

Query: 570  GQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIR-------TVAKQ 622
              +I+++    LRR++A++ Q+PVL  GTIR N+      E T++E+         +AK 
Sbjct: 1276 DVNISQIGLFDLRRKLAIIPQDPVLFRGTIRKNL--DPFNERTEDELWDALVRGGAIAKN 1333

Query: 623  CF------------CHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILIL 670
                           H  + KF    D  +   G+  S G++Q +A+ RAL+++  ILIL
Sbjct: 1334 DLPEVKLQKPEENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILIL 1391

Query: 671  DEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGK 730
            DEATS++D E++G I     +  +    TI+ IAHRL TI   + I+VL   G V E   
Sbjct: 1392 DEATSSVDYETDGKIQVRIVE--EFGDCTILCIAHRLKTIVNYDRILVL-EKGEVAEFDT 1448

Query: 731  FKELFA 736
               LF+
Sbjct: 1449 PWALFS 1454

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 67/214 (31%), Positives = 108/214 (50%), Gaps = 22/214 (10%)

Query: 525 FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQ 584
           FK L+F+IK G  + I GP G GKS++   +      T G+I ++G              
Sbjct: 604 FKDLDFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNGD------------- 650

Query: 585 IAVVQQEPVLMSGTIRDNITYGLTEEP-TKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPH 643
             ++   P + + T++DNI +G    P  KE+   V   C     +   P    T IG  
Sbjct: 651 -LLMCGYPWIQNATVKDNIIFG---SPFNKEKYDEVIHVCSLKADLDILPAGDMTEIGER 706

Query: 644 GTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVS 702
           G  LSGGQK RI +AR++ K+ +I + D+  SA+D    +  ++     L+++K+  + +
Sbjct: 707 GITLSGGQKARINLARSVYKRKDIYLFDDVLSAVDSRVGKHIMDECLTGLLENKTRVLAT 766

Query: 703 IAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFA 736
             H+LS I ++  +IVLG DG  V++G   EL A
Sbjct: 767 --HQLSLIEKASRVIVLGTDGD-VDIGTVDELKA 797

>ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1695

 Score =  140 bits (354), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 136/499 (27%), Positives = 235/499 (47%), Gaps = 57/499 (11%)

Query: 263  RLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIG 322
            ++ +++++  LH    FFD   +G +++R   D   V + +T        SL+     + 
Sbjct: 1177 KIFNLLLQKVLHAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFFEGAFYSLV---TCLS 1233

Query: 323  MMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQ--DATGQ--LTRVSEEQLNGV 378
             ++ ++      L+  VI  VL   I G      SREL+  D+  +  + +   E L GV
Sbjct: 1234 TVVLITFITPQFLIVAVIVAVLYYFI-GYFYLAGSRELKRLDSISRSPIYQHFSETLVGV 1292

Query: 379  RTVQSFVAEQREIKRFNHSIREIFDVGKRAAFI----NAKFFTSTSLVGDLSFLTVLVYG 434
             T+++F  E R I+   H I E      R  F     N        L+G L    V   G
Sbjct: 1293 TTIRAFGDESRFIQENLHKIDE----NNRPFFYLWVANRWLAMRIDLIGSL---VVFGAG 1345

Query: 435  SYLVLH-----GSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFE--LTD 487
             +++L+       +    LT  + +TE        L   YS +     +  RL E  + +
Sbjct: 1346 VFILLNIDHIDAGMAGISLTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMVVE 1401

Query: 488  RVPTIRPTLGK-TYTPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGSNVCIVGPSG 545
            + P  +P +   +  P  G +E  +VS  Y P  P  ++ K+++F ++P S V +VG +G
Sbjct: 1402 QEPYNQPIMTPPSDWPQHGRVEMSDVSLRYAPGLP--RVIKNVSFTVEPKSKVGVVGRTG 1459

Query: 546  KGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITY 605
             GKSTI   L  + +P +G I ID  DI+ ++ + LRR I ++ Q+P L +GTI+ N+  
Sbjct: 1460 AGKSTIITALFRFLDPETGHIKIDNVDISLIDLQMLRRSITIIPQDPTLFTGTIKSNL-- 1517

Query: 606  GLTEEPTKEEIRTVAKQC-----------------FCHNFIVKFPYTYDTYIGPHGTLLS 648
               +E + E+I    K+                       + KF    ++ I   G  LS
Sbjct: 1518 DPYDEYSDEDIFAALKRVNLVSQEELDRSNIDAASVGSENVNKF-LDLNSEINEGGGNLS 1576

Query: 649  GGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLS 708
             GQ+Q + +AR+L++ P I++LDEAT+++D +S+  I  T  +  +    TI++IAHRL 
Sbjct: 1577 QGQRQLVCLARSLLRSPKIILLDEATASIDYQSDAKIQETIRKEFQGN--TILTIAHRLR 1634

Query: 709  TIRRSENIIVLGNDGSVVE 727
            ++   + I+V+ + G V E
Sbjct: 1635 SVIDYDKILVM-DQGEVKE 1652

 Score =  105 bits (261), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 115/473 (24%), Positives = 201/473 (42%), Gaps = 58/473 (12%)

Query: 285 VGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMM---LELSMDLSSVLVCFVIP 341
           +G +I+ +  D++ VS  I   +   V+++    V I ++   L LS  + ++L+  ++P
Sbjct: 527 LGAIINLMAVDAFKVSE-ICAYLHAFVEAVAMSCVAIVLLYKLLGLSAIIGALLIVVLMP 585

Query: 342 VVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREI 401
           V      +  Q++  S    D   Q      E    +R ++ F  E      F   I+ I
Sbjct: 586 VNFRLVTWLGQLQKKSLSYTDKRIQNL---NEAFQAIRIIKFFSWEDN----FEKGIQAI 638

Query: 402 FDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLY------- 454
            DV         K     SL+  L            V + + TI   +AF  Y       
Sbjct: 639 RDV-------ELKLLLQRSLIWALC---------SFVWYATPTIVTTSAFAFYIYVQKQT 682

Query: 455 ----TEYTGNAIFGL--------STFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTP 502
                 +T  ++F L        S   S ++Q   +  R+ E  +  P        +  P
Sbjct: 683 LTTPVAFTALSLFSLLRTPLDQLSDMLSFVIQSKVSLDRIQEFLEE-PDTDKYNQLSVAP 741

Query: 503 GKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPT 562
           G  ++ F+N + ++ +   +   ++LN   K G    ++GP+G GK++I + LL      
Sbjct: 742 GGQKLGFENATISWDSEKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSILMALLGEMKLL 801

Query: 563 SGQILI---DGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKE-EIRT 618
           +G I++   D + +  +++  +   IA   Q   L++ T+R+NI +     P  E     
Sbjct: 802 NGNIVVPSLDPRALLPIDADGMTNSIAYCSQAAWLLNDTVRNNILFN---SPYSEARYND 858

Query: 619 VAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALD 678
           V + C              T IG  G  LSGGQKQRI++AR+L      L+LD+  SA+D
Sbjct: 859 VIEACGLKRDFEILSAGDMTEIGERGITLSGGQKQRISLARSLYSNSRHLLLDDCLSAVD 918

Query: 679 VESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMG 729
             +   I  N   G LM+ +  T + I+H ++   R+  ++VL  +G V E G
Sbjct: 919 SHTASWIYDNCITGPLMQGR--TCILISHNIALTLRNAELVVLLENGQVKEQG 969

>NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_4.6
          Length = 1657

 Score =  140 bits (353), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 139/500 (27%), Positives = 230/500 (46%), Gaps = 70/500 (14%)

Query: 268  VMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLEL 327
            ++  TLH    FFD   +G +++R   D   V + +T  +     +  C    I  M   
Sbjct: 1145 LLYRTLHAKLGFFDATPIGRIMNRFSKDIESVDQELTPYLE---AAFFCLVQCIATM--- 1198

Query: 328  SMDLSSVLVCFVIPVVLSASIF--------GKQIRINSRELQD----ATGQLTRVSEEQL 375
                   L+ F+ P  LS +I         G      SREL+     +   + +   E L
Sbjct: 1199 ------ALITFITPQFLSVAILVGCLYYLVGYFYMAASRELKRFESISKSPIYQHFSETL 1252

Query: 376  NGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGS 435
             GV T++++  E R +    H I E           N  FF        LSF   ++ G+
Sbjct: 1253 VGVATIRAYGDESRFMLENLHKIDEN----------NKPFFYLWVFNRWLSFRIDMI-GA 1301

Query: 436  YLVLHGSLTI---------GDLTAFMLYT-EYTGNAIFGLSTFYSEIMQGAGAASRLFEL 485
            +++    + I         G     + Y   +T  A++ L  FY+++     +  RL E 
Sbjct: 1302 FVIFGAGVFILTNIKNIDSGMAGISLTYAISFTEGALW-LVRFYADVEMNMNSVERLKEY 1360

Query: 486  TD--RVP--TIRPTLGKTYTPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGSNVCI 540
             +  + P    + TL     P  G+IE K++S  Y P  P  ++ K+++F ++P + + I
Sbjct: 1361 MEIEQEPYDEYKDTLLHDEWPSNGKIEVKDLSLRYAPNLP--KVIKNVSFVVEPKTKIGI 1418

Query: 541  VGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIR 600
            VG +G GKSTI   +  + NP SG I ID  +I  +N   LRR I ++ Q+P L +GTI+
Sbjct: 1419 VGRTGAGKSTIITAMFRFLNPESGYIKIDDVNIASINLTKLRRSITIIPQDPTLFTGTIK 1478

Query: 601  DNIT-YG-LTEEP-----------TKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLL 647
             N+  Y   T++            T+EE++    Q        KF    +  I   G+ L
Sbjct: 1479 LNLDPYNEFTDDAIFEALKRVNLVTEEELQNNGTQTGTSENANKF-LNLENEITEGGSNL 1537

Query: 648  SGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRL 707
            S GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  +    TI++IAHRL
Sbjct: 1538 SHGQRQLVCLARSLLRNPKIILLDEATASIDYASDAKIQETIRK--EFSQSTILTIAHRL 1595

Query: 708  STIRRSENIIVLGNDGSVVE 727
             ++   + IIV+ + G V E
Sbjct: 1596 RSVIDYDKIIVM-DAGEVKE 1614

 Score =  105 bits (261), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 121/468 (25%), Positives = 214/468 (45%), Gaps = 48/468 (10%)

Query: 285 VGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLEL---SMDLSSVLVCFVIP 341
           +G +I+ +  D++ VS  I   +   V+++I   V I ++ +L   +  + + L+   +P
Sbjct: 492 LGAIINLMAVDAFKVSE-ICGYLHFFVEAVIMVFVAITLLYKLLGYAAFVGAALIIACLP 550

Query: 342 VVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQ---REIKRFNHSI 398
           + L  + F  +++  S    D   Q      E L  +R ++ F  E    R+IK      
Sbjct: 551 LNLKLATFLGKLQKESLGFTDKRIQKLN---ETLQAIRIIKFFSWEDNFSRDIKEVRE-- 605

Query: 399 REIFDVGKRA---AFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSL--TIGDLTAFML 453
           +E+  + KR+   AF +  +F + S+V   SF        Y+ + G +  T    TA  L
Sbjct: 606 KELHLLLKRSLIWAFSSFVWFVTPSIVTSASF------AFYIYVQGEVLTTPVAFTALSL 659

Query: 454 YTEYTGNAIFGLSTFYSEIMQGAGAASRLFEL-----TDRVPTIRPTLGKTYTPGKGEIE 508
           +T      +  LS   S ++Q   +  R+ +      TD+   +  T+ K        I 
Sbjct: 660 FT-LLKTPLDQLSNMISFVIQSKVSLDRIQDFLGEQDTDKYNQL--TIDKL----GNRIA 712

Query: 509 FKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI 568
           FKNV+  +     +   + LN + KPG+   ++GP+G GK+++ L LL       G+I++
Sbjct: 713 FKNVTVTWDNGEEDFKLRDLNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKGEIIV 772

Query: 569 DG----QDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEE-IRTVAKQC 623
                 QD+  ++   L   IA   Q   L++ T+R+NI +     P  EE    V   C
Sbjct: 773 PALNPRQDLV-IDKFGLTNSIAYCSQAAWLLNETVRNNILFN---SPYNEERYNAVIDAC 828

Query: 624 FCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEG 683
                +     +  T IG  G  LSGGQKQR+++ARAL      ++LD+  SA+D  +  
Sbjct: 829 GLRRDLKILKASDMTEIGEKGITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVDSHTAL 888

Query: 684 AI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMG 729
            I  N   G LM  ++  +VS  H ++   ++  ++V+  +G V + G
Sbjct: 889 WIYDNCITGPLMSGRTCILVS--HNIALTLKNAELVVILENGRVKDQG 934

>KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_5.10
            YGR281W
          Length = 1457

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 136/499 (27%), Positives = 238/499 (47%), Gaps = 50/499 (10%)

Query: 271  HTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMD 330
              LH    + D   +G +++R   D+     S+  ++++ V+ ++     +G ++ + + 
Sbjct: 954  RVLHAPMSYLDTTPLGRILNRFTKDT----DSLDNELTESVRLML---FQVGNIVAVIVM 1006

Query: 331  LSSVLVCFVIPVVLSASIF---GKQIRINSRELQ--DATGQ--LTRVSEEQLNGVRTVQS 383
                L  F I V     +F       +  SRE++  DA  +  +     E L G+ T++S
Sbjct: 1007 CIVYLPWFAIAVPFLFFMFVLIADHYQSTSREIKRLDAIQRSFVYNNLNEVLGGMDTIKS 1066

Query: 384  FVAEQREIKRFNHSIREIFDVGKRAAFIN---AKFFTSTSLVGDLSFLTVLVYGSYLVLH 440
            +  ++R   + ++ I ++ + G     +    + F    +++  L    + V G + +  
Sbjct: 1067 YKGQKRFQAKSDYLINKMNEAGYLLVSVQRWVSIFLDMVAIIFALIIALLSVTGVFSLSA 1126

Query: 441  GSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPT----IRPTL 496
             S  +G L  ++L      N++    T   +      +A RL     ++P      +P L
Sbjct: 1127 SS--VGVLLTYVLQLPGLLNSVLRALT---QTENDMNSAERLVNYATKLPLEAAYKKPEL 1181

Query: 497  GKTYT-PGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLL 555
                + P KGEI F +V FAY +     + K LN  IK G  + I G +G GKSTI   L
Sbjct: 1182 SPPESWPSKGEIRFLDVDFAYRSGLP-VVLKGLNLDIKSGEKIGICGRTGAGKSTIMSAL 1240

Query: 556  LHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDN------------- 602
                  TSG+ILID  DI+ L    LRR+++++ Q+PVL  GTIR N             
Sbjct: 1241 YRLNELTSGKILIDDVDISTLGLYDLRRKLSIIPQDPVLFKGTIRKNLDPFSNYDDSLLW 1300

Query: 603  ---ITYGLTEEPTKEEIRT-VAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIA 658
               I  G  E+ + E++++ +  +   H  + KF    D  +   G+  S G++Q +A+ 
Sbjct: 1301 DALIRSGAIEKESVEKVKSEMVNEEGTHTDMHKF--HLDQLVEEEGSNFSLGERQVLALT 1358

Query: 659  RALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIV 718
            RAL+++  ILILDEATS++D E++G I     +  +  + TI+ IAHRL TI + + I+V
Sbjct: 1359 RALVRQSKILILDEATSSVDYETDGKIQKRIVE--EFDNCTILCIAHRLKTILQYDRILV 1416

Query: 719  LGNDGSVVEMGKFKELFAD 737
            L   G + E  +  +LF+D
Sbjct: 1417 L-EKGVIAEFDQPFKLFSD 1434

 Score = 94.7 bits (234), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 107/212 (50%), Gaps = 22/212 (10%)

Query: 525 FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQ 584
           F +L+F+I+ G  + I GP G GKS++      + N T G+I ++G              
Sbjct: 588 FSNLDFEIRKGEFIMITGPIGTGKSSLLNAFAGFMNKTEGRIQVNGD------------- 634

Query: 585 IAVVQQEPVLMSGTIRDNITYGLTEEP-TKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPH 643
             +    P + + T++DNI +G    P  KE+   V + C     +   P    T IG  
Sbjct: 635 -LLFCGYPWIQNATVKDNILFG---SPFIKEKYENVLRVCSLDADLKVLPAGDKTEIGER 690

Query: 644 GTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVS 702
           G  LSGGQK RI +ARA+ K  +I + D+  SA+D    +  ++     L++ K+  + +
Sbjct: 691 GINLSGGQKARINLARAVYKTKDIFLFDDVLSAVDSRVGKHIMDECLLDLLEGKTRILAT 750

Query: 703 IAHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
             H+LS I +++ +IVLG DGS  ++G   EL
Sbjct: 751 --HQLSLIEKADRVIVLGTDGS-FDIGTVDEL 779

>TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4.6
            YHL035C
          Length = 1691

 Score =  140 bits (352), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 139/521 (26%), Positives = 234/521 (44%), Gaps = 98/521 (18%)

Query: 263  RLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLI-CGGVGI 321
            ++ + ++K++LH    FFD   +G +++R   D   V + +   +      L+ C  +  
Sbjct: 1169 KMFNSLLKNSLHAKLRFFDSTPLGRIMNRFSKDIEAVDQEVPMYLGGTFACLVECFSI-- 1226

Query: 322  GMMLELSMDLSSVLVCFVIPVVLSASIF--------GKQIRINSRELQ--DATGQ--LTR 369
                        VL+  + P  L  +IF        G      SREL+  D+  +  + +
Sbjct: 1227 -----------IVLITLITPQFLGVAIFIAVFYWFVGAVYISGSRELKRFDSITKSPIYQ 1275

Query: 370  VSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLT 429
               E L G+ TV+++  E R ++     I E           N  FF        LSF T
Sbjct: 1276 HFSETLAGITTVRAYGDESRFMRENLEKIDEN----------NKPFFYMWVSNRWLSFRT 1325

Query: 430  VLVYGSYLVL-HGSLTIGDLTAF--------MLYTEYTGNAIFGLSTFYSEIMQGAGAAS 480
             ++ G++++L  G  +I ++           + Y     +A   L  FY +      +  
Sbjct: 1326 QII-GAFVILGAGGFSIWNINKIDSGLAGISLTYALTFSDAALWLVRFYGDTEMNMNSTE 1384

Query: 481  RLFELT--DRVP----TIRPTLGKTYTPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIK 533
            R+ E    D+ P    T+ P       P  G+IE  +VS  Y P  P  ++ K+++F + 
Sbjct: 1385 RIQEYMNIDQEPYNEGTVEPPAD---WPENGKIEINDVSLRYAPNLP--RVIKNVSFTVD 1439

Query: 534  PGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPV 593
              S V IVG +G GKSTI   L  +  P +G I ID  DI  ++ + LRR I+++ Q+P 
Sbjct: 1440 SKSKVGIVGRTGAGKSTIITALFRFLEPETGNIKIDNIDIVSIDLQKLRRSISIIPQDPT 1499

Query: 594  LMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFI-------VKFPYTYDTY------- 639
            L +GTIR N+     +  T+   + +     C N +       V+ P + DT        
Sbjct: 1500 LFTGTIRSNL-----DPYTQYSDKEIFDSLICVNLVSREELAQVQSPSSNDTSSIVSENF 1554

Query: 640  ---------IGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYT-- 688
                     +   G+ +S GQ+Q + +AR+L+ KP I++LDEAT+++D ES+  I  T  
Sbjct: 1555 NHFLDLEYNVSEGGSNISQGQRQLLCLARSLLGKPKIILLDEATASIDYESDKKIQETIR 1614

Query: 689  --FGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVE 727
              FG      + TI++IAHRL ++   + I+V+  D   VE
Sbjct: 1615 NEFG------NSTILTIAHRLRSVIDYDKILVM--DAGEVE 1647

 Score = 94.0 bits (232), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 109/464 (23%), Positives = 211/464 (45%), Gaps = 40/464 (8%)

Query: 285 VGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLEL---SMDLSSVLVCFVIP 341
           VG +I+ +  D++ V+  I   +   + ++I   V I ++  L   +  + ++ +  +IP
Sbjct: 539 VGAIINLIAVDAFKVAE-IGAYLHTFIGTIIMTFVSIYLLFNLLGSAAFIGALTIIVLIP 597

Query: 342 VVLS-ASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIRE 400
           V    A+  G    +  + L+    ++ +++E     +R ++ F + ++  +   H IRE
Sbjct: 598 VNYKIANWLGN---LQQKNLKTTDKRIQKLNE-TFQAIRIIK-FFSWEKNFENDIHKIRE 652

Query: 401 --IFDVGKRA---AFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYT 455
             ++ +  R    +F    FF S ++V  LSF        Y+ +       +LT+ + +T
Sbjct: 653 EELYILLLRCLVWSFSTFIFFISPTIVTSLSF------AYYIFIQKQ----ELTSPVAFT 702

Query: 456 EYTGNAIFG-----LSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFK 510
             +  A+       ++   S ++Q   +  R+    D  P  +     T    K ++ FK
Sbjct: 703 ALSLFALLKIPLDQMANMLSYVVQSKVSLDRVQTFLDE-PDTKKYEQLTVPVEKNKLSFK 761

Query: 511 NVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG 570
           N + ++     +   ++L+   K G    ++GP+G GK+++ + LL     T GQI I  
Sbjct: 762 NATMSWGNDNDSFKLRNLDIDFKIGQLNVVIGPTGSGKTSLLMALLGEMTLTEGQINIPS 821

Query: 571 QDITK---LNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHN 627
            D      + S      IA   Q   L++ T+R+NI +       + +   VA      +
Sbjct: 822 LDPRHDLIIESDGHTNSIAYCSQAAWLLNDTVRNNILFNSPYNKDRYDAAIVAAG-LKRD 880

Query: 628 FIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI-- 685
           F +       T IG  G  LSGGQKQRI++ARAL      ++LD+  SA+D  +   I  
Sbjct: 881 FEI-LAAGDLTEIGERGITLSGGQKQRISLARALYSNARHVLLDDCLSAVDAHTAAWIYD 939

Query: 686 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMG 729
           N   G LM+ ++  +VS  H ++   ++ +++V+  +G V + G
Sbjct: 940 NCISGPLMEGRTCVLVS--HNIALTLKNASLVVMLKNGRVADQG 981

>SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} similar
            to uniprot|P39109 Saccharomyces cerevisiae YDR135C
          Length = 1499

 Score =  139 bits (351), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 139/497 (27%), Positives = 229/497 (46%), Gaps = 45/497 (9%)

Query: 264  LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSY----IVSRSITQKISDGVKSLICGGV 319
            L   +    L     FF+   +G +++R   D Y    ++ R+ +Q   + VK      V
Sbjct: 1010 LHDAMASSVLRAPMSFFETTPIGRILNRFSNDIYKVDELLGRTFSQFFVNVVK------V 1063

Query: 320  GIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVS-----EEQ 374
               +++  +     +LV  V+P+ +    + +     SREL+     +TR       +E 
Sbjct: 1064 TFTIVVICTSTWQFILV--VLPLSVLYIYYQQYYLRTSRELRR-LDSVTRSPIYAHFQET 1120

Query: 375  LNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAF--INAKFFTSTSL--VGDLSFLTV 430
            L GV T++ +  +    KRF H  +   D    A +  +NA  + +  L  +G +  L  
Sbjct: 1121 LGGVSTIRGYGQQ----KRFAHINQARIDNNMSAFYPAVNANRWLAFRLEFLGSIIILGA 1176

Query: 431  LVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRL---FELTD 487
                 + +  G+LT G +   + Y      ++  +     E+     +  R+    EL  
Sbjct: 1177 ATLSVFRLKQGTLTAGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELKP 1236

Query: 488  RVPTI----RPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQ-IFKSLNFKIKPGSNVCIVG 542
              P I    RP  G    P +G+I F++ S  Y  RP  Q I + +N  IK    V IVG
Sbjct: 1237 EAPAIIESSRPPKG---WPSQGDIRFEHYSTRY--RPELQLILRDVNLHIKAREKVGIVG 1291

Query: 543  PSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDN 602
             +G GKS++ L L        G I IDG     +    LR +++++ Q+  + +GT+R+N
Sbjct: 1292 RTGAGKSSLTLALFRIIEAAEGHIFIDGLSTDTIGLADLRHKLSIIPQDSQVFAGTLREN 1351

Query: 603  ITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYT-YDTYIGPHGTLLSGGQKQRIAIARAL 661
            +    TEE T EEI    +       ++        T +   G+ LS GQ+Q + +ARAL
Sbjct: 1352 V--DPTEEFTDEEIWHALELSHLKEHVMSMGNDGLQTMLTECGSNLSVGQRQLLCLARAL 1409

Query: 662  IKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGN 721
            +    IL+LDEAT+A+DVE++  I  T     K++  TI++IAHR++TI  S+ IIVL N
Sbjct: 1410 LIPSKILVLDEATAAVDVETDRVIQETIRTAFKNR--TILTIAHRINTIMDSDKIIVL-N 1466

Query: 722  DGSVVEMGKFKELFADP 738
            +G V E    + L   P
Sbjct: 1467 EGQVAEFDTPENLLQRP 1483

 Score = 97.8 bits (242), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 115/493 (23%), Positives = 222/493 (45%), Gaps = 48/493 (9%)

Query: 264 LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSR-----SITQKISDGVKSLICGG 318
           L SV+ K +L   +E   +   GD+++ +  D   V R        Q I  G   +I   
Sbjct: 372 LTSVIYKKSLVLSNEASGLSSTGDIVNLMSVD---VQRLQDLTQWGQIIWSGPFQIILCL 428

Query: 319 VGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGV 378
           + +  +L   M +  +++  +IP+  ++ I   Q  +   ++++   + TRV  E LN +
Sbjct: 429 ISLYSLLGPCMWVGVIIMVVMIPI--NSIIMKYQKNLQKIQMKNK-DERTRVISEILNNI 485

Query: 379 RTVQSFVAEQREIKRFNH-----SIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVY 433
           ++++ +  E    K+ ++      ++ +  +G   A  + +F     LV   +F   ++ 
Sbjct: 486 KSLKLYAWEVPYKKKLDYVRNEKELKNLTKMGCTLALASFQFNIVPFLVSCSTFAVFVMT 545

Query: 434 GSYLVLHGSLTIGDLTAFMLYT---EYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVP 490
                L   L    LT F L +       NAI       +  ++ + + +RL        
Sbjct: 546 QKGRALTTDLVFPALTLFNLLSFPLAVVPNAI-------TSFIEASVSVNRLHSFLTNEE 598

Query: 491 TIRPTLGKT-YTPGKGEIEFK---NVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGPSG 545
             + ++ +      KG+I  K   + +F +  +P  ++  K++NF+ K G   CIVG  G
Sbjct: 599 LQKDSVSREPSVTSKGDIAVKVGGDATFLWQRKPEYKVALKNINFQAKKGELTCIVGRVG 658

Query: 546 KGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITY 605
            GKS +   +L       G   I G              +A V Q P +M+GT+++NI +
Sbjct: 659 SGKSALIQSILGDLFRVKGFATIHGS-------------VAYVSQIPWIMNGTVKENILF 705

Query: 606 GLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKP 665
           G   +P+  E +TV K C  +  +   P    T +G  G  LSGGQK R+++ARA+  + 
Sbjct: 706 GHKYDPSFYE-KTV-KACALNVDLSILPQGDQTLVGEKGISLSGGQKARLSLARAVYSRA 763

Query: 666 NILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGS 724
           +  +LD+  +A+D   ++  ++   G      S T V   ++++ +  +++I +L N G 
Sbjct: 764 DTYLLDDPLAAVDEHVAKHLVDNVLGVTGLLHSKTKVLATNKITVLSIADSIALLEN-GE 822

Query: 725 VVEMGKFKELFAD 737
           +V+ G + E+  D
Sbjct: 823 IVQQGSYDEVVRD 835

>Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  139 bits (351), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 138/504 (27%), Positives = 233/504 (46%), Gaps = 61/504 (12%)

Query: 264  LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSY----IVSRSITQKISDGVK-----SL 314
            L +++    L     FF+   +G +++R   D Y    ++ R+ +Q   + VK     ++
Sbjct: 1026 LHNLMTNSVLRAPMTFFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVTFTITV 1085

Query: 315  ICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVS--- 371
            IC               +   +  +IP+ +    + +     SREL+     +TR     
Sbjct: 1086 ICAT-------------TWQFIFIIIPLGVFYIYYQQYYLRTSRELR-RLDSITRSPIYS 1131

Query: 372  --EEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAF--INAKFFTS--TSLVGDL 425
              +E L G+ TV+ +  +    KRF+H  +   D    A +  INA  + +    L+G +
Sbjct: 1132 HFQETLGGLATVRGYSQQ----KRFSHINQCRIDNNMSAFYPSINANRWLAYRLELIGSI 1187

Query: 426  SFLTVLVYGSYLVLHGSLT---IGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRL 482
              L       + +  G+LT   +G   ++ L    T N I  ++    E+     +  R+
Sbjct: 1188 IILGAATLSVFRLKQGTLTSGMVGLSLSYALQITQTLNWIVRMTV---EVETNIVSVERI 1244

Query: 483  FELTD---RVPTI----RPTLGKTYTPGKGEIEFKNVSFAYPTRPS-NQIFKSLNFKIKP 534
             E  D     P I    RP   K + P +G+I F N S  Y  RP  + + K +N  IKP
Sbjct: 1245 KEYADLKSEAPLIIEGHRPP--KQW-PAQGDIRFNNYSTRY--RPELDLVLKQINIHIKP 1299

Query: 535  GSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVL 594
               V IVG +G GKS++ L L      + G I+IDG  I ++    LR +++++ Q+  +
Sbjct: 1300 NEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDGVSINEIGLYDLRHKLSIIPQDSQV 1359

Query: 595  MSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYT-YDTYIGPHGTLLSGGQKQ 653
              GT+R+NI      + + E I    +       ++       D  +   G+ LS GQ+Q
Sbjct: 1360 FEGTVRENI--DPINQYSDEAIWRALELSHLKEHVLSMSNDGLDAQLSEGGSNLSVGQRQ 1417

Query: 654  RIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRS 713
             + +ARA++    IL+LDEAT+A+DVE++  +  T     K +  TI++IAHRL+TI  S
Sbjct: 1418 LLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDR--TILTIAHRLNTIMDS 1475

Query: 714  ENIIVLGNDGSVVEMGKFKELFAD 737
            + IIVL N G V E     +L ++
Sbjct: 1476 DRIIVLDN-GKVAEFDTPGQLLSN 1498

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 107/502 (21%), Positives = 219/502 (43%), Gaps = 67/502 (13%)

Query: 264 LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQK---ISDGVKSLICGGVG 320
           L +++ + +L   +E   +   GD+++ +  D   + + +TQ    I  G   +I     
Sbjct: 382 LTALIYQKSLVLSNEASGLSSTGDIVNLMSVDVQKL-QDLTQWLNLIWSGPFQIIICLYS 440

Query: 321 IGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRT 380
           +  +L  SM +  +++  ++P  L++ +   Q ++   +++    + TRV  E LN +++
Sbjct: 441 LYKLLGNSMWVGVIILVIMMP--LNSFLMRIQKKLQKSQMK-YKDERTRVISEILNNIKS 497

Query: 381 VQSFVAEQ-----REIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGS 435
           ++ +  E+      E  R N  ++ +  +G   A  + +F     LV   +F  V VY  
Sbjct: 498 LKLYAWEKPYREKLEEVRNNKELKNLTKLGCYMAVTSFQFNIVPFLVSCCTF-AVFVYTE 556

Query: 436 YLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFEL---------- 485
              L   L    LT F L +      +  +    +  ++ + +  RLF            
Sbjct: 557 DRALTTDLVFPALTLFNLLS----FPLMIIPMVLNSFIEASVSIGRLFSFFTNEELQPDS 612

Query: 486 TDRVPTIRPTLGKTYTPGKGEIEFK---NVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIV 541
             R+P +            G+I      + +F +  +P  ++  K+++F+   G+  CIV
Sbjct: 613 VQRLPNVENI---------GDIAINIGDDATFLWQRKPEYKVALKNIDFQATKGNLTCIV 663

Query: 542 GPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRD 601
           G  G GK+ +   +L       G   + G              IA V Q P +M+GT+++
Sbjct: 664 GKVGSGKTALLSCMLGDLFRVKGFATVHGC-------------IAYVSQVPWIMNGTVKE 710

Query: 602 NITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYD---TYIGPHGTLLSGGQKQRIAIA 658
           NI +G   +   E      K C      +      D   T +G  G  LSGGQK R+++A
Sbjct: 711 NILFG--HKYDAEFYEKTIKAC---ALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLA 765

Query: 659 RALIKKPNILILDEATSALDVE-SEGAINYTFGQ--LMKSKSMTIVSIAHRLSTIRRSEN 715
           RA+  + +  +LD+  +A+D   +   I +  G   L+ +K+  + +  +++S +  +++
Sbjct: 766 RAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTRILAT--NKVSALSIADS 823

Query: 716 IIVLGNDGSVVEMGKFKELFAD 737
           I +L N G +++ G + ++  D
Sbjct: 824 IALLDN-GEIIQQGAYSDITKD 844

>Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON}
            YHL035C (REAL)
          Length = 1585

 Score =  139 bits (350), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 145/508 (28%), Positives = 242/508 (47%), Gaps = 70/508 (13%)

Query: 272  TLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLI-CGGVGIGMMLELSMD 330
             LH    FFDV  VG +++R   D   + + +   +   V  LI C  + + +++     
Sbjct: 1082 VLHAKIRFFDVTPVGRIMNRFSKDIEGIDQELIPYLEVTVFCLIQCSSILLLIVVITPRF 1141

Query: 331  LSSVLVCFVIPVVLSASIFGKQIRINSRELQ--DATGQ--LTRVSEEQLNGVRTVQSFVA 386
             S  ++ F++   +     GK     SR+L+  D+  +  + +   E L GV T+++F  
Sbjct: 1142 FSVAVIVFILYYFV-----GKWYLKASRDLKRIDSITKSPIFQHFSETLVGVCTIRAFGD 1196

Query: 387  EQREIKRFNHSIREIFDVGKRAAF---INAKFFT-STSLVGDLSFLTVLVYGSYLVLH-- 440
            E    KRF     E  D   +A F   +  K+F     ++G  +F+ VL  GS+++ +  
Sbjct: 1197 E----KRFILENMEKIDQNNKAFFYLSVAVKWFAFRVDMIG--AFI-VLGSGSFILFNID 1249

Query: 441  ---GSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIR---- 493
                 L    LT  +L+T+    +   L   YS       +  RL E +  V        
Sbjct: 1250 NIDSGLAGISLTYAILFTD----SALWLVQLYSRFEMNMNSVERLKEYSSIVQEKYLGYD 1305

Query: 494  ----PTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKS 549
                  L  +  P  G+IE +N+S  Y +     + K++ FK+ P S V IVG +G GKS
Sbjct: 1306 EDHIQALNDSSWPKHGKIEVENLSLRYASNLP-LVLKNVCFKVDPQSKVGIVGRTGAGKS 1364

Query: 550  TIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTE 609
            TI   L     P +G I ID QDI+K++  +LRR I ++ Q+PVL +GTI+ NI      
Sbjct: 1365 TIIAALFRLLEPVTGCIKIDDQDISKIDLITLRRSITIIPQDPVLFAGTIKSNI------ 1418

Query: 610  EPTKE-EIRTVAKQCFCHNFI--VKFPYTYD---------------TYIGPHGTLLSGGQ 651
            +P  E + R + K     N I  ++F   ++               + I   G  LS G+
Sbjct: 1419 DPHDEYDERRIFKVLLQVNLISSLEFKQVFNLKENFNIHNKFLNLQSEIVEGGLNLSQGE 1478

Query: 652  KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSK--SMTIVSIAHRLST 709
            +Q + IAR+L+++  I++LDEATS++D +S+  I      +++SK    TI++IAHRL +
Sbjct: 1479 RQLLFIARSLLRESKIILLDEATSSIDYDSDHLIQ----SIIRSKFNKSTILTIAHRLRS 1534

Query: 710  IRRSENIIVLGNDGSVVEMGKFKELFAD 737
            +   + I+V+ + G + E G   EL  +
Sbjct: 1535 VIYYDKILVM-DAGEIKEYGHPYELLKN 1561

 Score = 91.7 bits (226), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 116/246 (47%), Gaps = 16/246 (6%)

Query: 499 TYTPGKGEIEFKNVSFAYPTRPSNQIFK----SLNFKIKPGSNVCIVGPSGKGKSTIALL 554
           T +P + +IEFK  +  +     N I K     LN     G    ++G +G GKS + + 
Sbjct: 656 TISPDRNKIEFKKANLVW-NENDNDINKFKLCDLNIIFSIGKLNLVLGSTGSGKSALLMS 714

Query: 555 LLHYYNPTSGQILIDG----QDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEE 610
           LL   +  SG I+I G     D+   +   L    A   Q   L+S TI++NI +  + +
Sbjct: 715 LLGELDLVSGFIIIPGLEPRHDLIP-DHDGLTNSFAYCSQSAWLVSDTIKNNIVFNGSYD 773

Query: 611 PTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILIL 670
             K   + V   C  +  +   P    T IG  G  LSGGQKQRI++ARA+      ++L
Sbjct: 774 --KSRYKKVIDACGLNRDLNILPAGDLTEIGEKGITLSGGQKQRISLARAVYSHAKHVLL 831

Query: 671 DEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEM 728
           D+  SA+D  +   I  N   GQLMK++  T + + H +    R+ +  ++  DG V   
Sbjct: 832 DDCLSAVDSHTAVWIYENCITGQLMKNR--TCILVTHNVPLAIRNAHFAIILEDGKVKNQ 889

Query: 729 GKFKEL 734
           G  KEL
Sbjct: 890 GTIKEL 895

>SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar to
            uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1439

 Score =  139 bits (349), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 148/557 (26%), Positives = 246/557 (44%), Gaps = 86/557 (15%)

Query: 222  IMFGLTLYEFLG-GFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFF 280
            I F    Y F+   F++  +IG AA+                 L    +K  LH    F 
Sbjct: 900  IFFVFVNYFFMSLQFTILCYIGLAAS---------------KWLNLKAVKRLLHTPMSFM 944

Query: 281  DVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVI 340
            D   +G +++R   D+  +   +T+ +   V        G+ +M  + +   ++ V F+ 
Sbjct: 945  DTTPLGRVLNRFTKDTDTLDNELTESVRLFVYQ-TANIAGVIIMCIIYLPWFAIAVPFLG 1003

Query: 341  PVVLSASIFGKQIRINSRELQDATG-QLTRVSE---EQLNGVRTVQSFVAEQREIKRFNH 396
             + +   I     + + RE++     Q + V     E L+G+ T++++ +E R + + + 
Sbjct: 1004 LIFI---IVADHYQSSGREIKRLEAVQRSFVYNNFNEVLSGMDTIKAYKSENRFLMKSDF 1060

Query: 397  SIREIFDVGKRAAFINAKFFTSTSLVG----------------DLSFLTVLVYGSYLVLH 440
             I  + + G     +      S  ++                 D+S  +V V  +Y++  
Sbjct: 1061 LINRMSEAGYLVVAVQRWVSISLDMIAVAFALIITLLCVTRQFDISAASVGVLLTYVLQL 1120

Query: 441  GSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTY 500
              L  G L A M   E   N++  +  + +E+ Q A  A R  E+T + P          
Sbjct: 1121 PGLLNGLLRA-MTQAENDMNSVERIVNYATELPQEA--AYRKPEMTPQEPW--------- 1168

Query: 501  TPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYY 559
             P  GE+ F NVS +Y P  P   + K ++  IK G  + I G +G GKSTI   L    
Sbjct: 1169 -PSNGEVVFDNVSLSYRPGLP--LVLKGVSLNIKGGEKIGICGRTGAGKSTIMSALYRLC 1225

Query: 560  NPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNIT-YGLTEEP------- 611
                G++LIDG D +KL    LRR+++++ Q+PVL  G+IR N+  +G  E+        
Sbjct: 1226 ELNEGRVLIDGVDTSKLGLYDLRRKLSIIPQDPVLFKGSIRKNLDPFGEREDEELWSALV 1285

Query: 612  -----TKEEIRTVAKQ--------CFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIA 658
                   EE+  V  Q           H F +      D  +   GT  S G++Q +A+ 
Sbjct: 1286 RSGTIEAEEVEKVKNQHRDESGSSTGLHKFHL------DQEVEDDGTNFSLGERQLLALT 1339

Query: 659  RALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIV 718
            RAL+++  ILILDEATS++D E++  I     Q  +    TI+ IAHRL TI   + ++V
Sbjct: 1340 RALVRQSKILILDEATSSVDHETDAKIQSLIAQ--EFNRCTILCIAHRLKTILNYDRLVV 1397

Query: 719  LGNDGSVVEMGKFKELF 735
            L N G+V E    + LF
Sbjct: 1398 LDN-GTVKEFDTPRSLF 1413

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/223 (29%), Positives = 108/223 (48%), Gaps = 20/223 (8%)

Query: 513 SFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQD 572
           +FA   + S   FK+LNF+I+ G  V I G  G GKS++   L  +   T G I  +G  
Sbjct: 559 AFASSEKASFSGFKNLNFQIQKGELVIITGSIGTGKSSLLNALAGFMKKTEGDIFKNGS- 617

Query: 573 ITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKF 632
                         ++   P + + T+RDNI +G + +  +   + V + C     +   
Sbjct: 618 -------------LLLCGYPWIQNTTVRDNILFGSSFDDVR--YKEVIRVCALQADLDIL 662

Query: 633 PYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQ 691
           P    T IG  G  LSGGQK RI +AR++ K  +I + D+  SA+D    +  ++     
Sbjct: 663 PAGDFTEIGERGITLSGGQKARINLARSVYKSMDIYLFDDVLSAVDARVGKHIMDECLMG 722

Query: 692 LMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
           ++  K+  + +  H+LS I R+  +I LG  GS  ++G  +EL
Sbjct: 723 MLDGKTRILAT--HQLSLIERASRVIFLGAGGS-FDIGTVEEL 762

>YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON}
            YCF1Vacuolar glutathione S-conjugate transporter; member
            of the ATP-binding cassette family; has a role in
            detoxifying metals such as cadmium, mercury, and
            arsenite; also transports unconjugated bilirubin,
            selenodigluthatione, and oxidized glutathione; similar to
            human cystic fibrosis protein CFTR
          Length = 1515

 Score =  139 bits (349), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 136/501 (27%), Positives = 228/501 (45%), Gaps = 55/501 (10%)

Query: 264  LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSY----IVSRSITQKISDGVK-----SL 314
            L +++    L     FF+   +G +++R   D Y    ++ R+ +Q   + VK     ++
Sbjct: 1025 LHNLMTNSVLRAPMTFFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVTFTITV 1084

Query: 315  ICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVS--- 371
            IC               +   +  +IP+ +    + +     SREL+     +TR     
Sbjct: 1085 ICAT-------------TWQFIFIIIPLSVFYIYYQQYYLRTSRELR-RLDSITRSPIYS 1130

Query: 372  --EEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAF--INAKFFTS--TSLVGDL 425
              +E L G+ TV+ +  +    KRF+H  +   D    A +  INA  + +    L+G +
Sbjct: 1131 HFQETLGGLATVRGYSQQ----KRFSHINQCRIDNNMSAFYPSINANRWLAYRLELIGSI 1186

Query: 426  SFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFEL 485
              L       + +  G+LT G +   + Y       +  +     E+     +  R+ E 
Sbjct: 1187 IILGAATLSVFRLKQGTLTAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEY 1246

Query: 486  TD---RVPTI----RPTLGKTYTPGKGEIEFKNVSFAYPTRPS-NQIFKSLNFKIKPGSN 537
             D     P I    RP   K + P +G+I+F N S  Y  RP  + + K +N  IKP   
Sbjct: 1247 ADLKSEAPLIVEGHRPP--KEW-PSQGDIKFNNYSTRY--RPELDLVLKHINIHIKPNEK 1301

Query: 538  VCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSG 597
            V IVG +G GKS++ L L      + G I+ID   I ++    LR +++++ Q+  +  G
Sbjct: 1302 VGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNIAINEIGLYDLRHKLSIIPQDSQVFEG 1361

Query: 598  TIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYT-YDTYIGPHGTLLSGGQKQRIA 656
            T+R+NI      + T E I    +       ++       D  +   G  LS GQ+Q + 
Sbjct: 1362 TVRENI--DPINQYTDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLC 1419

Query: 657  IARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENI 716
            +ARA++    IL+LDEAT+A+DVE++  +  T     K +  TI++IAHRL+TI  S+ I
Sbjct: 1420 LARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRI 1477

Query: 717  IVLGNDGSVVEMGKFKELFAD 737
            IVL N G V E     +L +D
Sbjct: 1478 IVLDN-GKVAEFDSPGQLLSD 1497

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 110/493 (22%), Positives = 217/493 (44%), Gaps = 49/493 (9%)

Query: 264 LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQK---ISDGVKSLICGGVG 320
           L +++ + +L   +E   +   GD+++ +  D   + + +TQ    I  G   +I     
Sbjct: 381 LTALIYQKSLVLSNEASGLSSTGDIVNLMSVDVQKL-QDLTQWLNLIWSGPFQIIICLYS 439

Query: 321 IGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRT 380
           +  +L  SM +  +++  ++P  L++ +   Q ++   +++    + TRV  E LN +++
Sbjct: 440 LYKLLGNSMWVGVIILVIMMP--LNSFLMRIQKKLQKSQMK-YKDERTRVISEILNNIKS 496

Query: 381 VQSFVAEQ-----REIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGS 435
           ++ +  E+      E  R N  ++ +  +G   A  + +F     LV   +F  V VY  
Sbjct: 497 LKLYAWEKPYREKLEEVRNNKELKNLTKLGCYMAVTSFQFNIVPFLVSCCTF-AVFVYTE 555

Query: 436 YLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFEL---TDRVPTI 492
              L   L    LT F L +      +  +    +  ++ + +  RLF      +  P  
Sbjct: 556 DRALTTDLVFPALTLFNLLSF----PLMIIPMVLNSFIEASVSIGRLFTFFTNEELQPDS 611

Query: 493 RPTLGKTYTPGKGEIEF-KNVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGPSGKGKST 550
              L K    G   I    + +F +  +P  ++  K++NF+ K G+  CIVG  G GK+ 
Sbjct: 612 VQRLPKVKNIGDVAINIGDDATFLWQRKPEYKVALKNINFQAKKGNLTCIVGKVGSGKTA 671

Query: 551 IALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEE 610
           +   +L       G   + G              +A V Q P +M+GT+++NI +G    
Sbjct: 672 LLSCMLGDLFRVKGFATVHGS-------------VAYVSQVPWIMNGTVKENILFG--HR 716

Query: 611 PTKEEIRTVAKQCFCHNFIVKFPYTYD---TYIGPHGTLLSGGQKQRIAIARALIKKPNI 667
              E      K C      +      D   T +G  G  LSGGQK R+++ARA+  + + 
Sbjct: 717 YDAEFYEKTIKAC---ALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADT 773

Query: 668 LILDEATSALDVE-SEGAINYTFGQ--LMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGS 724
            +LD+  +A+D   +   I +  G   L+ +K+  + +  +++S +  +++I +L N G 
Sbjct: 774 YLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTKVLAT--NKVSALSIADSIALLDN-GE 830

Query: 725 VVEMGKFKELFAD 737
           + + G + E+  D
Sbjct: 831 ITQQGTYDEITKD 843

>Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015W
            (REAL)
          Length = 1557

 Score =  138 bits (347), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 146/548 (26%), Positives = 255/548 (46%), Gaps = 62/548 (11%)

Query: 228  LYEFLGGFSVALFIGCAA--NYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFDVHKV 285
            ++ F+G +S+ + +G AA  N          S R   +L   + K  +     FF+   V
Sbjct: 1017 VWMFVGVYSL-IGVGSAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIKSPMIFFETTPV 1075

Query: 286  GDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLS 345
            G +I+R  +D   V  S+    S   KS++   V +            +LV + +P  L 
Sbjct: 1076 GRIINRFSSDMDAVDSSLQYIFSFFFKSILTYLVTV------------ILVGYNMPWFLV 1123

Query: 346  ASIFGKQIRIN--------SRELQD----ATGQLTRVSEEQLNGVRTVQSFVAEQREI-- 391
             ++F   I I         SREL+     +   +  +  E LNG   + ++   +R I  
Sbjct: 1124 FNMFLLGIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYL 1183

Query: 392  --KRFNHSIREIFDVGKRAAFINAKFFT-STSLVGDLSFLTVLVYGSYLVLHGSLTIGDL 448
              ++  ++I  +F+      +++ +  T   ++V   + LT+    +   L   + +G L
Sbjct: 1184 NYEKIQYNIDFVFNFRSTNRWLSVRLQTIGATIVLATAMLTLATMNTKKQLSSGM-VGLL 1242

Query: 449  TAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRV-------PTIRPTLGKTYT 501
             ++ L  E TG+  + + T    I     +  R+ E  +         P  RP   K + 
Sbjct: 1243 MSYSL--EVTGSLTWIVRTTVM-IETNIVSVERIVEYCELPSEAQSINPEKRP--DKNW- 1296

Query: 502  PGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNP 561
            P +G IEFK+ S  Y     + + K +N KI+P   V IVG +G GKST++L L     P
Sbjct: 1297 PSRGSIEFKDYSTKY-RENLDPVLKDINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEP 1355

Query: 562  TSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNIT--YGLTEEPTKEEIRTV 619
            T G+I+IDG +I+ L    LR  +A++ Q+     GT++ N+      +E+  K+ +   
Sbjct: 1356 TEGKIIIDGINISDLGLFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRYSEDELKKAVELA 1415

Query: 620  AKQCFCHNFIVKFPY----------TYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILI 669
              +      +   P             D  I  +G+ LS GQ+Q + +ARAL+ +  IL+
Sbjct: 1416 HLKPHLEKMLENEPSDSEESCDIKDILDVKINENGSNLSVGQRQLLCLARALLNRSKILV 1475

Query: 670  LDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMG 729
            LDEAT+++D+E++  I  T  +  K +  TI++IAHR+ T+  S+ IIVL ++GSV E  
Sbjct: 1476 LDEATASIDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGSVKEFD 1532

Query: 730  KFKELFAD 737
               +L ++
Sbjct: 1533 SPSKLLSN 1540

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 101/402 (25%), Positives = 185/402 (46%), Gaps = 66/402 (16%)

Query: 373 EQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLT--- 429
           E LN +++++ +  E+  +KR NH +R   ++         K F    +V +L +     
Sbjct: 477 ELLNAIKSIKLYAWEEPMMKRLNH-VRNDMEL---------KNFRKIGIVSNLIYFAWNC 526

Query: 430 --VLVYGSYLVLHGSLTIGDLTAFMLYTEYT-----GNAIFGLSTFYSEIMQGAGAASRL 482
             ++V  S   L        L+  +++   +      +AI+ + +  + I++ + +  RL
Sbjct: 527 VPLMVACSTFGLFSLFNDSPLSPAIVFPSLSLFNILNSAIYSVPSMINTIIETSVSMKRL 586

Query: 483 --FELTDRV-----PTIRPTLGKTYTPGKGEIEFKNVSFAYPTRP--------------- 520
             F L+D +       I P++ +   P    IE  N++F + ++                
Sbjct: 587 KSFLLSDEIDDSFIERIDPSVDERTLPV---IEMNNITFLWKSKEALASSQLENNSRADE 643

Query: 521 -----SNQI-FKSLN-FKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDI 573
                S+QI  K+++ F+ K G+ VCIVG  G GKST    +L       GQ+       
Sbjct: 644 ESAMGSSQIALKNIDHFEAKRGNLVCIVGRVGAGKSTFLKAIL-------GQLPCMSGSK 696

Query: 574 TKLNSKSLRRQ--IAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVK 631
             +  K + R   +A   QE  +M+ ++++NI +G   +    ++   A Q      I+ 
Sbjct: 697 ESIPPKLIIRSSSLAYCSQESWIMNASVKENILFGHKFDKAYYDLTIKACQLLPDLRIL- 755

Query: 632 FPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTF- 689
            P   +T +G  G  LSGGQK R+++ARA+  + +I +LD+  SA+D E S+  I Y   
Sbjct: 756 -PDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLI 814

Query: 690 GQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKF 731
           G+    K+ TI+   + +S ++ S+ I  L N G +VE G +
Sbjct: 815 GKKALLKNKTIILTTNTVSILKHSQMIYALEN-GEIVEQGNY 855

>ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1525

 Score =  138 bits (347), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 137/480 (28%), Positives = 234/480 (48%), Gaps = 39/480 (8%)

Query: 278  EFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVC 337
             FF+   +G +++R   D + V   + +  S  V ++I     I ++   +   +     
Sbjct: 1046 RFFETTPIGRILNRFSNDIFKVDELLGRTFSQFVNNVIKVSFTIIVICFTTWQFT----L 1101

Query: 338  FVIPVVLSASIFGKQIRINSRELQ--DATGQ--LTRVSEEQLNGVRTVQSFVAEQREIKR 393
            FVIP+ +    + +     SREL+  D+T +  +    +E L G+ T++ +  +QR   R
Sbjct: 1102 FVIPLGILYVYYQQYYLRTSRELRRLDSTTRSPIYAHFQESLGGLSTIRGY-NQQR---R 1157

Query: 394  FNHSIREIFDVGKRAAF--INAKFFTSTSLVGDLSFL-TVLVYG----SYLVLH-GSLTI 445
            F H  +   D    A +  +NA  +    L   L F+ T++++G    S L L  GSLT 
Sbjct: 1158 FIHINQSRMDNNMSAYYPSVNANRW----LAYRLEFIGTIIIFGASSLSILRLKSGSLTP 1213

Query: 446  GDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPG-- 503
            G +   + Y      ++  +     E+     +  R+ E ++ +P+  P L +   P   
Sbjct: 1214 GMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSE-IPSEAPYLIEDRRPSPN 1272

Query: 504  ---KGEIEFKNVSFAYPTRPS-NQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYY 559
                G I+F++ S  Y  RP  + I K +N  IKP   + IVG +G GKS++ L L    
Sbjct: 1273 WPTDGAIQFQHYSTRY--RPGLDLILKDINLDIKPKEKIGIVGRTGAGKSSLTLALFRLI 1330

Query: 560  NPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTV 619
                G+I+IDG  I ++    LR +++++ Q+  +  G++R+NI    TE+ + EEI  V
Sbjct: 1331 EAAEGRIVIDGVPIDQMGLYDLRHKLSIIPQDSQVFEGSVRENI--DPTEQYSDEEIWRV 1388

Query: 620  AKQCFCHNFIVKFPYT-YDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALD 678
                   N ++        T +   G  LS GQ+Q + +ARAL+    IL+LDEAT+A+D
Sbjct: 1389 LDLSHLKNHVLNMGNDGLLTQLSEGGGNLSVGQRQLMCLARALLVPTKILVLDEATAAVD 1448

Query: 679  VESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADP 738
            VE++  +  T       +  TI++IAHRL+TI  S+ I+VL + G V E    + L  +P
Sbjct: 1449 VETDKVLQETIRTAFADR--TILTIAHRLNTIMDSDRILVL-DAGRVAEFDTPENLLKNP 1505

 Score =  107 bits (268), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 121/493 (24%), Positives = 223/493 (45%), Gaps = 47/493 (9%)

Query: 260 LVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSR-----SITQKISDGVKSL 314
           L + L SV+ K +L   SE  D+   GD+++ +  D   V R          I  G   +
Sbjct: 381 LKSALTSVIYKKSLVLSSEAADMSSTGDIVNLMSVD---VQRLQDLAQWCHLIWSGPFQI 437

Query: 315 ICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQ 374
           I     +  +L  SM +  +++  ++P  L++S+   Q  +   ++++   Q TR+  E 
Sbjct: 438 ILCLTSLYKLLGKSMWVGVIILIVMMP--LNSSLMRVQKNLQKGQMKNK-DQRTRLINEI 494

Query: 375 LNGVRTVQSFVAEQ-----REIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLT 429
           LN +++++ +  E+      E  R    ++ +  +G   A IN +F      V   +F  
Sbjct: 495 LNNMKSLKLYAWEKPYKEKLEYVRNEKELKNLTKIGVYNAIINFQFNIVPFFVSCSTF-A 553

Query: 430 VLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRV 489
           V VY     L   L    LT F L +         L+++    ++ + +  RL+      
Sbjct: 554 VFVYTEDRPLTTDLVFPALTLFGLLSFPLAVVPLVLNSY----IEASVSIGRLYSFLTNE 609

Query: 490 PTIRPTLGKT-YTPGKGEIEFK---NVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGPS 544
              R ++ +       G++  K   N +F +  +P  ++  K++NF+ K G   C+VG  
Sbjct: 610 ELQRDSVQRLPRVKNIGDVAMKLGDNATFLWKRKPEYKVALKNVNFQAKKGELNCVVGRV 669

Query: 545 GKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNIT 604
           G GKS +   LL       G   + G              IA V Q   +M+GT++DNI 
Sbjct: 670 GSGKSALIQSLLGDLFRVKGFATVHGN-------------IAYVSQVAWIMNGTVKDNIL 716

Query: 605 YGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKK 664
           +G   +P  E      K C     +   P    T +G  G  LSGGQK R+++ARA+  +
Sbjct: 717 FGHKYDP--EFYEKTIKACALTIDLAILPDGDKTIVGEKGISLSGGQKARLSLARAVYSR 774

Query: 665 PNILILDEATSALDVE-SEGAINYTFGQ--LMKSKSMTIVSIAHRLSTIRRSENIIVLGN 721
            +I +LD+  +A+D   S   I++  G   L+K+K+  + +  +++S +  ++++ +L N
Sbjct: 775 ADIFLLDDPLAAVDEHVSTHLIDHVLGPNGLLKTKTKILAT--NKISALSIADSVTLLEN 832

Query: 722 DGSVVEMGKFKEL 734
            G +++ G F E+
Sbjct: 833 -GEIIQQGTFCEI 844

>CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {ON}
            highly similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281w YOR1 ATP-binding cassette transporter protein
          Length = 1477

 Score =  137 bits (346), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 142/514 (27%), Positives = 234/514 (45%), Gaps = 80/514 (15%)

Query: 269  MKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELS 328
            +K  LH    + D   +G +++R   D+  +   +T+ I   + S     +G+ ++  + 
Sbjct: 973  VKRILHAPMSYLDTTPLGRILNRFTKDTDSLDNELTENIR-LMMSQFANIIGVCVLCIVY 1031

Query: 329  MDLSSVLVCFVIPV-VLSASIF---GKQI-RINSRELQDATGQLTRVSEEQLNGVRTVQS 383
            +   ++ + F++ V VL A  +   G++I R+ + +       L  V    L G+ T+++
Sbjct: 1032 LPWFAIAIPFLLLVFVLIADHYQSAGREIKRLEAIQRSFVYNNLIEV----LGGMDTIKA 1087

Query: 384  FVAEQREIKRFNHSIREIFDVGKRA----------------AF--------INAKFFTST 419
            + ++ R + + +  I ++ +V                    AF        +  +F  S 
Sbjct: 1088 YKSQDRYMTKMDFLINKMNEVSYMVVSVQRWVAIFLDMIAVAFALIISLLCVTRQFHISP 1147

Query: 420  SLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAA 479
            S VG      +L Y    VL     +  +   +  TE   N+   L T+ +E+ Q A   
Sbjct: 1148 SAVG-----VLLTY----VLQLPGLLNTVLRALTQTENDMNSAERLVTYATELPQEAAYR 1198

Query: 480  SRLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGSNV 538
               +   D  PT             GE+ F++VSFAY P  P+  + K++N  I  G  +
Sbjct: 1199 KSDYSPPDNWPT------------NGEVIFEDVSFAYRPGLPT--VLKNVNLSIAGGEKI 1244

Query: 539  CIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGT 598
             I G +G GKSTI   L      TSG+I IDG D  KL    LRR+++++ Q+PVL  GT
Sbjct: 1245 GICGRTGAGKSTIMTALYRLNELTSGRIFIDGIDTFKLGLYDLRRKLSIIPQDPVLFRGT 1304

Query: 599  IRDN----------------ITYGLTEEPTKEEIR-TVAKQCFCHNFIVKFPYTYDTYIG 641
            IR N                I  G  E+   E+I+     +   +N + KF    D  + 
Sbjct: 1305 IRKNLDPFNEFSDDSLWNSLIRGGAIEKDDLEDIKHQKPDKNGSYNNMHKF--HLDQIVE 1362

Query: 642  PHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIV 701
              G   S G++Q +A+ RAL+++  ILILDEATS++D E++G I        + +  TI+
Sbjct: 1363 EDGANFSLGERQVLALTRALVRQSKILILDEATSSVDYETDGKIQTRIAT--EFQDCTIL 1420

Query: 702  SIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELF 735
             IAHRL TI   + I+VL   G V E  K + LF
Sbjct: 1421 CIAHRLKTILNYDRILVL-EKGEVAEFDKPEILF 1453

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 113/211 (53%), Gaps = 20/211 (9%)

Query: 525 FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQ 584
           F +LNF+IK G  + I GP G GKS++   +  +   T+G++ I+G              
Sbjct: 617 FSNLNFEIKKGEFIMITGPIGTGKSSLLNAMAGFMPQTTGELDINGH------------- 663

Query: 585 IAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHG 644
             ++   P + + T+RDNI +G   +  +E+ + V + C     I   P    T IG  G
Sbjct: 664 -MLLCGYPWIQNATVRDNIIFGSPYD--REKYKEVIRVCSLQADIDILPAGDMTEIGERG 720

Query: 645 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 703
             LSGGQK RI +AR++ K  +I + D+  SA+D    +  ++  F Q ++SK+  + + 
Sbjct: 721 ITLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSKTRILAT- 779

Query: 704 AHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
            H+LS I +++ +IVL  +GS V++G  +EL
Sbjct: 780 -HQLSLIEKADRVIVLSTNGS-VDIGTVEEL 808

>CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1 or uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1
          Length = 1535

 Score =  137 bits (346), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 137/502 (27%), Positives = 236/502 (47%), Gaps = 53/502 (10%)

Query: 263  RLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIG 322
            +L + + K  +     FF+    G +I+R  +D   V  ++    S   +S++   + + 
Sbjct: 1027 KLHNKMAKTIMRSPMSFFETTPTGRIINRFSSDMDSVDTTLQNVFSLFFRSILDYIITV- 1085

Query: 323  MMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATG----QLTRVSEEQLNGV 378
            +++  +M L  +L   ++ + L    F     + SREL+  T      +  +  E L+G 
Sbjct: 1086 ILVTFNMPLFFLLNAGLLVIYLYYQSF---YIVLSRELKRLTSISYSPIMSLMGESLSGH 1142

Query: 379  RTVQSFVAEQREIKRFNH--------SIREIFDVGKRAAFINAKFFTSTSLVGDLSFL-T 429
             T+ ++     +I+RF+H        SI   F+      +++ +  +    +G L  L T
Sbjct: 1143 FTISAY----EQIRRFSHLNYERIQFSINCFFNYRSSNRWLSVRLQS----IGALIVLST 1194

Query: 430  VLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRV 489
             L+  S L     L+ G +   M Y     +++  +      I     +  R+ E  D  
Sbjct: 1195 GLLALSSLGTDHQLSSGLVGLLMSYALQVTSSLIWIIRSSVLIETNIVSVERIVEYCDIS 1254

Query: 490  PTIRPTLGKTY-----TPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPS 544
            P   P + + +      P +G+IEFKN S +Y     + + K +N  I PG  + +VG +
Sbjct: 1255 PE-APEVKEEHRLDDNWPNQGQIEFKNYSTSY-RENLDPVLKHINLVISPGEKIGVVGRT 1312

Query: 545  GKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIR---- 600
            G GKST+++ L     PT+G I ID  DIT +  + LR  IA++ Q+     GTIR    
Sbjct: 1313 GAGKSTLSMALFRLLEPTAGTISIDNIDITSIGLRDLRSHIAIIPQDAQAFEGTIRSNLD 1372

Query: 601  -------DNITYGLTEEPTKEEIRTVAKQC-----FCHNFIVKFPYTYDTYIGPHGTLLS 648
                   D++ + +     K  + T+AK+      +     ++ P   D  +   G+ LS
Sbjct: 1373 PFEKFSDDDLWHAIELSHLKFHLETIAKEINDDSEYSDRSRLESP--LDIPVREAGSNLS 1430

Query: 649  GGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLS 708
             GQKQ + +ARAL+ K  IL+LDEAT+++DVE++  I  T  +    +  TI++IAHRL 
Sbjct: 1431 VGQKQLLCLARALLNKSKILVLDEATASVDVETDKIIQETIRKEFADR--TILTIAHRLD 1488

Query: 709  TIRRSENIIVLGNDGSVVEMGK 730
            T+  S+ IIVL + G V E  K
Sbjct: 1489 TVFDSDRIIVL-DGGEVKEFDK 1509

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 97/429 (22%), Positives = 189/429 (44%), Gaps = 65/429 (15%)

Query: 347 SIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNH-----SIREI 401
           ++  +++++ S+          +   E L+ +++++ +  E+  +KR  H      +  +
Sbjct: 434 TLLSRKLKVLSKTQMKFKDSRIKTVSEILSSIKSIKLYAWEEPMLKRLFHIRNDLELMNL 493

Query: 402 FDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNA 461
             +G  + FI+  +      +   +F T  V  S   L   +    L+ F +      +A
Sbjct: 494 KKIGIMSNFISFAWNAVPLAITCATFFTFAVI-SKTPLSPEIVFPALSLFNI----LNSA 548

Query: 462 IFGLSTFYSEIMQGAGAASRL--FELTDRVPTIRPTLGKTYTPGKGE---IEFKNVSFAY 516
           I+ + +  S I++   + SR+  F L + +      + ++ TP       ++  N +F +
Sbjct: 549 IYSIPSMISRIIETGVSISRVKKFLLLEELDN--SFIERSVTPEDDTTPVLKINNATFLW 606

Query: 517 PTRP------------------SNQI-FKSL-NFKIKPGSNVCIVGPSGKGKSTIALLLL 556
            ++                   S+QI  KS+ NF++   S +C+VG  G GKSTI   +L
Sbjct: 607 RSKENLHKDDKNGENDVEARIESSQIALKSIDNFEVPKSSLICVVGRVGAGKSTILKCIL 666

Query: 557 HYYNPTSGQILIDGQDITKLNSKSLRRQ-------IAVVQQEPVLMSGTIRDNITYGLTE 609
                 SG            N+  L  Q       +A   QE  +M+ +++DNI +G   
Sbjct: 667 GQLPCISG------------NNDHLSPQFQINATTVAYCPQEAWIMNASVKDNILFG--H 712

Query: 610 EPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILI 669
           +  +   +   K C     I   P   +T +G  G +LSGGQK R+++ARA+  + ++ +
Sbjct: 713 KYDEAFYKATIKACQLLPDIKVLPDGDETMVGEKGIVLSGGQKTRLSLARAVYSRADLYL 772

Query: 670 LDEATSALDVE-SEGAINYTFGQ---LMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSV 725
           LD+  SA+D E  +  I     +   L+K KS  IV   + +S ++ S  I +L N  S+
Sbjct: 773 LDDILSAVDTEVCKTIIKEVLDEKTGLLKDKS--IVLATNTISVLKHSTKIYLLENK-SI 829

Query: 726 VEMGKFKEL 734
            + G + ++
Sbjct: 830 AQEGNYDDI 838

>Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar to
            Ashbya gossypii ACL072C
          Length = 1678

 Score =  137 bits (344), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 134/495 (27%), Positives = 233/495 (47%), Gaps = 48/495 (9%)

Query: 263  RLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLI-CGGVGI 321
            ++ ++++K  L+    FFD    G +++R   D   +   +         SL+ C    I
Sbjct: 1158 KIFTLLLKKVLYAKLRFFDSTPTGRIMNRFSRDVEAIDEELIPFFEGAFASLVQC----I 1213

Query: 322  GMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQD----ATGQLTRVSEEQLNG 377
              +L +   ++ V + F I + +S  I G    + SRELQ         + +   E L G
Sbjct: 1214 TTILLIGY-ITPVFLFFAIVICVSYYIVGYFYLVGSRELQRFESITKSPIHQHFSETLVG 1272

Query: 378  VRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFL---TVLVYG 434
            V T+++F  E    +RF        D   R  F    + T+  L   + F+    +L  G
Sbjct: 1273 VTTIRAFGDE----RRFLADNLSKVDTHNRPFFY--LWVTNRWLAFRIDFIGAFVILASG 1326

Query: 435  SYLVLH-GSLTIGDLTAFMLYT-EYTGNAIFGLSTFYSEIMQGAGAASRLFELT--DRVP 490
             +++L+  SL  G     ++Y   +T  A++ L   YS +     +  RL E    ++ P
Sbjct: 1327 IFILLNVNSLDAGLAGISLIYAISFTEGALW-LVRLYSNVEMTMNSVERLKEYMKIEQEP 1385

Query: 491  TIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKST 550
            +          P +G+IE  N+S  Y +    ++ K++ F ++P S V IVG +G GKST
Sbjct: 1386 STGLYEPPPEWPDRGKIEVNNLSLRYASNLP-KVIKNVTFTVEPQSKVGIVGRTGAGKST 1444

Query: 551  IALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDN-------- 602
            I   L  + +P +G I +D  DIT +  K LR+ I ++ Q+PVL +GTI+ N        
Sbjct: 1445 IITALFRFLDPDTGTIKLDNVDITSIRLKRLRQSITIIPQDPVLFAGTIKSNLDPYSEYA 1504

Query: 603  ----------ITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQK 652
                      +   + EE T  +I + +      N + KF     + I   G+ LS GQ+
Sbjct: 1505 DDRIFEALKRVNLIVQEELTPTDIPSSSSSLSFEN-VNKF-LDLTSEITEGGSNLSQGQR 1562

Query: 653  QRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRR 712
            Q + +AR+L++ P  ++LDEAT+++D  S+  I  T  +  +    TI++IAHRL +I  
Sbjct: 1563 QLVCLARSLLRNPKAILLDEATASIDYASDAKIQQTIRE--EFSGSTILTIAHRLRSIID 1620

Query: 713  SENIIVLGNDGSVVE 727
             + ++V+ + G + E
Sbjct: 1621 YDKVLVI-DSGELAE 1634

 Score = 88.2 bits (217), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 108/470 (22%), Positives = 204/470 (43%), Gaps = 41/470 (8%)

Query: 285 VGDLISRLGADSYIVSR--SITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPV 342
           +G +I+ +  DS  VS+  +    + + V   I   V +  +L  S  + +  +  ++P+
Sbjct: 494 LGAIINLMAVDSIKVSQVSAYIHMLLESVVMAIVAMVLLYRLLGWSALVGATFIICILPI 553

Query: 343 VLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQR------EIKRFNH 396
            L    F  ++     +    T +  +   E L  +R ++ F  E +      +I+    
Sbjct: 554 NLR---FATKLGELQEDALACTDRRIQKLNETLQAIRIIKFFAWEDKFESDVQKIREMEL 610

Query: 397 SI--REIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLY 454
           S+  R +  V   ++F+   ++ + +LV   SF  V +Y    VL   +    L+ F+L 
Sbjct: 611 SVMLRRVV-VWSLSSFV---WYITPTLVASASF-CVYIYVQGEVLTTPVAFTALSLFVLL 665

Query: 455 TEYTGNAIFGLSTFYSEIMQGAGAASRL--FELTDRVPTIRPTLGKTYTPGKGEIEFKNV 512
                N +  L      ++Q + +  R+  F   D  P  R       T  K  + F N 
Sbjct: 666 R----NPLDQLCDIVFSLVQCSVSLRRIQNFLDQDETPKYR-----QLTVKKDRLGFSNA 716

Query: 513 SFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG- 570
           +  +    +     K+LN   K G    IVGP+G GK+++ + LL   N + G+I +   
Sbjct: 717 TIGWDHDSATDFKLKNLNIDFKIGKLNVIVGPTGSGKTSLLMGLLGEINLSEGKIYVPAL 776

Query: 571 ---QDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHN 627
              +D+  +++  +   I    Q   L++ T+R+NI +    E  +     V   C    
Sbjct: 777 NPREDLV-VDADGMTDSIGYCSQSAWLLNDTLRNNILFSAPYEANRYN--AVIHACGLTR 833

Query: 628 FIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI-- 685
            +        T +G  G  LSGGQKQR+++ARA+  +   ++LD+  SA+D  +   I  
Sbjct: 834 DLEILNAGDQTEVGEKGITLSGGQKQRVSLARAMYSRARHILLDDCLSAVDSHTAQWIYK 893

Query: 686 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELF 735
           +   G LM+ ++  +VS  H  +   ++ + +V+  +  V   G+  ELF
Sbjct: 894 HCITGPLMEGRTCVLVS--HNTALTLKNADWVVILENAKVTAQGEPLELF 941

>Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  137 bits (344), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 135/502 (26%), Positives = 235/502 (46%), Gaps = 57/502 (11%)

Query: 264  LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSY----IVSRSITQKISDGVK-----SL 314
            L +++    L     FF+   +G +++R   D Y    ++ R+ +Q   + VK     ++
Sbjct: 1026 LHNLMTNSVLRAPMTFFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVTFTITV 1085

Query: 315  ICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRI-NSRELQDATGQLTRVS-- 371
            IC              +++    F+I  +    I+ +Q  +  SREL+     +TR    
Sbjct: 1086 IC--------------VTTWQFIFIIVPLGVFYIYYQQYYLRTSRELR-RLDSITRSPIY 1130

Query: 372  ---EEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAF--INAKFFTS--TSLVGD 424
               +E L G+ TV+ +  +    KRF+H  +   D    A +  +NA  + +    L+G 
Sbjct: 1131 SHFQETLGGLATVRGYSQQ----KRFSHINQCRIDNNMSAFYPSVNANRWLAYRLELIGS 1186

Query: 425  LSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFE 484
            +  L       + +  G+LT G +   + Y       +  +     E+     +  R+ E
Sbjct: 1187 VIILGAATLSVFRLKQGTLTAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKE 1246

Query: 485  LTD---RVPTI----RPTLGKTYTPGKGEIEFKNVSFAYPTRPS-NQIFKSLNFKIKPGS 536
              D     P +    RP   K + PG+G+I+F   S  Y  RP  + + K ++  IKP  
Sbjct: 1247 YADIKSEAPLVIEGHRPP--KEW-PGQGDIKFNQYSTRY--RPELDLVLKQIDIHIKPKE 1301

Query: 537  NVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMS 596
             + IVG +G GKS++ L L      ++G I+IDG  I ++    LR +++++ Q+  +  
Sbjct: 1302 KIGIVGRTGAGKSSLTLALFRIIEASAGNIVIDGIPINEIGLYDLRHKLSIIPQDSQVFE 1361

Query: 597  GTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYT-YDTYIGPHGTLLSGGQKQRI 655
            GT+R+NI      + T E +    +       I+       D+ +   G+ LS GQ+Q +
Sbjct: 1362 GTVRENI--DPINQYTDEAMWRALELSHLKEHILSMSNDGLDSQLTEGGSNLSVGQRQLL 1419

Query: 656  AIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSEN 715
             +ARA++ +  IL+LDEAT+A+DVE++  I  T     K +  TI++IAHRL+TI  S+ 
Sbjct: 1420 CLARAMLVQSKILVLDEATAAVDVETDKVIQETIRTAFKDR--TILTIAHRLNTIMDSDR 1477

Query: 716  IIVLGNDGSVVEMGKFKELFAD 737
            IIVL N G V E     +L  +
Sbjct: 1478 IIVLDN-GKVAEFDSPAQLLTN 1498

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 110/491 (22%), Positives = 222/491 (45%), Gaps = 45/491 (9%)

Query: 264 LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQK---ISDGVKSLICGGVG 320
           L +++ + +L   +E   +   GD+++ +  D   + + +TQ    I  G   +I     
Sbjct: 382 LTALIYQKSLVLSNEASGLSSTGDIVNLMSVDVQKL-QDLTQWLNLIWSGPFQIIICLYS 440

Query: 321 IGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRT 380
           +  +L  SM +  +++  ++P  L++ +   Q ++   +++    + TRV  E LN +++
Sbjct: 441 LYKLLGNSMWVGVIILVIMMP--LNSFLMRIQKKLQKSQMK-YKDERTRVISEILNNIKS 497

Query: 381 VQSFVAEQ-----REIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGS 435
           ++ +  E+      E  R N  +  +  +G   A  + +F     LV   +F  V VY  
Sbjct: 498 LKLYAWEKPYREKLEDVRNNKELNNLTKLGCYMAVTSFQFNIVPFLVSCCTF-AVFVYTE 556

Query: 436 YLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFEL---TDRVPTI 492
              L   L    LT F L +      +  +    +  ++ + +  RLF      +  P  
Sbjct: 557 DRALTTDLVFPALTLFNLLS----FPLMIIPMVLNSFIEASVSIGRLFSFFTNEELQPDS 612

Query: 493 RPTLGKTYTPGKGEIEF-KNVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGPSGKGKST 550
              L K    G   I    + +F +  +P  ++  K++NF+ K G   C+VG  G GK+ 
Sbjct: 613 VQRLPKVENVGDIAINIGDDATFLWQRKPEYKVALKNINFQAKKGELTCVVGKVGSGKT- 671

Query: 551 IALLLLHYYNPTSGQILIDGQDITKLNS-KSLRRQIAVVQQEPVLMSGTIRDNITYGLTE 609
            ALL     + T G       D+ ++    S+   +A V Q P +M+GT+++NI +G   
Sbjct: 672 -ALL-----SSTLG-------DLFRVKGFASVHGSVAYVSQVPWIMNGTVKENILFG--H 716

Query: 610 EPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILI 669
           +   E      K C     +        T +G  G  LSGGQK R+++ARA+  + +  +
Sbjct: 717 KYDAEFYEKTIKACALTIDLAILMDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYL 776

Query: 670 LDEATSALDVE-SEGAINYTFGQ--LMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVV 726
           LD+  +A+D   +   + +  G   L+ +K+  + +  +++S +  +++I +L N G ++
Sbjct: 777 LDDPLAAVDEHVARHLVEHVLGSNGLLHTKTKLLAT--NKVSALSVADSIALLDN-GEII 833

Query: 727 EMGKFKELFAD 737
           + G + ++  D
Sbjct: 834 QQGTYDDITKD 844

>Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {ON}
            YLL048C (YBT1) - bile acid transporter of ABC family
            [contig 274] PARTIAL
          Length = 1436

 Score =  136 bits (343), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 139/509 (27%), Positives = 229/509 (44%), Gaps = 74/509 (14%)

Query: 263  RLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLI-CGGVGI 321
            ++ ++++K  L+    FFD   +G +++R   D   V + +T  +     SL+ C     
Sbjct: 915  KIFNLILKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQC----- 969

Query: 322  GMMLELSMDLSSV-LVCFVIPVVLSASIF--------GKQIRINSRELQD----ATGQLT 368
                     LS+V L+ ++ P     +IF        G      SREL+     +   + 
Sbjct: 970  ---------LSTVILIAYITPGFFVVAIFIAILYYLVGYFYMAGSRELKRFESISRSPIH 1020

Query: 369  RVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFI----NAKFFTSTSLVGD 424
            +   E L G+ T+++F  E    +RF     E  D   +  F     N        ++G 
Sbjct: 1021 QHFSETLVGITTIRAFGDE----RRFMQENLEKIDENNKPFFYLWVANRWLAFRIDMIGA 1076

Query: 425  LSFLTVLVYGSYLVLH-GSLTIGDLTAFMLYT-EYTGNAIFGLSTFYSEIMQGAGAASRL 482
                 +   G +++L+  SL  G     + Y   +T  A++ L   YS +     +  RL
Sbjct: 1077 C---VIFAAGIFVLLNIKSLDSGLAGISLTYAISFTEGALW-LVRLYSNVEMTMNSVERL 1132

Query: 483  FELTDRVPTIRPTLGKTYTP-----GKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGS 536
             E  +      P    T+TP      +G+IE  ++S  Y P+ P  ++ K+++F + P  
Sbjct: 1133 KEYMEVEQ--EPHYQSTHTPPPEWPSQGKIEVNDLSLRYAPSLP--KVIKNVSFTVDPNC 1188

Query: 537  NVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMS 596
             V IVG +G GKSTI   L  + +P SG I ID  DIT +  K LR+ I ++ Q+P L +
Sbjct: 1189 KVGIVGRTGAGKSTIITALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFT 1248

Query: 597  GTIRDNI----TYG-------------LTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTY 639
            GT++ N+     Y              LTEE               H+  V      D  
Sbjct: 1249 GTVKSNLDPYDEYSDGQIFEALKRVNLLTEEELNSAGSPAPGNSSIHSENVNKFLRLDNE 1308

Query: 640  IGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTF-GQLMKSKSM 698
            I   G  LS GQ+Q + +AR+L++ P +++LDEAT+++D  S+  I  T  G+   S   
Sbjct: 1309 ITEGGANLSQGQRQLVCLARSLLRSPKVMLLDEATASIDYTSDARIQQTIRGEFSNS--- 1365

Query: 699  TIVSIAHRLSTIRRSENIIVLGNDGSVVE 727
            TI++IAHRL +I   + I+V+ + G V E
Sbjct: 1366 TILTIAHRLRSIIDYDKILVM-DAGEVKE 1393

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 107/462 (23%), Positives = 212/462 (45%), Gaps = 26/462 (5%)

Query: 285 VGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVL 344
           +G +I+ +  D++ VS  I   +   V++L+   V + ++ +L +  S+++   +I V+L
Sbjct: 258 LGAIINLMAVDAFKVSE-ICAYLHSFVEALVMTIVALTLLYKL-LGWSAIVGVLLIIVIL 315

Query: 345 SASIFGKQIRIN-SRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFD 403
             +     +  N  +E    T +  +   E    +R ++ F  E+     F   I+ I D
Sbjct: 316 PLNFKLANLLGNLQKETLSFTDKRIQKLNETFQAIRIIKFFSWEEN----FEKDIQNIRD 371

Query: 404 VGKRAAFINAKFFTSTSLVGDL--SFLTVLVYGSYLVLHGSL--TIGDLTAFMLYTEYTG 459
              +     +  +  T+ V  +  S +T + + +Y+ + G +  T    TA  L+T    
Sbjct: 372 QELKMLVKRSIVWALTAFVWFVTPSIVTTVSFATYIYIQGEVLTTPVAFTALSLFT-LLR 430

Query: 460 NAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTR 519
           N +  LS   S ++Q   +  R+    +   T +       T  +  I F+N +F++  +
Sbjct: 431 NPLDMLSDMLSYVIQSKVSLDRVQVFLEEDETEK---YDQITVSRKRIGFENATFSWDRK 487

Query: 520 PSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI---LIDGQDITKL 576
             +   K+++ + + G    ++GP+G GK+++ + LL   +   G++    +D ++   +
Sbjct: 488 NPDFKLKNMSIEFRLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEGKVYAPCLDPREDLIV 547

Query: 577 NSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKE-EIRTVAKQCFCHNFIVKFPYT 635
            +  +   IA   Q   L++ T+++NI +     P  E     V + C            
Sbjct: 548 ENDGMTNSIAYCSQGAWLLNDTVKNNILFS---SPFNEARYDAVVEACGLKRDFEILSAG 604

Query: 636 YDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQLM 693
             T IG  G  LSGGQKQR+++ARAL      L+LD+  SA+D  +   I  N   G LM
Sbjct: 605 DQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSHTALWIYENCITGPLM 664

Query: 694 KSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELF 735
           + ++  +VS  H ++   ++ + +V   +G V + G+  ELF
Sbjct: 665 EGRTCILVS--HNVALTLKNADWVVFMENGKVKDQGEPLELF 704

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
            YHL035C (REAL)
          Length = 1599

 Score =  135 bits (339), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 150/542 (27%), Positives = 253/542 (46%), Gaps = 78/542 (14%)

Query: 222  IMFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFD 281
            +++ L +Y F  GF  AL +G   N          S ++   +  +V    LH    FFD
Sbjct: 1044 MLYYLGMY-FAIGFIQAL-LGGIKNIATFFSGIQASRKIFDNMLDLV----LHAKIRFFD 1097

Query: 282  VHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIP 341
            V  +G +++R   D   V + +T  +     ++ C      ++  +++     L+  V+ 
Sbjct: 1098 VTPIGRIMNRFAKDIEGVDQELTPYLE---VTMFCLIQCTSIIFLITIITPHFLIVAVVV 1154

Query: 342  VVLSASIFGKQIRINSRELQ--DATGQ--LTRVSEEQLNGVRTVQSFVAEQREIKRFNHS 397
             +L   + G      SREL+  D+  +  + +   E L GV T+++F  E    KRF   
Sbjct: 1155 FILYYFV-GMWYLTASRELKRIDSITKSPIFQHFSETLVGVCTIRAFGDE----KRFILE 1209

Query: 398  IREIFDVGKRAAF---INAKFFT-STSLVGDLSFLTVLVYGSYLVLH-GSLTIG----DL 448
              +  D   RA F   +  K+F     ++G  +F+ VL  GS+++++ G++  G     L
Sbjct: 1210 NLDKIDQNNRAFFYLSVAVKWFAFRVDIIG--AFI-VLASGSFILINIGNIDSGLAGISL 1266

Query: 449  TAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELT--------DRVPTIRPTLGKTY 500
            T  +L+T+        L   YS       +  RL E +        D        L ++ 
Sbjct: 1267 TYAILFTD----GALWLVRLYSTFEMSMNSVERLKEYSSIEQENYFDYNKDHIQELQQSS 1322

Query: 501  TPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYN 560
             P  G+IE  N+S  Y +     + K+++F I+P S V IVG +G GKSTI   L     
Sbjct: 1323 WPEHGQIEVDNLSLRYASNLP-PVIKNVSFTIEPQSKVGIVGRTGAGKSTIITALFRLLE 1381

Query: 561  PTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVA 620
            P +G I IDG DI++++  +LRR I ++ Q+P+L +GTI+ N+     +E   ++I  V 
Sbjct: 1382 PETGHIKIDGYDISQIDLVTLRRAITIIPQDPILFTGTIKSNV--DPCDEYDNKKIFKVL 1439

Query: 621  KQCFCHNFIV-------------------KFPYTYDTYIGPHGTLLSGGQKQRIAIARAL 661
             Q    N I                    KF     T I   G  +S G++Q + IAR+L
Sbjct: 1440 SQV---NLISTGEMEAAQNMGDDSNTARNKF-VNLQTEITEGGQNISQGERQLLFIARSL 1495

Query: 662  IKKPNILILDEATSALDVES----EGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENII 717
            +++P I++LDEATS++D ES    +G I   F +       TI++IAHRL ++   + ++
Sbjct: 1496 LREPKIILLDEATSSIDYESDHLIQGIIRNEFNK------STILTIAHRLRSVIDYDRVL 1549

Query: 718  VL 719
            V+
Sbjct: 1550 VM 1551

 Score = 97.1 bits (240), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 119/469 (25%), Positives = 213/469 (45%), Gaps = 37/469 (7%)

Query: 285 VGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELS-----MDLSSVLVCFV 339
           +G +I+ +  DS+ VS  I+      V+++I   + +G++ +         +S +L+ F 
Sbjct: 447 LGTIINLISIDSFKVSE-ISTYFYMTVQAIIMVLIVVGLLFKFLGISALAGISIILMMFP 505

Query: 340 IPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQ---REIKRFNH 396
           +   L A + GK        LQ    ++ +++E  L  +R V+ F  E    ++IK    
Sbjct: 506 LNFRL-AELLGK---FQKSALQCTDKRIAKLNE-CLQNIRIVKYFAWENNISKDIKSIRQ 560

Query: 397 S-IREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYT 455
           + +R +F      A  +  +F + +LV  ++F  + ++  +  L+  L    L+ F L  
Sbjct: 561 NELRFLFQKALVWALSSFLWFVTPTLVTGVTF-AIYIFVQHQELNAPLAFTTLSLFTLLK 619

Query: 456 EYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFA 515
                 +  LS   S + Q   +  R+ +  +   T +     T +P + +IEFKN +  
Sbjct: 620 ----TPLDQLSNMLSFMNQSIVSLDRIVKFINEDDTEKYN-QLTVSPDENKIEFKNATLT 674

Query: 516 YPTRPSNQ-IFK--SLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG-- 570
           +     +  IFK   LN   + G    I+G +G GKS + + LL   +  SG I + G  
Sbjct: 675 WNENDKDSTIFKLCGLNITFQIGKLNLILGSTGSGKSALLMGLLGELHLISGSITVPGLE 734

Query: 571 --QDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNF 628
              D+   +   L    A   Q   L++ T+++NI +    +  +   + V   C     
Sbjct: 735 PRHDLIP-DHNGLTNSFAYCSQSAWLLNDTVKNNIIFNGAYDDVR--YKEVIDACGLKRD 791

Query: 629 IVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--N 686
           +   P    T IG  G  LSGGQKQRI++ARA+      ++LD+  SA+D  +   I  N
Sbjct: 792 LEILPAGDSTEIGEKGITLSGGQKQRISLARAVYSNAKHVLLDDCLSAVDSHTAVWIYEN 851

Query: 687 YTFGQLMKSKSMTIVSIAHRLS-TIRRSENIIVLGNDGSVVEMGKFKEL 734
              G +M+++  T + + H +S TIR +   ++L N G V   G  K+L
Sbjct: 852 CITGPIMENR--TCILVTHNVSLTIREAYFAVILEN-GKVKNQGTIKQL 897

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
            complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score =  134 bits (338), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 143/503 (28%), Positives = 233/503 (46%), Gaps = 69/503 (13%)

Query: 264  LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSY----IVSRSITQKISDGVKS-----L 314
            L S ++   L     FF+   +G +++R   D Y    ++ RS +Q   + VK      +
Sbjct: 1033 LHSSMVSSILRAPMTFFETTPIGRILNRFSNDVYKIDEVLGRSFSQFFVNAVKVSFTILV 1092

Query: 315  ICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQD----ATGQLTRV 370
            IC      ++L             VIP+ +    + +     SREL+         +   
Sbjct: 1093 ICWNTWQFILL-------------VIPMGVLYLYYQQYYLRTSRELRRLDSITKSPIYAH 1139

Query: 371  SEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAF--INAKFFTSTSLVGDLSFL 428
             +E L G+ T++ +  EQ+  KRF H  +   D    A +  IN+  +    L   L FL
Sbjct: 1140 FQESLGGLATIRGY--EQQ--KRFIHINQARVDNNMSAYYPSINSNRW----LAYRLEFL 1191

Query: 429  -TVLVYG----SYLVLH-GSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRL 482
             +++++G    S L L  G+LT G +   + Y      ++  +     E+     +  R+
Sbjct: 1192 GSLIIFGAASLSILKLRDGTLTAGMIGLSLSYALQVTQSLNWIVRMTVEVETNIVSVERI 1251

Query: 483  ---FELTDRVPTI----RPTLGKTYTPGKGEIEFKNVSFAYPTRPS-NQIFKSLNFKIKP 534
                EL    P I    RP+      P +G I+F+N S  Y  RP  + + K+++  IKP
Sbjct: 1252 KEYAELKSEAPLIIEEKRPSEN---WPERGAIKFENYSTRY--RPDLDLVLKNISLDIKP 1306

Query: 535  GSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVL 594
               V IVG +G GKS++ L L        G I++DG +I+++    LR +++++ Q+  +
Sbjct: 1307 QEKVGIVGRTGAGKSSLTLALFRIIEAAEGSIIVDGLNISEIGLYDLRHKLSIIPQDSQV 1366

Query: 595  MSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPY---------TYDTYIGPHGT 645
              GTIR+NI    T   T E+I    +       I++               T +   G 
Sbjct: 1367 FEGTIRENI--DPTNIYTDEQIWNALELSHLKQHILRMNEESVNGSENNALYTRVTEGGN 1424

Query: 646  LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
             LS GQ+Q + +ARAL+    ILILDEAT+A+DVE++  I  T     K +  TI++IAH
Sbjct: 1425 NLSVGQRQLMCLARALLVPSKILILDEATAAVDVETDSLIQETIRTAFKDR--TILTIAH 1482

Query: 706  RLSTIRRSENIIVLGNDGSVVEM 728
            RL+TI  S+ I+VL + G V E 
Sbjct: 1483 RLNTIMDSDKIVVL-DKGEVAEF 1504

 Score =  109 bits (273), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 123/495 (24%), Positives = 221/495 (44%), Gaps = 59/495 (11%)

Query: 264 LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSR--SITQK---ISDGVKSLICGG 318
           + SV+ +  L   +E  D+   GD+++ +  D   V R   +TQ    I  G   +I   
Sbjct: 382 MTSVLYQKALVLSNEASDLSSTGDVVNLMSVD---VQRLQDLTQWCNIIWSGPFQIILCL 438

Query: 319 VGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGV 378
             +  +L  SM +  +++  +IP+        KQ++    + +D   + TRV  E LN +
Sbjct: 439 FSLYKLLGHSMWVGVIVLIVMIPLNSYLMRIQKQLQKVQMKYKD---ERTRVINEILNNI 495

Query: 379 RTVQSFVAEQREIKRFNH-----SIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVY 433
           ++++ +  EQ   ++  H      ++ +  +G   A  N +F     LV   +F  V VY
Sbjct: 496 KSLKLYAWEQPYKEKLEHVRNEKELKNLTRIGVFNAMTNFQFNLVPFLVSCSTF-AVFVY 554

Query: 434 GSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFEL-------T 486
                L   L    LT F L T      +  L    +  ++ + + SRLF         T
Sbjct: 555 IEDKPLTTDLVFPALTLFNLLTF----PLAALPIVITAFIEASVSMSRLFSFMTNEELQT 610

Query: 487 DRVPTIRPTLGKTYTPGKGEIEFK---NVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVG 542
           D +  + P         +G+I      N +F +  +P  ++  K++ F+ K G   CIVG
Sbjct: 611 DAIQRLPPV------KKQGDIAVNIGDNATFLWKRKPEYKVALKNIEFQAKKGELACIVG 664

Query: 543 PSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDN 602
             G GKS     +L       G   I G              +A V Q P +M+GT++DN
Sbjct: 665 KVGSGKSAFIQSILGDLFRVKGFATIHGN-------------VAYVSQLPWIMNGTVKDN 711

Query: 603 ITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALI 662
           I +G   +  +E      + C     +   P    T +G  G  LSGGQK R+++ARA+ 
Sbjct: 712 ILFG--HKYNQEFYEKTLRACALTIDLSILPDGDQTLVGEKGISLSGGQKARLSLARAVY 769

Query: 663 KKPNILILDEATSALDVE-SEGAINYTFGQ--LMKSKSMTIVSIAHRLSTIRRSENIIVL 719
            + ++ +LD+  +A+D   S+  I +  G   L+ +K+  + +  +++S +  ++NI +L
Sbjct: 770 ARADVYLLDDPLAAVDEHVSKHLIQHVIGPNGLLHTKTRVLAT--NKISVLSIADNITLL 827

Query: 720 GNDGSVVEMGKFKEL 734
            +DG +V+ G + E+
Sbjct: 828 -DDGEIVQQGTYNEV 841

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
            YDR135C
          Length = 1535

 Score =  134 bits (338), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 135/488 (27%), Positives = 227/488 (46%), Gaps = 49/488 (10%)

Query: 264  LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSY----IVSRSITQKISDGVKSLICGGV 319
            L +V+          FF+   +G +++R   D Y    ++ R+ +Q + + VK      V
Sbjct: 1030 LHTVMTNAVFRAPMSFFETTPIGRILNRFSNDIYKVDSLLGRTFSQFLVNAVK------V 1083

Query: 320  GIGMMLELSMDLSSVLVCFVI-PVVLSASIFGKQIRINSRELQDATGQLTRVS-----EE 373
               M++   +  ++    F+I P+ +    + +     SREL+     +TR       +E
Sbjct: 1084 VFTMIV---ICWTTWQFIFIIGPLGVLYIYYQQYYLRTSRELR-RLDSITRSPIYSHFQE 1139

Query: 374  QLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAF---INAKFFTSTSL--VGDLSFL 428
             L G+ T++ +  +QR     NH   +       +AF   INA  + +  L  +G +  L
Sbjct: 1140 TLGGMSTIRGY-NQQRRFDHINHCRID----NNMSAFYPSINANRWLAFRLESIGSVIIL 1194

Query: 429  TVLVYGSYLVLHGSLTIGDL---TAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFEL 485
                   Y +  G+LT G +    ++ L    T N I  ++      +          EL
Sbjct: 1195 GAATLSIYRLGQGTLTAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYSEL 1254

Query: 486  TDRVPTI----RPTLGKTYTPGKGEIEFKNVSFAYPTRPS-NQIFKSLNFKIKPGSNVCI 540
                P +    RP     + P  G+I F + S  Y  RP  + + + +N  IKP   + I
Sbjct: 1255 KSEAPLVIEEKRPA---AHWPDSGDIRFDHYSTRY--RPELDLVLRDVNLHIKPREKIGI 1309

Query: 541  VGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIR 600
            VG +G GKS++ L L      +SG I+IDG  I ++    LR  ++++ Q+  +  GTIR
Sbjct: 1310 VGRTGAGKSSLTLALFRIVEASSGGIVIDGVRIDEIGLHDLRHNLSIIPQDSQVFQGTIR 1369

Query: 601  DNITYGLTEEPTKEEIRTVAKQCFCHNFIVKF-PYTYDTYIGPHGTLLSGGQKQRIAIAR 659
            +N+    TE  T +EI  V +    +  +    P      +   G+ LS GQ+Q + +AR
Sbjct: 1370 ENV--DPTETYTDDEIWRVLELSHLNRHVESMGPRGLLNEVNEGGSNLSVGQRQLMCLAR 1427

Query: 660  ALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVL 719
            AL+    ILILDEAT+A+DVE++  I  T     + +  TI++IAHR++TI  S+ I+VL
Sbjct: 1428 ALLVPSKILILDEATAAVDVETDQVIQETIRSAFRDR--TILTIAHRINTIMDSDRIVVL 1485

Query: 720  GNDGSVVE 727
             + G V E
Sbjct: 1486 -DGGRVTE 1492

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 112/497 (22%), Positives = 217/497 (43%), Gaps = 57/497 (11%)

Query: 264 LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVK--SLICGG--- 318
           L S++    L    E       GD+++ +  D         QK+ D  +   L+  G   
Sbjct: 380 LTSIIYNKALVLSREASATSSTGDIVNLMSVD--------VQKLQDLCQFIHLLWSGPFQ 431

Query: 319 -----VGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEE 373
                V +  +L  SM +  V++  + P+    +   K+++ +    +D   + T V  E
Sbjct: 432 VVICLVSLYKLLGPSMWIGVVILLVMTPLNTFLAKIQKRLQKSQMGFKD---ERTSVISE 488

Query: 374 QLNGVRTVQSFVAEQREIKRFNH-----SIREIFDVGKRAAFINAKFFTSTSLVGDLSFL 428
            LN +++++ +  E+   K+  H      ++ +  +G   A  + +F     LV   +F 
Sbjct: 489 ILNNIKSLKLYAWEEPYKKKLEHVRNDKELKNLTKLGCFMAITSFQFNVVPFLVSCCTF- 547

Query: 429 TVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDR 488
            V VY     L   L    LT F L +      +F +    +  ++ + + +RLF     
Sbjct: 548 AVFVYTEDRALTVDLVFPALTLFNLLS----FPLFVIPNVMTSFIEASVSVTRLFNFLTN 603

Query: 489 VPTIRPTLGKT-YTPGKGEIEFK---NVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGP 543
               + ++ +       G++  K   + +F +  +P  ++  K++NF+ K G   C+VG 
Sbjct: 604 EELQKDSVQRLPKVTNVGDVAVKVGDDATFLWRRKPEYKVALKNINFEAKKGQLTCVVGR 663

Query: 544 SGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNS-KSLRRQIAVVQQEPVLMSGTIRDN 602
            G GKS +   L       SG       D+ ++    ++   +A V Q   +M+GT+++N
Sbjct: 664 VGSGKSALIQSL-------SG-------DLFRVKGFATVHGSVAYVSQVAWIMNGTVKEN 709

Query: 603 ITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALI 662
           I +G   +P  E      K C     +       +T +G  G  LSGGQK R+++ARA+ 
Sbjct: 710 ILFGHRYDP--EFYDKTIKACALTIDLAVLVDGDETLVGEKGISLSGGQKARLSLARAVY 767

Query: 663 KKPNILILDEATSALDVESEGA--INYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLG 720
            + +  +LD+  +A+D E  G   + +  G     ++ T +   +++S +  ++ I +L 
Sbjct: 768 ARADTYLLDDPLAAVD-EHVGKHLLEHVLGPTGLLRTKTKILATNKISVLSIADRIALLE 826

Query: 721 NDGSVVEMGKFKELFAD 737
           N G +VE G + E+ AD
Sbjct: 827 N-GEIVEQGSYDEVTAD 842

>NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON}
            Anc_4.6
          Length = 1682

 Score =  134 bits (338), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 143/507 (28%), Positives = 223/507 (43%), Gaps = 83/507 (16%)

Query: 271  HT-LHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLI-CGGVGIGMMLELS 328
            HT LH    FFD   +G +++R   D   V + +T  +      L+ C    +  ML   
Sbjct: 1166 HTVLHSKLRFFDATPIGRIMNRFSKDIEAVDQELTPYLEAAFYCLVEC----VSTML--- 1218

Query: 329  MDLSSVLVCFVIPVVLSASIF--------GKQIRINSRELQD----ATGQLTRVSEEQLN 376
                  L+ F+ P  L  +IF        G      SREL+         + +   E L 
Sbjct: 1219 ------LIAFITPQFLILAIFIGFLYYLVGYFYMAASRELKRFESVTKSPIYQHFSETLV 1272

Query: 377  GVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSF-------LT 429
            G+ T++++  E+R +    H I E           N  FF   +    LSF       L 
Sbjct: 1273 GIVTIRAYGDEKRFMLENLHKIDEN----------NKPFFYLWAFNRWLSFRIDMIGSLV 1322

Query: 430  VLVYGSYLVLH-----GSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFE 484
            V   G +++L+       L    LT  + +TE    A   L  FY+++     +  RL E
Sbjct: 1323 VFGAGVFIILNIDNLDSGLAGISLTYAISFTE----AALWLVRFYADVEMNMNSVERLKE 1378

Query: 485  LT--DRVPTIR-----PTLGKTYTPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGS 536
                D+ P          L     P  G+IE  N+S  Y P  P  ++ K++ F ++P  
Sbjct: 1379 YMEIDQEPYEEHLERSEVLAVDNWPRNGKIEVNNLSLRYAPNLP--KVIKNVTFVVEPNC 1436

Query: 537  NVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMS 596
             V +VG +G GKSTI   L  + +  +G I ID  DIT +N   LRR I ++ Q+P L S
Sbjct: 1437 KVGVVGRTGAGKSTIITALFRFLDAETGYIKIDDIDITTVNLTKLRRSITIIPQDPTLFS 1496

Query: 597  GTIRDNIT-YG-LTEEPTKEEIRTV--------------AKQCFCHNFIVKFPYTYDTYI 640
            GTIR N+  Y   +++   + +R V                       + KF       I
Sbjct: 1497 GTIRSNLDPYNEFSDDAIFKALRRVNLINENESTGPASSETSPSSTENVNKF-LNLKNEI 1555

Query: 641  GPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTI 700
               G  LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + K  TI
Sbjct: 1556 TEGGNNLSHGQRQLVCLARSLLRCPKIILLDEATASIDNASDAKIQETIRK--EFKESTI 1613

Query: 701  VSIAHRLSTIRRSENIIVLGNDGSVVE 727
            ++IAHRL ++   + I+V+ + G V E
Sbjct: 1614 LTIAHRLRSVCDYDKILVM-DAGEVKE 1639

 Score =  108 bits (270), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 118/467 (25%), Positives = 212/467 (45%), Gaps = 46/467 (9%)

Query: 285 VGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLEL---SMDLSSVLVCFVIP 341
           +G +I+ +  D++ VS  I   +   V++L+   V + ++  L   +  +   LV   +P
Sbjct: 512 LGAIINLMAVDAFKVSE-ICGYLHFFVEALLMVVVALALLYHLLGYAALVGGALVVAFLP 570

Query: 342 VVLS-ASIFG----KQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQ---REIKR 393
           + L  A++ G    K + +  + +Q           E    +R ++ F  E    R+I+ 
Sbjct: 571 LNLKLATLLGEYQKKSLAVTDKRIQKLN--------ETFQAIRIIKYFSWEDNFTRDIET 622

Query: 394 FNHSIREIFDVGKRA---AFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTA 450
                +E+  + KR+   AF +  +F + S+V   SF        Y+ + G  T+    A
Sbjct: 623 VRE--KELHLLFKRSLIWAFSSFIWFITPSIVTSCSF------AFYIYVQGE-TLTTPVA 673

Query: 451 FMLYTEYT--GNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIE 508
           F   + +T     +  LS   S ++Q   +  R+ +L     T + +   T       I 
Sbjct: 674 FTALSLFTLLKTPLDQLSNMISFVIQSKVSLDRIQDLLQEKETEKYS-QLTIDKNGNRIA 732

Query: 509 FKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI 568
           F+N + A+  + S    + LN   KPG    ++GP+G GKS++ L LL   +  +G I++
Sbjct: 733 FQNATVAWDKKNSEFKLRDLNIDFKPGKLNVVIGPTGSGKSSLLLALLGEMHLENGNIIV 792

Query: 569 ---DGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFC 625
              D +D   ++   +   IA   Q   L++ T+R+NI +     P  E       +  C
Sbjct: 793 PSLDPRDELVIDHDGMTNSIAYCSQGAWLLNDTVRNNILFN---SPYNEARYNAVVEACC 849

Query: 626 HNFIVKFPYTYD-TYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGA 684
                +     D T IG  G  LSGGQKQR+++ARAL      ++LD+  SA+D  +   
Sbjct: 850 LKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARALYSNSRHVLLDDCLSAVDSHTALW 909

Query: 685 I--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMG 729
           I  N   G LM++++  +VS  H ++   R+  ++V+  DG V + G
Sbjct: 910 IYDNCITGPLMENRTCILVS--HNIALTLRNAELVVILEDGRVKDQG 954

>Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL015W
            (BPT1) - ABC-type transmembrane transporter; highly
            homologous to human MRP1 and to C. elegans mrp-1 [contig
            184] FULL
          Length = 1538

 Score =  134 bits (336), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 128/481 (26%), Positives = 224/481 (46%), Gaps = 37/481 (7%)

Query: 279  FFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLI---CGGVGIGMMLELSMDLSSVL 335
            FF+   VG +I+R  +D   +  S+   +S  + S++      + IG  + L + +++VL
Sbjct: 1056 FFETTPVGRIINRFSSDMNSLDDSVQYVMSFFLVSILDYLVVVIIIGYQVPLFLIVNAVL 1115

Query: 336  VCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFN 395
            +       +      ++++   R +  +   +  +  E L G   + +F    R   RF+
Sbjct: 1116 LVIYFYYQVYYVTLSRELK---RLMSTSFSPIMSMLSETLAGHMIIDAF----RHSDRFD 1168

Query: 396  H-SIREI-FDVGKRAAFINAKFFTSTSL--VGDLSFLTVLVYGSYLVLHG--SLTIGDLT 449
            + ++  + F++     F +   + S  L  +G L  LT  +  S    +G  +L+ G + 
Sbjct: 1169 YLNVENVQFNINCLFNFRSTNRWLSIRLESIGALMILTTALL-SLATKNGGHALSTGMVG 1227

Query: 450  AFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTY----TPGKG 505
              M Y     N +  +     ++     +  R+ E  D  P   P +  +      P +G
Sbjct: 1228 LLMSYALQVTNKLMWIVRMSVQLETNIVSVERIVEYCDLPPEAPPVIEDSRPPKNWPSQG 1287

Query: 506  EIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQ 565
             I FKN S  Y     + + + L+ +IKP   + IVG +G GKST++L L     P+ G 
Sbjct: 1288 LIRFKNYSTRYRAN-LDPVLRHLDLEIKPQEKIGIVGRTGAGKSTLSLALFRILEPSEGT 1346

Query: 566  ILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFC 625
            I IDG DI+K+  K LR  ++++ Q+     GT+R N+     E+ + EEI    +    
Sbjct: 1347 IDIDGVDISKIGLKDLRSNLSIIPQDAQAFEGTVRTNL--DPFEQYSDEEIWKALELSHL 1404

Query: 626  HNFIVKFPYT----------YDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATS 675
               I+K                T I  +G+ LS GQ+Q + ++RAL+ +  IL+LDEAT+
Sbjct: 1405 KPHILKMAKDDADPEKKEDLLQTKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATA 1464

Query: 676  ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELF 735
            A+D E++  I  T     K +  TI++IAHR+ T+  S+ I+VL + G V E      L 
Sbjct: 1465 AVDSETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-DKGEVKEFDSPSNLL 1521

Query: 736  A 736
            A
Sbjct: 1522 A 1522

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 92/393 (23%), Positives = 175/393 (44%), Gaps = 46/393 (11%)

Query: 373 EQLNGVRTVQSFVAEQREIKRFNHSIR---EIFDVGKRAAFINAKFFTSTSLVGDLSFLT 429
           E LN V+TV+ +  E+  +KR +H +R   E+ +  K +   N   F    +   ++  T
Sbjct: 472 ELLNSVKTVKLYAWEEPMLKRLDH-VRNDLELQNFKKISIITNLILFAWNCVPILVASST 530

Query: 430 VLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRV 489
            L+Y   L +   LT   +   +   +   + I+ +    +  ++   +  RL +     
Sbjct: 531 FLIYA--LTMDVPLTPQIVFPSLSLFDILNDCIYTIPRTITNFIETGVSLGRLKDFLLAK 588

Query: 490 PTIRPTLGKTYTPGKGE---IEFKNVSF------------AYPTRP---SNQI-FKSLN- 529
              +  +     P  G+   IE  N +F            +Y       S+Q+  K+++ 
Sbjct: 589 EIDKSFIEFESLPSDGKVPVIEVHNATFLRKIPNDSTDDESYDEEAAVESSQVALKNIDG 648

Query: 530 FKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRR--QIAV 587
           F++  G  VC+VG  G GKST    LL       GQ+       +  +     R   +A+
Sbjct: 649 FQVFKGQLVCVVGRVGAGKSTFLQALL-------GQLPCISNSPSHASPTVHFRANSVAL 701

Query: 588 VQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLL 647
             Q+  +M+ +++DN+ +G      +   +   + C     +       +T +G  G  L
Sbjct: 702 CSQQSWIMNASVKDNVLFG--HRFDEATYKATLEACQLVPDLEILADGDETLVGEKGISL 759

Query: 648 SGGQKQRIAIARALIKKPNILILDEATSALDVES-----EGAINYTFGQLMKSKSMTIVS 702
           SGGQK R+++ARA+  + ++ +LD+  SA+D E      E  ++   G L+K+K  T++ 
Sbjct: 760 SGGQKARLSLARAVYSRSDVYLLDDILSAVDAEVCKRIIEQVLSKKTG-LLKNK--TVIL 816

Query: 703 IAHRLSTIRRSENIIVLGNDGSVVEMGKFKELF 735
             + +S ++ S++I  L  DG +VE G F ++ 
Sbjct: 817 TTNSISVLKHSQSIYAL-EDGEIVESGSFNDIM 848

>KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1500

 Score =  133 bits (335), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 131/490 (26%), Positives = 223/490 (45%), Gaps = 61/490 (12%)

Query: 279  FFDVHKVGDLISRLGADSY----IVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSV 334
            FF+   +G +++R   D +    ++ R+  Q   + +K                +  + +
Sbjct: 1026 FFETTPIGRILNRFSNDIFKVDELLGRTFAQFFVNAIK----------------VSFTII 1069

Query: 335  LVCF--------VIPVVLSASIFGKQIRINSRELQDATGQLTRVS-----EEQLNGVRTV 381
            ++CF        ++P+      + +     SREL+     +TR       +E L G+ T+
Sbjct: 1070 VICFSTWQFILVILPMGTLYIYYQQYYLRTSRELRR-LDSVTRSPIYAHFQETLGGISTI 1128

Query: 382  QSFVAEQREIKRFNHSIREIFDVGKRAAF--INAKFFTSTSL--VGDLSFLTVLVYGSYL 437
            + +     + KRF H  +   D    A +  +NA  + +  L  +G +  L         
Sbjct: 1129 RGY----NQQKRFVHINQARVDNNMSAYYPSVNANRWLAFRLEFIGSVIILAASSLSVLR 1184

Query: 438  VLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFE---LTDRVPTI-- 492
            +  G+LT G +   + Y      ++  +     E+     +  R+ E   L    P +  
Sbjct: 1185 LKQGALTPGMIGLSVSYALQITQSLNWIVRMTVEVETNIVSVERIKEYANLESEAPAVIE 1244

Query: 493  --RPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGPSGKGKS 549
              RP+      P +G I+F+N S  Y  RP  ++  K +N  IKP   + IVG +G GKS
Sbjct: 1245 SNRPS---EDWPSQGSIKFENYSARY--RPELELSLKDINLDIKPQERIGIVGRTGAGKS 1299

Query: 550  TIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTE 609
            ++ L L       SG+I IDG  I  +  + LR  ++++ Q+  L  GTIR+NI    T 
Sbjct: 1300 SLTLALFRIIEAASGRIYIDGLPIDSIGLRDLRHHLSIIPQDSQLFEGTIRENI--DPTN 1357

Query: 610  EPTKEEIRTVAKQCFCHNFIVKF-PYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNIL 668
            E T E+I    +     + +        D  +   G+ LS GQ+Q + +ARAL+    IL
Sbjct: 1358 EYTDEQIWRALELSHLKDHVKGLGKEELDAPLTEGGSNLSVGQRQLMCLARALLIPSKIL 1417

Query: 669  ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEM 728
            +LDEAT+A+DVE++  I  T     K++  TI++IAHR++TI  S+ I+VL + G V E 
Sbjct: 1418 VLDEATAAVDVETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKVAEF 1474

Query: 729  GKFKELFADP 738
                 L  +P
Sbjct: 1475 DTPDNLLKNP 1484

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 116/501 (23%), Positives = 228/501 (45%), Gaps = 71/501 (14%)

Query: 264 LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQK---ISDGVKSLICGGVG 320
           L SV+ +  L   +E       GD+++ +  D   + + +TQ    I  G   LI   V 
Sbjct: 371 LTSVIYQKALVLSNEASSASSTGDIVNLMSVDVQRI-QDLTQWGQIIWSGPFQLILCLVS 429

Query: 321 IGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRT 380
           +  +L  SM +  +++   IP   ++ I   Q ++   +++   G+ TR+  E LN +++
Sbjct: 430 LYKLLGNSMWIGVIIMVITIPA--NSLIMRYQKKLQKVQMKYKDGR-TRLISEILNNIKS 486

Query: 381 VQSFVAEQREIKRFNH--SIREIFDVGKRAAFINA---------KFFTSTSLVG------ 423
           ++ +  E+   K+ ++  + +E+ ++ +R    NA          F  S S  G      
Sbjct: 487 LKLYAWEEPYRKKLDYVRNEKELKNL-RRMGITNACASFQFNVIPFLVSCSTFGVFIWTQ 545

Query: 424 DLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLF 483
           D    T LV+ +       LT+ +L AF L           + T  +  ++ + + +RL 
Sbjct: 546 DAPLTTDLVFPA-------LTLFNLLAFPLAV---------IPTAITAFVEASVSITRLQ 589

Query: 484 ELTDRVPTIRPTLG-KTYTPGKGEIEFK---NVSFAYPTRPSNQI-FKSLNFKIKPGSNV 538
                    R ++  K+    KGE+      + +F +  +P  ++  K++NF  K G   
Sbjct: 590 SFLTNEELQRDSVQRKSKVTKKGEVAVNVGADATFLWQRKPEYKVALKNINFAAKKGKLT 649

Query: 539 CIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNS-KSLRRQIAVVQQEPVLMSG 597
           C+VG  G GKS +   +L               D+ ++    S+   IA V Q P +M+G
Sbjct: 650 CVVGKVGSGKSALIQAILG--------------DLFRVKGFASVHGSIAYVSQVPWIMNG 695

Query: 598 TIRDNITYGLTEEPTKEEIRTVA-KQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIA 656
           T++DNI +G       E   T+  K C     +   P    T +G  G  LSGGQK R++
Sbjct: 696 TVKDNILFG---HKYDESFYTMTLKACALIVDLAVLPKGDQTLVGEKGISLSGGQKARLS 752

Query: 657 IARALIKKPNILILDEATSALDVE-SEGAINYTFGQ--LMKSKSMTIVSIAHRLSTIRRS 713
           +ARA+  + +  +LD+  +A+D   ++  + +  G   L+ SK+  + +  ++++ +  +
Sbjct: 753 LARAVYARADTYLLDDPLAAVDEHVTKHLVEHVLGPNGLLASKTKVLAT--NKITVLSIA 810

Query: 714 ENIIVLGNDGSVVEMGKFKEL 734
           ++I +L N G +++ G + ++
Sbjct: 811 DHIALLEN-GEIIQQGSYDDV 830

>AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR135C (YCF1)
          Length = 1492

 Score =  133 bits (334), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 128/495 (25%), Positives = 223/495 (45%), Gaps = 61/495 (12%)

Query: 264  LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSY----IVSRSITQKISDGVKSLICGGV 319
            L   ++   L     FF+   +G +++R   D Y    +++R+ +Q  ++  +       
Sbjct: 1003 LHESMLAAVLRAPMSFFETTPIGRILNRFSNDIYKVDELLARTFSQFFANTTR------- 1055

Query: 320  GIGMMLELSMDLSSVLVC--------FVIPVVLSASIFGKQIRINSRELQDATGQLTRVS 371
                     +  + +++C        FVIP+ +    + +     SREL+    +L  V+
Sbjct: 1056 ---------VSFTIIVICVTTWQFTFFVIPLAMLYIYYQQYYLKTSRELR----RLDSVT 1102

Query: 372  --------EEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAF----INAKFFTST 419
                    +E LNGV +++ +     ++ RF H  +   +    A +    +N       
Sbjct: 1103 KSPVYAHFQETLNGVSSIRGY----GQLDRFIHINQARINNNTSAYYPSMNVNRWLAYRL 1158

Query: 420  SLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAA 479
              +G            + +  GSLT G +   + Y      ++  +     E+     + 
Sbjct: 1159 EFIGSCIIFFAATLSVFRLASGSLTSGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSV 1218

Query: 480  SRLFELTDRVPT----IRPTLGKTYTPGKGEIEFKNVSFAYPTRPS-NQIFKSLNFKIKP 534
             R+ E  +  P     I  ++     P  GEI+F+N S  Y  RP  + I + +N  IKP
Sbjct: 1219 ERIKEYAELEPEAPQFIANSVPSGDWPKDGEIKFENYSTRY--RPGLDLILRGINLHIKP 1276

Query: 535  GSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVL 594
               V IVG +G GKS++AL L        G I IDG  I  +    LR++++++ Q+  +
Sbjct: 1277 HERVGIVGRTGAGKSSLALSLFRIIEAAEGHISIDGVPIDTIGLTDLRKKLSIIPQDSQV 1336

Query: 595  MSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYT-YDTYIGPHGTLLSGGQKQ 653
              GT+RDNI    T++ T E+I    +     + +        DT +   G  LS GQ+Q
Sbjct: 1337 FEGTVRDNI--DPTKQYTDEQIWKALELSHLADHVKGMGSDGLDTPLTEGGKNLSVGQRQ 1394

Query: 654  RIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRS 713
             + +ARAL+    IL+LDEAT+A+DVE++  I  T       +  TI++IAHR++TI  S
Sbjct: 1395 LMCLARALLIPFRILVLDEATAAIDVETDKVIQDTIRSSFNDR--TILTIAHRINTIMDS 1452

Query: 714  ENIIVLGNDGSVVEM 728
            + I+VL + G+V E 
Sbjct: 1453 DKIVVL-DKGTVAEF 1466

 Score =  107 bits (267), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 116/492 (23%), Positives = 223/492 (45%), Gaps = 50/492 (10%)

Query: 266 SVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQK---ISDGVKSLICGGVGIG 322
           S++ K  LH  +E       GD+++ +  D+  + R +TQ    I  G   L      + 
Sbjct: 364 SLIYKKALHLSNEASGTSATGDIVNLMSVDAQRL-RDLTQWGNVIWSGPFQLCLCLYSLH 422

Query: 323 MMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQ 382
            +L   + +  VL+ F +P+    S   + ++   +E      + TR+  E LN +++++
Sbjct: 423 RLLGPCIWVGVVLLLFTLPL---NSYISRVLKRLQKEQMKNKDERTRLISEILNNIKSLK 479

Query: 383 SFVAE-----QREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYL 437
            +  E     + +  R    ++ +  +G   AF N ++     LV   +F   ++     
Sbjct: 480 LYAWEIPYKEKLDYVRNQKELKTLRKMGLTTAFANFQYNIIPFLVSCSTFAVFVLTQKGR 539

Query: 438 VLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLF------ELTDRVPT 491
            L   L    LT F L +         +++F    ++ + A  RL       EL     T
Sbjct: 540 PLTTDLVFPALTLFNLLSFPLAVLPIAITSF----IEASVAIGRLTNFLTAEELQRDAIT 595

Query: 492 IRPTLGKTYTPGKGEIEFK-NVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGPSGKGKS 549
             P +     PG   +    N +F +  +P  ++  K++NF+ K     CI+G  G GKS
Sbjct: 596 REPAVK---APGGVAVALADNATFLWQRKPEYKVALKNINFRAKKSELTCIIGKVGSGKS 652

Query: 550 TIALLLLHYYNPTSGQILIDGQDITKLN-SKSLRRQIAVVQQEPVLMSGTIRDNITYGLT 608
            +   +L               D+ ++N S  +R  +A V Q   +M+GT+RDNI +G  
Sbjct: 653 ALIQAML--------------GDLFRVNGSAVVRGNVAYVSQVAWIMNGTVRDNILFG-- 696

Query: 609 EEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNIL 668
            +   +  +   K C     +   P   +T++G  G  LSGGQK R+++ARA+  + +  
Sbjct: 697 HKYDAKFYQQTIKACALTVDLSILPDGDNTFVGEKGISLSGGQKARLSLARAVYARADTY 756

Query: 669 ILDEATSALDVE-SEGAINYTFGQ--LMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSV 725
           +LD+  +A+D   ++  +   FG   L+KSK+  + +  ++++ +  +++I++L N G +
Sbjct: 757 LLDDPLAAVDEHVAKHLLQNVFGPNGLLKSKARVLTT--NKITALEIADHIVLLEN-GEI 813

Query: 726 VEMGKFKELFAD 737
           V+ G F E+ +D
Sbjct: 814 VQQGTFSEVISD 825

>NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {ON} 
          Length = 1654

 Score =  132 bits (333), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 131/499 (26%), Positives = 228/499 (45%), Gaps = 69/499 (13%)

Query: 268  VMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLEL 327
            ++K  +H    FFD   +G +++R   D   + + +   +     SL+     I      
Sbjct: 1145 LLKKVMHSKLRFFDSTPIGRIMNRFSKDIEAIDQELAPVVQGAFYSLVSCVTTI------ 1198

Query: 328  SMDLSSVLVCFVIPVVLSASIF--------GKQIRINSRELQ--DATGQ--LTRVSEEQL 375
                  +L+ F+ P  LS +I         G      SRE +  D+  +  + +   E L
Sbjct: 1199 ------LLITFITPQFLSVAILVTGLYYLIGYFYLAASREFKRFDSITKSPIYQHFSETL 1252

Query: 376  NGVRTVQSFVAE----QREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVL 431
             GV T+++F  E    Q  + + + + R  F +     +++ +      +VG L    V 
Sbjct: 1253 VGVTTIRAFGDEGRFMQENLSKIDENNRPFFYLWVANRWLSFRI----DMVGAL---VVF 1305

Query: 432  VYGSYLVLH-GSLTIGDLTAFMLYT-EYTGNAIFGLSTFYSEIMQGAGAASRLFELT--- 486
              GS+++ +  ++  G     + Y   +T  A++ L   YS +     +  RL E     
Sbjct: 1306 GSGSFIIWNIKNIDAGMAGISLTYAISFTEGALW-LVRLYSNVEMNMNSVERLKEYMKIE 1364

Query: 487  -----DRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIV 541
                 D   T  P       P +G+IE  ++S  Y      ++ K++ F + P + + IV
Sbjct: 1365 QEPYEDATCTPPPEW-----PQEGKIEVCDLSLRY-AEGLPRVIKNVTFTVAPKAKIGIV 1418

Query: 542  GPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRD 601
            G +G GKSTI   L  + +P +G I ID  DIT +N   LRR I ++ Q+P L +GTI+ 
Sbjct: 1419 GRTGAGKSTIITALFRFLDPETGYIKIDNIDITSINLNKLRRSINIIPQDPTLFTGTIKS 1478

Query: 602  NIT-YG-LTEEPTKEEIRTV-----------AKQCFCHNFIVKFPYTYDTYIGPHGTLLS 648
            N+  YG  ++E     +R V             +      + KF    +  I   G+ LS
Sbjct: 1479 NLDPYGEYSDEDMFTALRRVNLVPEDVSSNIETESISSQNVNKF-LNLNNEISEGGSNLS 1537

Query: 649  GGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLS 708
             GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  +  S TI++IAHRL 
Sbjct: 1538 QGQRQLVCLARSLLRSPKIMLLDEATASIDYNSDAKIQETIRK--EFNSSTILTIAHRLR 1595

Query: 709  TIRRSENIIVLGNDGSVVE 727
            ++   + I+V+ + G V E
Sbjct: 1596 SVIDYDKILVM-DAGEVKE 1613

 Score =  102 bits (253), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 114/473 (24%), Positives = 211/473 (44%), Gaps = 46/473 (9%)

Query: 285 VGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLEL---SMDLSSVLVCFVIP 341
           +G +I+ +  D++ VS  +   +   V++ +   + + ++  L   S  + ++++    P
Sbjct: 490 LGGIINLMAVDAFKVSE-VCAYLFAFVEATVMAIISLTLLYRLIGSSAIIGTIVILIAAP 548

Query: 342 V-VLSASIFGKQIRINSRELQDATGQLT--RVSE--EQLNGVRTVQSFVAEQREIKRFNH 396
                A++ GK        +Q AT  +T  R+ +  E L  +R ++ F  E      F  
Sbjct: 549 ANYYFATLLGK--------IQKATLLVTDKRIQKLNESLQAIRIIKFFSWEDN----FEK 596

Query: 397 SIREIFD------VGKRAAFINAKF--FTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDL 448
           SI ++ +      + +  A++ + F  F + SLV   +F    +Y    VL   +    L
Sbjct: 597 SINDVREQELQLLLKRSMAWVCSSFVWFVTPSLVTAAAF-AFYIYVQKEVLTTPIAFTAL 655

Query: 449 TAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIE 508
           + F L      N +  LS   S ++Q   +  R+ +      T +     T  P   ++E
Sbjct: 656 SLFTLLR----NPLDQLSDMLSFVIQSKVSLDRIRDFLLETDTAKYD-QLTVAPQGDQLE 710

Query: 509 FKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI 568
           FKN + ++ +   +   K LN   K G    ++GP+G GK+++ + LL       G+I++
Sbjct: 711 FKNTTVSWDSSAQDFKLKDLNIDFKIGKLNVVIGPTGSGKTSLLMALLGEMKIMEGEIIV 770

Query: 569 ---DGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRT-VAKQCF 624
              D ++   ++       IA   Q   L++ T+R+NI +     P  E   T V + C 
Sbjct: 771 PSLDPREDLVVDENGTTNSIAYCSQAAWLLNDTVRNNILFN---SPYNEARYTSVIEACG 827

Query: 625 CHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGA 684
                        T IG  G  LSGGQKQR+++ARA+      ++LD+  SA+D  +   
Sbjct: 828 LKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARAMYSNSRHILLDDCLSAVDSHTALW 887

Query: 685 I--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELF 735
           I  N   G LM  ++  +VS  H ++   ++ +++V+  DG V + G   EL 
Sbjct: 888 IYDNCITGPLMDGRTCILVS--HNIALTLKNADLVVILEDGKVKDQGDPMELL 938

>KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa]
            {ON} similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1516

 Score =  132 bits (332), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 139/494 (28%), Positives = 220/494 (44%), Gaps = 61/494 (12%)

Query: 264  LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSY----IVSRSITQKISDGVKSLICGGV 319
            L   +    L     FF+   +G +++R   D Y    I+ R+  Q  ++ VK       
Sbjct: 1028 LHDAMASSVLKAPMSFFETTPIGRILNRFSNDIYKVDEILGRTFAQFFANVVK------- 1080

Query: 320  GIGMMLELSMDLSSVLVCF--------VIPVVLSASIFGKQIRINSRELQDATGQLTRVS 371
                     +  + V++C         V+P+ +    + +     SREL+     +TR  
Sbjct: 1081 ---------VSFTIVVICMATWQFIFIVLPLSVLYIYYQQYYLRTSRELRR-LDSVTRSP 1130

Query: 372  -----EEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAF--INAKFFTSTSL--V 422
                 +E L G+ T++ +  + R    F H  +   D    A +  +NA  + +  L  +
Sbjct: 1131 IYAHFQETLGGLTTIRGYSQQNR----FVHINQTRVDNNMSAFYPSVNANRWLAFRLEFI 1186

Query: 423  GDLSFLTVLVYGSYLVLHGSLT---IGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAA 479
            G +  L   +     + +G+LT   IG   +F L    + N I  ++      +      
Sbjct: 1187 GSVIILAASMLAVIRLGNGTLTAGMIGLSLSFALQITQSLNWIVRMTVEVETNIVSVERI 1246

Query: 480  SRLFELTDRVPTI----RPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQ-IFKSLNFKIKP 534
                EL    P I    RP       P  GEI+F N S  Y  RP  + I K ++  I P
Sbjct: 1247 KEYAELKSEAPYIIKDHRPPAS---WPESGEIKFVNYSTRY--RPELELILKDIDLHIHP 1301

Query: 535  GSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVL 594
               + IVG +G GKS++ L L       SG I+IDG  I  +    LR  ++++ Q+  +
Sbjct: 1302 KEKIGIVGRTGAGKSSLTLALFRIIEAASGHIVIDGIPIDSIGLADLRHGLSIIPQDSQI 1361

Query: 595  MSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYT-YDTYIGPHGTLLSGGQKQ 653
              GT+R+NI    T   T EEI          + I+       +T +   G+ LS GQ+Q
Sbjct: 1362 FEGTVRENI--DPTNRYTDEEIWNALALSHLKDHILGMGSNGLETMLTEGGSNLSVGQRQ 1419

Query: 654  RIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRS 713
             + +ARAL+   NILILDEAT+A+DVE++  I  T     K +  TI++IAHR++TI  S
Sbjct: 1420 LMCLARALLISSNILILDEATAAVDVETDQLIQKTIRNAFKER--TILTIAHRINTIMDS 1477

Query: 714  ENIIVLGNDGSVVE 727
            + IIVL + G V E
Sbjct: 1478 DRIIVL-DKGRVTE 1490

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 97/383 (25%), Positives = 171/383 (44%), Gaps = 43/383 (11%)

Query: 368 TRVSEEQLNGVRTVQSFVAEQREIKRFNH-----SIREIFDVGKRAAFINAKFFTSTSLV 422
           TRV+ E LN +++++ +  E     + +H      ++ +  +G   A  N +F     LV
Sbjct: 482 TRVTSEILNNIKSLKVYGWEIPYKAKLDHVRNEKELKNLKKMGCTLALANFQFNIVPFLV 541

Query: 423 GDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYT---EYTGNAIFGLSTFYSEIMQGAGAA 479
              +F  V VY     L   L    LT F L +       NAI       S  ++ + + 
Sbjct: 542 SCSTF-AVFVYTEERPLSTDLVFPALTLFNLLSFPLAVVPNAI-------SSFIEASVSI 593

Query: 480 SRLF------ELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQI-FKSLNFKI 532
           +RLF      EL +      P   K    G   ++  + +F +  +P  ++  K++NF  
Sbjct: 594 NRLFAFLTNEELQNDAVLREP---KVKNIGDEGVKVNDATFLWQRKPEYKVALKNINFVA 650

Query: 533 KPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEP 592
           K G   CIVG  G GKS +   LL             G  I      ++   +A V Q P
Sbjct: 651 KKGELTCIVGKVGSGKSALIQSLL-------------GDLIRVKGFATVHGDVANVSQVP 697

Query: 593 VLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQK 652
            +M+GT++DNI +G   +P  E  +   K C     +   P    T +G  G  LSGGQK
Sbjct: 698 WIMNGTVKDNILFGHKYDP--EFYQLTIKACALSIDLSMLPDGDQTLVGEKGISLSGGQK 755

Query: 653 QRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSIAHRLSTIR 711
            R+++ARA+  + +  +LD+  +A+D   ++  I +  G      S T V   ++++ + 
Sbjct: 756 ARLSLARAVYSRADTYLLDDPLAAVDEHVAKHLIEHVLGPHGLLHSKTKVLATNKITVLS 815

Query: 712 RSENIIVLGNDGSVVEMGKFKEL 734
            +++I ++ N G +++ G + ++
Sbjct: 816 IADSITLMEN-GEIIQQGSYDQV 837

>TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1514

 Score =  132 bits (331), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 133/488 (27%), Positives = 232/488 (47%), Gaps = 49/488 (10%)

Query: 264  LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGM 323
            L S++    L     FF+   +G +++R   D Y V   + +  +    ++      I +
Sbjct: 1027 LHSIMAASVLRAPMVFFETTPIGRILNRFSNDIYKVDELLGRTFAQFFVNVTKVSFTIIV 1086

Query: 324  MLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVS--------EEQL 375
            +   +       +  ++P+++    + +     SREL+    +L  V+        +E L
Sbjct: 1087 ICVTTWQF----IFLILPMIVLYVYYQQYYLRTSRELR----RLDSVTKSPVYAHFQESL 1138

Query: 376  NGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAF--INAKFFTSTSLVGDLSFL-TVLV 432
             G+ T++ +  +Q++  RF H  +   D    A +  +NA  +    L   L F+ T+++
Sbjct: 1139 GGLSTIRGY--DQQD--RFTHINQSRIDNNMSAFYPSVNANRW----LAFRLEFIGTIII 1190

Query: 433  YG----SYLVLH-GSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTD 487
            +G    S L L  GSLT G +   + Y      ++  +     E+     +  R+ E ++
Sbjct: 1191 FGAASLSMLRLKAGSLTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSE 1250

Query: 488  ---RVPTI----RPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCI 540
                 P +    RP       P KG+I+F++ S  Y     N + K +N  +KP   + I
Sbjct: 1251 IKSEAPLVIEDHRPPAD---WPSKGDIKFEHYSTRY-RENMNLVLKDINLHVKPQEKIGI 1306

Query: 541  VGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIR 600
            VG +G GKS++ L L        G+I+IDG  I ++    LR +++++ Q+  +  GT+R
Sbjct: 1307 VGRTGAGKSSLTLALFRIIEAAEGRIVIDGVPINEIGLHDLRHKLSIIPQDSQVFEGTVR 1366

Query: 601  DNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYT-YDTYIGPHGTLLSGGQKQRIAIAR 659
            +NI    T + + EEI  V +     N ++        T +   G  LS GQ+Q + +AR
Sbjct: 1367 ENI--DPTNQYSDEEIWRVLELSHLKNHVLSMSKDGLMTRLTEGGANLSVGQRQLMCLAR 1424

Query: 660  ALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVL 719
            AL+    ILILDEAT+A+DVE++  I  T     K +  TI++IAHRL+TI  S+ I+VL
Sbjct: 1425 ALLIPSRILILDEATAAVDVETDQVIQETIRTAFKDR--TILTIAHRLNTIMDSDRILVL 1482

Query: 720  GNDGSVVE 727
             + G V E
Sbjct: 1483 -DAGEVRE 1489

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 113/499 (22%), Positives = 217/499 (43%), Gaps = 61/499 (12%)

Query: 264 LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSR--SITQK---ISDGVKSLICGG 318
           L S + K  L   +E  D+   GD+++ +  D   V R   +TQ    I  G   ++   
Sbjct: 386 LTSTIYKKALVLSNEAADMSSTGDIVNLMSVD---VQRLQDLTQYCHLIWSGPFQILLCL 442

Query: 319 VGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGV 378
           V +  +L  SM +  +++  ++P  L++ +   Q ++   ++++   + +R+  E LN +
Sbjct: 443 VSLYKLLGRSMWIGVIILVIMMP--LNSMLMRIQKKLQKVQMKNK-DERSRLISEILNNI 499

Query: 379 RTVQSFVAEQREIKRFNH-----SIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVY 433
           ++++ +  E     +  H      ++ +  +G   A  + +F     LV   +F  V VY
Sbjct: 500 KSLKLYSWEAPYKAKLEHVRNDKELKNLTKMGVYMALTSFQFNIVPFLVSCSTF-AVFVY 558

Query: 434 GSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIR 493
                L   L    L  F L +         L+ F    ++ + + +RL+         +
Sbjct: 559 TEKKPLTTDLVFPALALFNLLSFPLNVVPMVLTAF----IEASVSVNRLYSFLTNEELQK 614

Query: 494 PTLGKTYTPGK-GEIEFK---NVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGPSGKGK 548
             +       K G++  K   + +F +  +P  Q+  K++N ++K G   C+VG  G GK
Sbjct: 615 DAVHHLPKAQKAGDVAIKISDDANFLWKRKPQYQVALKNINLEVKKGELACVVGKVGSGK 674

Query: 549 STIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLT 608
           S +   LL       G   + G               A V Q P +M+GT++DNI +G  
Sbjct: 675 SALVQSLLGDLYRVKGYAAVHGST-------------AYVSQVPWIMNGTVKDNILFGHK 721

Query: 609 EEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNIL 668
            +P   ++    K C     +   P    T +G  G  LSGGQK R+++ARA   + +  
Sbjct: 722 YDPVFYDL--TIKACALTIDLGILPDGDQTMVGEKGISLSGGQKARLSLARATYARADTY 779

Query: 669 ILDEATSALDVE-SEGAINYTFGQ--LMKSKS-------MTIVSIAHRLSTIRRSENIIV 718
           +LD+  +A+D   ++  I +  G   L+KSK+       +T++SIA  +S +        
Sbjct: 780 LLDDPLAAVDEHVAQHLIEHVLGPRGLLKSKTKLLATNKITVLSIASSISLVE------- 832

Query: 719 LGNDGSVVEMGKFKELFAD 737
               G +++ G ++++  D
Sbjct: 833 ---GGEIIQHGSYEDISKD 848

>TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1646

 Score =  132 bits (331), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 132/495 (26%), Positives = 240/495 (48%), Gaps = 52/495 (10%)

Query: 263  RLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIG 322
            ++  +++   LH    FFD   +G +++R   D      +I Q+++  V+S++   V + 
Sbjct: 1131 KIFKLLLSKVLHSKLRFFDSTPIGRIMNRFSKDI----EAIDQELTPYVESVVYNSVQLI 1186

Query: 323  MMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQ--DATGQ--LTRVSEEQLNGV 378
              + L   +++  +   + V+L     G      SREL+  ++T +  + +   E L GV
Sbjct: 1187 ATVLLITYITNGFIVVALLVILLYYFVGVYYLSGSRELKRFESTTKSPIYQHFSETLVGV 1246

Query: 379  RTVQSFVAEQREIKRFNHSIREIFDVGKRAAFI---NAKFFTSTSLVGDLSFLT--VLVY 433
             T++++  E R +K    ++ +I +  K   ++   N        ++G L      VLV 
Sbjct: 1247 TTIRAYGDEIRFMK---ENLTKIDENNKPFFYLWVANRWLCFRIDIIGSLVIFGAGVLVL 1303

Query: 434  GSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTD--RVPT 491
             +   +   L    LT  + +TE    +   L   YS +     +  R+ E  D  + P 
Sbjct: 1304 MNINKIDSGLAGISLTYAITFTE----SALWLVRSYSNVEINMNSVERVKEYMDIEQEPY 1359

Query: 492  IRPTLG--KTYTPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGK 548
                +   K++ P +G+IE  ++S  Y P+ P  ++ K+++F ++P   V +VG +G GK
Sbjct: 1360 SAGIVNVDKSW-PSEGKIEVNDLSLRYAPSLP--KVIKNVSFTVEPKMKVGVVGRTGAGK 1416

Query: 549  STIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLT 608
            STI   L  + +P +G I ID  DIT ++ K LR+ I ++ Q+P L +GTI+ N+     
Sbjct: 1417 STIITALFRFLDPETGYIKIDNIDITTIDLKKLRKSITIIPQDPTLFTGTIKSNL--DPY 1474

Query: 609  EEPTKEEIRTVAKQCFCHNFIVKFPYTYD----------------TYIGPHGTLLSGGQK 652
             E   ++I    ++    N IV      D                + I   G+ LS GQ+
Sbjct: 1475 NEYNDDQIFKALRRV---NLIVDGNLNSDVTSVSSENVNKFLNLQSEISEGGSNLSQGQR 1531

Query: 653  QRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRR 712
            Q + +AR+L++ PNI++LDEAT+++D  S+  I  T     + K  TI++IAHRL ++  
Sbjct: 1532 QLMCLARSLLRAPNIMLLDEATASIDYASDAKIQGTIRN--EFKDSTILTIAHRLRSVID 1589

Query: 713  SENIIVLGNDGSVVE 727
             + I+V+ + G V E
Sbjct: 1590 YDKILVM-DAGEVKE 1603

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 115/231 (49%), Gaps = 11/231 (4%)

Query: 505 GEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG 564
            +I  +NV+ ++  +  +   ++LN   K G    ++GP+G GK+++ + LL   +   G
Sbjct: 696 NKISLENVTVSWNKQKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSLLMALLGEMHLLEG 755

Query: 565 QILIDGQDI---TKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAK 621
           +I +   D       +S  L   +A   Q   L++ T+++NI +    E  +E    V  
Sbjct: 756 KITVPSLDPRCEMTFDSDGLSNSMAYCSQAAWLLNDTVKNNILFN--AEYNEERYLAVIS 813

Query: 622 QCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVES 681
            C              T IG  G  LSGGQKQRI++ARAL      ++LD+  SA+D  +
Sbjct: 814 ACALKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSSSKHILLDDCLSAVDSHT 873

Query: 682 EGAI--NYTFGQLMKSKSMTIVSIAHRLS-TIRRSENIIVLGNDGSVVEMG 729
              I  N   G LM++++  +VS  H ++ T++ +E +I++ N G +  +G
Sbjct: 874 AAWIYDNCIIGPLMENRTCILVS--HNVALTLKNAEQVIMIDN-GKISHIG 921

>TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4.6
            YHL035C
          Length = 1649

 Score =  131 bits (330), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 130/478 (27%), Positives = 215/478 (44%), Gaps = 61/478 (12%)

Query: 279  FFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCF 338
            FFD   +G +++R   D  ++   +   + DGV S     V   M++     ++   +  
Sbjct: 1150 FFDNTPIGRIMNRFSKDIQVLDSELAPFL-DGVFSCFIQAVTALMLIVF---ITPKFLII 1205

Query: 339  VIPVVLSASIFGKQIRINSRELQ----DATGQLTRVSEEQLNGVRTVQSFVAEQREIKRF 394
             I ++ S+   G      SREL+     +   + +   E L+G+ T+++F  E + +K  
Sbjct: 1206 AIFIICSSITIGYLYLCCSRELKRFESSSKSPVYQHFTETLSGLVTIRAFGNEIKFLKEN 1265

Query: 395  NHSIREIFDVGKRAAFINAKFFTSTSLVGDLSF-------LTVLVYGSYLVLHGS----- 442
               I E           N  FF   S+   LSF       +TV   G++++L+       
Sbjct: 1266 LDFIDEN----------NKFFFYMWSVNSWLSFRIDLLGAITVFGSGAFILLNADKIDAG 1315

Query: 443  LTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTY-- 500
            L    LT  + +TE+       +  FYS +     +  RL E  +         G     
Sbjct: 1316 LAGISLTYAVTFTEFC----LWMVKFYSTVEMSMNSVERLKEYMEIEEEALADPGAITPS 1371

Query: 501  --TPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLH 557
               P +G I F N S  Y P  P   + K LN KI  GS + +VG +G GKSTI   L  
Sbjct: 1372 ENWPVQGAITFANYSLRYAPKLP--DVLKQLNLKIDGGSKIGVVGRTGAGKSTIISALFR 1429

Query: 558  YYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIR 617
            + + +SG+ILID  DI+++N + LR  + ++ Q+P L  GTIR N+     EE   ++I 
Sbjct: 1430 FLDCSSGKILIDDLDISEINLRRLRSCLTIIPQDPSLFVGTIRSNL--DPNEEYENKDIY 1487

Query: 618  T--VAKQCFCHNFIVKFPY--------------TYDTYIGPHGTLLSGGQKQRIAIARAL 661
               V       +++    Y                D+ I   G  LS GQ+Q I +AR++
Sbjct: 1488 DALVKVHLLTEDYLANLNYDANADVAYDENIFLNLDSPISEGGINLSQGQRQLICLARSI 1547

Query: 662  IKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVL 719
            +    I++LDEAT+++D +S+  +  T       K  TI++IAHR+ ++   + I+VL
Sbjct: 1548 LHCSKIVLLDEATASIDYKSDFKVQETIRNEFSQK--TILTIAHRIKSVIDYDKILVL 1603

 Score = 90.9 bits (224), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 111/468 (23%), Positives = 208/468 (44%), Gaps = 48/468 (10%)

Query: 286 GDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLEL---SMDLSSVLVCFVIPV 342
           G +I+ +  D+  V   +   +   +++LI   V + ++  +   +  + + ++ F IP 
Sbjct: 496 GGIINLMATDAIKVGE-LCNYLHSSIEALIMAVVAVILLYRILGTAAFIGTAVIIFFIPF 554

Query: 343 VLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIF 402
            +      K I    RE    T Q  +   E    +R ++SF  E   I++      +  
Sbjct: 555 NV---FLTKLIARFQRETLTFTDQRIQNLNETFQSIRIIKSFGWENNIIQKILGLRNKEI 611

Query: 403 DVGKRAAFINAKFFTSTSLVGDLS--FLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGN 460
            V KR    N+  ++  +LV  LS   +T L +  Y+++       DLT       +T  
Sbjct: 612 SVLKR----NSITWSINALVWYLSPTIITTLSFSYYILVDKQ----DLTT---PVAFTAL 660

Query: 461 AIFGL--------STFYSEIMQGAGAASRLFELTDRVPTIRPTL---GKTYTPGKGEIEF 509
           A+F L        S   + + Q   +  R+    ++  +++ T      +    +  + F
Sbjct: 661 ALFNLLKAPLDQLSNTINFLTQSKVSLDRI----EKFLSVKETTKFENLSVDSSQNRLAF 716

Query: 510 KNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILID 569
              +  +     +   +++N + + G    ++GP+G GK+++ + LL   +  SG++ + 
Sbjct: 717 SGATLGWCGNKKSFQLRNINAEFEMGKLNLVIGPTGSGKTSLLMALLGELHLFSGKVFVP 776

Query: 570 GQDITKLN----SKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFC 625
             + +K N    S +L   IA   Q P + + TIR+NI + +  +  K+    V   C  
Sbjct: 777 NLE-SKFNLIPESDNLLNSIAYCSQLPWIFNDTIRNNIIFDMGYD--KDRYENVVIACGL 833

Query: 626 HNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 685
                       T +G  G+ LSGGQKQRI++ARAL  K   LILD+  SA+D  S   I
Sbjct: 834 ERDFQILNLGDKTIVGDKGSCLSGGQKQRISLARALYSKSRHLILDDCLSAVDSHSAKWI 893

Query: 686 NYTF--GQLMKSKSMTIVSIAHRLS-TIRRSENIIVLGNDGSVVEMGK 730
                 G LM+ ++  +VS  H +S TI+++  + ++ N G +V  G+
Sbjct: 894 YNVCITGPLMQGRTCILVS--HNVSLTIKKASKVFMIEN-GYIVASGR 938

>KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1546

 Score =  131 bits (330), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 93/309 (30%), Positives = 151/309 (48%), Gaps = 19/309 (6%)

Query: 442  SLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLG---- 497
            +L+ G +   M Y     N +  +     ++     +  R+ E  D  P   P +     
Sbjct: 1229 ALSTGMVGLLMSYALQVTNKLMWIVRMSVQLETNVVSVERIVEYCDLPPEAPPVIEDCRP 1288

Query: 498  KTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLH 557
            +   P +G + FK+ S  Y     + + K LN +I P   + IVG +G GKST++L L  
Sbjct: 1289 EKNWPAQGHVVFKDYSARY-RENLDPVLKKLNVEINPQEKIGIVGRTGAGKSTLSLALFR 1347

Query: 558  YYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIR 617
               P  G I+IDG DITK+    LR  ++++ Q+     G++R N+     E+ + +EI 
Sbjct: 1348 ILEPCGGTIVIDGVDITKIGLADLRSHLSIIPQDAQAFEGSVRSNL--DPFEQYSDDEIW 1405

Query: 618  TVAKQCFCHNFIVKFPYT---------YDTYIGPHGTLLSGGQKQRIAIARALIKKPNIL 668
               +       I+K              +T I  +G+ LS GQ+Q + ++RAL+ +  IL
Sbjct: 1406 RALELSHLKPHILKMANEEGPEKTKNLLETKISENGSNLSVGQRQLLCLSRALLNRSRIL 1465

Query: 669  ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEM 728
            +LDEAT+A+D E++  I  T     K +  TI++IAHR+ T+  S+ I+VL + G V E 
Sbjct: 1466 VLDEATAAVDSETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-DQGEVKEF 1522

Query: 729  GKFKELFAD 737
                 L AD
Sbjct: 1523 DSPSNLLAD 1531

 Score = 81.6 bits (200), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 110/507 (21%), Positives = 222/507 (43%), Gaps = 55/507 (10%)

Query: 264 LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSR--SITQKISDGVKSLICGGVGI 321
           L +++ + +L   SE  +    GD+++ +  D   + R    +Q++     +L+   V +
Sbjct: 373 LMTMLYQKSLKLSSEAREGKTAGDIMNMMAVDVLRIQRFFETSQELVGSPIALLTTLVSL 432

Query: 322 GMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTV 381
              L  S     V++  + P+    S   ++I++  ++  +      +   E LN V+TV
Sbjct: 433 YTFLGYSTAGGVVIMAVMFPI---NSYLSRKIKVLIKKQMEYKDARIKTVTEILNSVKTV 489

Query: 382 QSFVAEQREIKRFNHSIR---EIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLV 438
           + +  E+  +KR +H +R   E+    K A   N   F    +   ++  T L+Y   LV
Sbjct: 490 KLYAWEEPMLKRLDH-VRNELELESFKKIAVMNNLTLFAWNCVPILVASSTFLIYA--LV 546

Query: 439 LHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGK 498
           +   LT   +   +   +   + I+ +       ++   +  RL +       +   L K
Sbjct: 547 MDVPLTPQIVFPSLSLFDILNDCIYTIPRTIINFIETGVSMGRLKDFL-----LAKELDK 601

Query: 499 TYT--------PGKGEIEFKNVSFA--YPTRPSNQ--------------IFKSLN-FKIK 533
           ++         P    IE  N +F    PT+ +++                K+++ F+  
Sbjct: 602 SFIEFESLPDDPNVPVIEVHNATFLRNLPTKATSEENYDEEAMIESSRVALKNIDGFQAL 661

Query: 534 PGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPV 593
            G  VC+VG  G GKST    LL      S       Q   K++ +     +A+  Q+  
Sbjct: 662 KGQLVCVVGRVGAGKSTFLHALLGQLPCISSS---HDQATPKMHFRC--DSVALCSQQAW 716

Query: 594 LMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQ 653
           +++ +++ N+ +G   +  +   +   + C     +       +T +G  G  LSGGQK 
Sbjct: 717 ILNASVKYNVLFG--HKYDEASYKATIEACQLLPDLGILADGDETLVGEKGISLSGGQKA 774

Query: 654 RIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQ---LMKSKSMTIVSIAHRLST 709
           RI++ARA+  + ++ +LD+  SA+D E  +  I++   +   L+K+K  T++   + +S 
Sbjct: 775 RISLARAVYSRSDVYLLDDILSAVDAEVCKRIIDHVLSRKTGLLKNK--TVILTTNSISV 832

Query: 710 IRRSENIIVLGNDGSVVEMGKFKELFA 736
           ++ S++I  L N G +VE G F E+ +
Sbjct: 833 LKHSQSIYALEN-GEIVERGSFDEIMS 858

>SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1653

 Score =  131 bits (330), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 136/515 (26%), Positives = 232/515 (45%), Gaps = 87/515 (16%)

Query: 263  RLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLI-CGGVGI 321
            ++ ++V+K  L+    FFD   +G +++R   D   V + +T  +     SL+ C     
Sbjct: 1133 KIFNLVLKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQC----- 1187

Query: 322  GMMLELSMDLSSV-LVCFVIPVVLSASIF--------GKQIRINSRELQD----ATGQLT 368
                     LS+V L+ ++ P  L  +IF        G      SREL+     +   + 
Sbjct: 1188 ---------LSTVILIAYITPGFLVVAIFIGFLYYLVGYFYMAGSRELKRFESVSRSPIH 1238

Query: 369  RVSEEQLNGVRTVQSFVAEQR-------EIKRFNHSIREIFDVGKRAAFINAKFFTSTSL 421
            +   E L G+ T+++F  E+R       +I   N     ++   +  AF          +
Sbjct: 1239 QHFSETLVGITTIRAFGDERRFMLENLQKIDENNKPFFYLWVANRWLAF-------RIDM 1291

Query: 422  VGDLSFLTVLVYGSYLVLH-----GSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGA 476
            +G      V   G +++L+       L    LT  + +TE        L   YS +    
Sbjct: 1292 IGAC---VVFAAGVFILLNIKKLDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTM 1344

Query: 477  GAASRLFE--LTDRVPT----IRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNF 530
             +  RL E  + ++ P+      P +     P +G+IE  ++S  Y T    ++ K+++F
Sbjct: 1345 NSVERLKEYMVIEQEPSNDGAFNPPIE---WPDQGKIEVNDLSLRYATNLP-RVIKNVSF 1400

Query: 531  KIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQ 590
             + P   V IVG +G GKSTI   L  + +P +G I ID  DIT +  K LR+ I ++ Q
Sbjct: 1401 TVDPKCKVGIVGRTGAGKSTIITALFRFLDPETGHIKIDNVDITSIGLKRLRQSITIIPQ 1460

Query: 591  EPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQC--FCHNFIVKFPYTYDTY--------- 639
            +P L SGT++ N+     +E T E+I    K+      + +   P + D           
Sbjct: 1461 DPTLFSGTVKSNL--DPYDEYTDEQIFKALKRVNLVTADELDHVPDSADNASVNSENVNK 1518

Query: 640  -------IGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQL 692
                   I   G  LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  + 
Sbjct: 1519 FLDLRNEITEGGANLSQGQRQLVCLARSLLRSPKIILLDEATASIDYSSDAKIQQTIRE- 1577

Query: 693  MKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVE 727
             +    TI++IAHRL +I   + I+V+ + G V E
Sbjct: 1578 -EFGDSTILTIAHRLRSIIDYDKILVM-DAGEVRE 1610

 Score =  105 bits (261), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 118/466 (25%), Positives = 223/466 (47%), Gaps = 44/466 (9%)

Query: 285 VGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLEL---SMDLSSVLVCFVIP 341
           +G +I+ +  D++ VS  I   +   V++ I   V + ++ +L   +  + ++L+  ++P
Sbjct: 475 LGGIINLMAVDAFKVSE-ICAYLHAFVEATIMTIVALTLLYKLLGWAAVIGAILIVCMLP 533

Query: 342 VVLS-ASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQ---REIKRFNHS 397
           +    A++ GK  + N       T +  +   E    +R ++ F  E+   R+IK    +
Sbjct: 534 LNFKLANLIGKLQKDN----LGVTDKRIQKLNETFQSIRIIKFFSWEENFERDIK----A 585

Query: 398 IR--EIFDVGKRA---AFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSL--TIGDLTA 450
           IR  E+  + KR+   A ++  +F + S+V  +SF        Y+ + G +  T    TA
Sbjct: 586 IRTEELKILLKRSIVWALMSLVWFITPSIVTSVSF------AFYIYVQGEVLTTPIAFTA 639

Query: 451 FMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFK 510
             L+T    N +  LS   S ++Q   +  R+ E  D   T +       T  + +I F+
Sbjct: 640 LSLFT-LLRNPLDQLSDMLSFVIQSKVSLDRVQEFLDEEETEK---YNQLTISRNKIAFE 695

Query: 511 NVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI-- 568
           N +FA+  +  +   K+LN + K G    ++G +G GK+++ + LL   +   G++ +  
Sbjct: 696 NATFAWDKKNPSFKLKNLNVEFKLGKLNVVIGSTGSGKTSLLMGLLGEMDLIEGKVYVPS 755

Query: 569 -DGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHN 627
            D ++   + S  +   IA   Q   L++ T+R+NI +      T+   + V + C    
Sbjct: 756 LDPREELVIESDGMTNSIAYCSQAAWLLNDTVRNNILFNSPYNETR--YKAVVEACGLKR 813

Query: 628 FIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI-- 685
                     T IG  G  LSGGQKQR+++ARAL      ++LD+  SA+D  +   I  
Sbjct: 814 DFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHVLLDDCLSAVDSHTALWIYE 873

Query: 686 NYTFGQLMKSKSMTIVSIAHRLS-TIRRSENIIVLGNDGSVVEMGK 730
           N   G LM+ ++  +VS  H ++ T++ +E ++VL N G + + G+
Sbjct: 874 NCITGPLMQGRTCILVS--HNVALTLKNAEWVVVLDN-GRIKDQGE 916

>CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1 or uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1
          Length = 1535

 Score =  131 bits (329), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 138/474 (29%), Positives = 223/474 (47%), Gaps = 51/474 (10%)

Query: 279  FFDVHKVGDLISRLGADSY----IVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSV 334
            FF+   +G +++R   D Y    I+ R+ +Q   + VK L   GV      +        
Sbjct: 1062 FFETTPIGRILNRFSNDIYKVDSILGRTFSQFFVNTVKVLFTIGVIAYTTWQF------- 1114

Query: 335  LVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVS-----EEQLNGVRTVQSFVAEQR 389
             V  ++P+ +    + +     SREL+     +TR       +E L G+ T++ +  +  
Sbjct: 1115 -VFVIVPLGIFYIYYQQYYLRTSRELRRLES-VTRSPIFSHFQETLGGLATIRGYGQQ-- 1170

Query: 390  EIKRFNHSIREIFDVGKRAAF---INAKFFTSTSL--VGDLSFLTVLVYGSYLVLHGSLT 444
              KRF H I E       +AF   INA  + +  L  +G +  L       + +  G++T
Sbjct: 1171 --KRFEH-INECRVDNNMSAFYPSINANRWLAYRLEFIGSVIILGAATLSIFKLRAGTMT 1227

Query: 445  ---IGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTI----RPTLG 497
               IG   ++ L    T N I  ++      +          EL    P +    RP   
Sbjct: 1228 AGMIGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYSELKSEAPLVIESNRPP-- 1285

Query: 498  KTYTPGKGEIEFKNVSFAYPTRPS---NQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALL 554
            K + P  GEI+F++    Y TR     + + K +N +IKP   + IVG +G GKS++ L 
Sbjct: 1286 KEW-PVAGEIKFEH----YYTRYREDLDYVLKDINLEIKPREKIGIVGRTGAGKSSLTLA 1340

Query: 555  LLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKE 614
            L      TSG ILIDG  I ++    LR  ++++ Q+  +  GTIR+NI    T + T  
Sbjct: 1341 LFRIIEATSGGILIDGVHINEIGLHDLRHHLSIIPQDSQVFEGTIRENI--DPTNQFTDA 1398

Query: 615  EIRTVAKQCFCHNFIVKFPYT-YDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEA 673
            +I    +       I++       T +   G+ LS GQ+Q + +ARAL+    +L+LDEA
Sbjct: 1399 DIWRALELSHLKEHIMQMGGDGLMTMMTEGGSNLSVGQRQLMCLARALLVPSKVLVLDEA 1458

Query: 674  TSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVE 727
            T+A+DVE++  I  T     K +  TI++IAHR++TI  ++ IIVL + G VVE
Sbjct: 1459 TAAVDVETDKVIQETIRTSFKDR--TILTIAHRINTIMDNDRIIVL-DKGKVVE 1509

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 115/496 (23%), Positives = 213/496 (42%), Gaps = 55/496 (11%)

Query: 264 LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKIS---DGVKSLICGGVG 320
           L S++ +  L   +E  +    GD+++ +  D   + + +TQ I     G   ++   + 
Sbjct: 400 LTSIIYQKALVLSNEASNTSSTGDIVNLMSVDVQKL-QDLTQWIHLIWSGPLQIVLCLIS 458

Query: 321 IGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRT 380
           +  +L  SM +  +++  +IPV        K ++ +  + +D   + TRV  E LN +++
Sbjct: 459 LYKLLGHSMWVGVLILTIMIPVNSFLMKIQKNLQKSQMKFKD---ERTRVISEILNNMKS 515

Query: 381 VQSFVAEQ-----REIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGS 435
           ++ +  EQ      E  R    ++ +  +G   A  + +F     LV   +F  V VY  
Sbjct: 516 LKLYAWEQPYKEKLEYVRNEKELKNLKKLGVYMACTSFQFNIVPFLVSCSTF-AVFVYTE 574

Query: 436 YLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFEL---------- 485
              L   L    LT F L +      +  +    + I++ + + SRLF            
Sbjct: 575 DKALTTDLVFPALTLFNLLS----FPLMVIPNVITAIIESSVSVSRLFNFLTNEELQKDA 630

Query: 486 TDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGPS 544
             R+P ++         G       N +F +  +P  ++  K++N++ K G   CIVG  
Sbjct: 631 VQRLPKVKEIGDVAVNVGD------NATFLWKRKPEYKVALKNINYQAKKGELSCIVGKV 684

Query: 545 GKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNIT 604
           G GKS     LL       G   I G              +A V Q   +M+GT+RDN+ 
Sbjct: 685 GSGKSAFLQSLLGDLFRVKGFATIHGS-------------VAYVSQVAWIMNGTVRDNVL 731

Query: 605 YGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKK 664
           +G   +P  E      K C     +        T +G  G  LSGGQK R+++ARA+  +
Sbjct: 732 FGHKYDP--EFYEKTIKACALTIDLATLVDGDQTLVGEKGISLSGGQKARLSLARAVYAR 789

Query: 665 PNILILDEATSALDVE-SEGAINYTFGQ--LMKSKSMTIVSIAHRLSTIRRSENIIVLGN 721
            +  +LD+  +A+D   S   + +  G   L+ SK+  + +  +++S +  +++I +L N
Sbjct: 790 ADTYLLDDPLAAVDEHVSRHLVEHVLGPNGLLHSKTRILAT--NKISVLSAADSITLLEN 847

Query: 722 DGSVVEMGKFKELFAD 737
            G + + G + +   D
Sbjct: 848 -GEITQQGTYADCRKD 862

>YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}
            YBT1Transporter of the ATP-binding cassette (ABC) family
            involved in bile acid transport; similar to mammalian
            bile transporters
          Length = 1661

 Score =  131 bits (329), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 148/559 (26%), Positives = 243/559 (43%), Gaps = 98/559 (17%)

Query: 223  MFGLTLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFDV 282
            M+ L LY  + GF+ AL +G              S ++     ++++   LH    FFD 
Sbjct: 1102 MYYLVLY-LIIGFAQAL-LGAGKTILNFVAGINASRKIF----NMILNKVLHSKIRFFDA 1155

Query: 283  HKVGDLISRLGADSYIVSRSITQKISDGVKSLI-CGGVGIGMMLELSMDLSSV-LVCFVI 340
               G +++R   D   + + +T  I     SLI C              LS+V L+ F+ 
Sbjct: 1156 TPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIEC--------------LSTVILITFIT 1201

Query: 341  PVVLSASIF--------GKQIRINSRELQD----ATGQLTRVSEEQLNGVRTVQSFVAEQ 388
            P  LS +I         G      SREL+     +   + +   E L GV T+++F  E 
Sbjct: 1202 PQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAFGDEG 1261

Query: 389  REIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSL----T 444
            R ++   H I E           N  FF        L+F   ++ GS ++    L     
Sbjct: 1262 RFMQENLHKIDEN----------NKPFFYLWVANRWLAFRIDMI-GSLVIFGAGLFILFN 1310

Query: 445  IGDLTAFM------LYTEYTGNAIFGLSTFYSEIMQGAGAASRL---FELTDRVPTIRPT 495
            I +L + M          +T  A++ L   YSE+     +  R+    E+          
Sbjct: 1311 INNLDSGMAGISLTYAISFTEGALW-LVRLYSEVEMNMNSVERVKEYMEIEQEPYNEHKE 1369

Query: 496  LGKTYTPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALL 554
            +     P  G+IE  ++S  Y P  P  ++ K+++F +   S + IVG +G GKSTI   
Sbjct: 1370 IPPPQWPQDGKIEVNDLSLRYAPNLP--RVIKNVSFSVDAQSKIGIVGRTGAGKSTIITA 1427

Query: 555  LLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNI----------- 603
            L  +  P +G I ID  DI+ ++ + LRR I ++ Q+P L SGTI+ N+           
Sbjct: 1428 LFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRQI 1487

Query: 604  ---------------TYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLS 648
                             G T E + E   T ++       + KF     + I   G+ LS
Sbjct: 1488 FEALKRVNLISEEQLQQGATRETSNEASSTNSEN------VNKF-LDLSSEISEGGSNLS 1540

Query: 649  GGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLS 708
             GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + +  TI++IAHRL 
Sbjct: 1541 QGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRK--EFQGSTILTIAHRLR 1598

Query: 709  TIRRSENIIVLGNDGSVVE 727
            ++   + I+V+ + G V E
Sbjct: 1599 SVIDYDKILVM-DAGEVKE 1616

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 104/481 (21%), Positives = 210/481 (43%), Gaps = 44/481 (9%)

Query: 270 KHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSM 329
           + +++ D E      +G +I+ +  D++ VS  I   +   +++ +   V + ++  L +
Sbjct: 460 QKSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALALLYRL-L 517

Query: 330 DLSSVLVCFVIPVVLSASI-FGKQI-RINSRELQDATGQLTRVSEEQLNGVRTVQSFVAE 387
             ++++   +I  +L  +    K I  +  + L     ++ +++E     +R ++ F  E
Sbjct: 518 GFAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNE-AFQAIRIIKYFSWE 576

Query: 388 QREIKRFNHSIRE-----------IFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSY 436
           +   K  N +IRE           ++ +     F+     T+ S            +  Y
Sbjct: 577 ENFEKDIN-TIRENELSLLLMRSIVWSISSFLWFVTPTIVTAAS------------FAYY 623

Query: 437 LVLHGSL--TIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRP 494
           + + G +  T    TA  L+T    + +  LS   S ++Q   +  R+ +  +   T + 
Sbjct: 624 IYVQGEVLTTPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNENDT-KK 681

Query: 495 TLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALL 554
               T  P      F+N + ++     +   K LN + K G    ++GP+G GK+++ + 
Sbjct: 682 YDQLTIDPNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMA 741

Query: 555 LLHYYNPTSGQILIDGQDITK---LNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEP 611
           LL      +G++++   +  +   +++      IA   Q   L++ T+++NI +     P
Sbjct: 742 LLGEMYLLNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFN---SP 798

Query: 612 TKE-EIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILIL 670
             E   + V + C              T IG  G  LSGGQKQR+++ARAL      ++L
Sbjct: 799 FNEARYKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLL 858

Query: 671 DEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEM 728
           D+  SA+D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V + 
Sbjct: 859 DDCLSAVDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQ 916

Query: 729 G 729
           G
Sbjct: 917 G 917

>Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  130 bits (328), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 131/515 (25%), Positives = 233/515 (45%), Gaps = 84/515 (16%)

Query: 263  RLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLI-CGGVGI 321
            ++ ++++   LH    FFD    G +++R   D   + + +T  I     SLI C     
Sbjct: 1136 KIFNMILNKVLHSKLRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIEC----- 1190

Query: 322  GMMLELSMDLSSV-LVCFVIPVVLSASI--------FGKQIRINSRELQD----ATGQLT 368
                     LS+V L+ F+ P  LS +I         G      SREL+     +   + 
Sbjct: 1191 ---------LSTVILITFITPQFLSVAIVVSIMYYFIGYFYMAGSRELKRYESISRSPIY 1241

Query: 369  RVSEEQLNGVRTVQSFVAE----QREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGD 424
            +   E L GV T+++F  E    Q  +++ + + +  F +     ++  +      ++G 
Sbjct: 1242 QHFSETLVGVTTIRAFGDEGRFMQENLQKIDENNKPFFYLWVANRWLAFRI----DMIGS 1297

Query: 425  LSFLTVLVYGSYLVLHGSLTIGD-------LTAFMLYTEYTGNAIFGLSTFYSEIMQGAG 477
            L     +++G+ L +  ++   D       LT  + +TE        L   YSE+     
Sbjct: 1298 L-----VIFGAGLFILSNIDHLDSGMAGISLTYAISFTE----GALWLVRLYSEVEMNMN 1348

Query: 478  AASRL---FELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIK 533
            +  R+    E+          +     P  G+IE  ++S  Y P  P  ++ K+++F + 
Sbjct: 1349 SVERVKEYMEIEQEPYNQHKEVPPPQWPQDGKIEVNDLSLRYAPNLP--RVIKNVSFSVD 1406

Query: 534  PGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPV 593
              S V IVG +G GKSTI   L  +  P +G I ID  DI+ ++ + LRR I ++ Q+P 
Sbjct: 1407 AQSKVGIVGRTGAGKSTIITALFRFLEPDTGHIKIDNIDISNVDLQRLRRSITIIPQDPT 1466

Query: 594  LMSGTIRDN---------------------ITYGLTEEPTKEEIRTVAKQCFCHNFIVKF 632
            L SGTI+ N                     ++    ++ T  E+ T        N + KF
Sbjct: 1467 LFSGTIKTNLDPYNEFSNQKIFEALKRVNLVSEEQLQQGTVREVATDTSSADSEN-VNKF 1525

Query: 633  PYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQL 692
                ++ +   G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  + 
Sbjct: 1526 -LDLESEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRK- 1583

Query: 693  MKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVE 727
             + +  TI++IAHRL ++   + I+V+ + G V E
Sbjct: 1584 -EFQGSTILTIAHRLRSVIDYDKILVM-DAGEVKE 1616

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 87/366 (23%), Positives = 164/366 (44%), Gaps = 19/366 (5%)

Query: 373 EQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLS--FLTV 430
           E    +R ++ F  E+     F + I+ I +       + +  ++ +S V  ++   +T 
Sbjct: 562 EAFQAIRIIKYFSWEEN----FENDIKAIRESELALLLMRSIIWSISSFVWFVTPTIVTA 617

Query: 431 LVYGSYLVLHGSL--TIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDR 488
             +  Y+ + G +  T    TA  L+T    + +  LS   S ++Q   +  R+ +  + 
Sbjct: 618 ASFAYYIYVQGEVLTTPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNE 676

Query: 489 VPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGK 548
             T +     T  P      F+N + ++     +   K LN + K G    ++GP+G GK
Sbjct: 677 KDTEKYD-QLTIDPNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGK 735

Query: 549 STIALLLLHYYNPTSGQILIDGQDITK---LNSKSLRRQIAVVQQEPVLMSGTIRDNITY 605
           +++ + LL      +G++++   D  +   + +      IA   Q   L++ T+++NI +
Sbjct: 736 TSLLMALLGEMYLLNGKVVVPALDPRQELVVEANGTTNSIAYCSQAAWLLNDTVKNNILF 795

Query: 606 GLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKP 665
                 T+   + V + C              T IG  G  LSGGQKQR+++ARAL    
Sbjct: 796 NSQFNETR--YKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNA 853

Query: 666 NILILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDG 723
             ++LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG
Sbjct: 854 RHVLLDDCLSAVDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDG 911

Query: 724 SVVEMG 729
            V + G
Sbjct: 912 RVKDQG 917

>Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  130 bits (327), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 143/544 (26%), Positives = 249/544 (45%), Gaps = 50/544 (9%)

Query: 228  LYEFLGGFSVALFIGCAA--NYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFDVHKV 285
            ++ F+G +S+ + +G AA  N          S R   +L   + K  +     FF+   V
Sbjct: 1017 VWMFVGVYSL-IGVGSAAFNNLRSIVMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPV 1075

Query: 286  GDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLS 345
            G +I+R  +D   V  S+    S   KS++   V + +++  +M    V   F++ + + 
Sbjct: 1076 GRIINRFSSDMDAVDSSLQYIFSFFFKSILTYLVTV-ILVGYNMPWFFVFNMFLLVIYIY 1134

Query: 346  ASIFGKQIRINSRELQD----ATGQLTRVSEEQLNGVRTVQSFVAEQREI----KRFNHS 397
               F     + SREL+     +   +  +  E LNG   + ++   +R I    ++  ++
Sbjct: 1135 YQTF---YIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYN 1191

Query: 398  IREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYT-E 456
            I  +F+      +++ +  T   +   +   T ++  + +     L+ G +   M Y+ E
Sbjct: 1192 IDFVFNFRSTNRWLSVRLQT---IGATIVLATAMLALTTMNTKKQLSSGMVGLLMSYSLE 1248

Query: 457  YTGNAIFGLSTFYSEIMQGAGAASRLFE---LTDRVPTIRP-TLGKTYTPGKGEIEFKNV 512
             TG+  + + T    I     +  R+ E   L     +I P        P KG IEFKN 
Sbjct: 1249 VTGSLTWIVRTTVM-IETNIVSVERIVEYCELPSEARSINPENRPDESWPSKGSIEFKNY 1307

Query: 513  SFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQD 572
            S  Y     + + K +N +IKP   + IVG +G GKST++L L     PT G I+ID  +
Sbjct: 1308 STKY-RENLDPVLKDINVRIKPCEKIGIVGRTGAGKSTLSLALFRILEPTEGSIVIDDIN 1366

Query: 573  ITKLNSKSLRRQIAVVQQEPVLMSGTIRDNI-------------TYGLT------EEPTK 613
            I+ L    LR  +A++ Q+     GT+R N+                L       E+   
Sbjct: 1367 ISDLGLFDLRSHLAIIPQDAQAFEGTVRTNLDPFNRYSEGELKKAVDLAHLGPHLEKMLD 1426

Query: 614  EEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEA 673
             EIR        +  +       +  I  +GT LS GQ+Q + +ARAL+ +  IL+LDEA
Sbjct: 1427 NEIRGADGAAEENGNVSD---VLNVKINENGTNLSVGQRQLLCLARALLNRSKILVLDEA 1483

Query: 674  TSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKE 733
            T+++D+E++  I  T  +  K +  TI++IAHR+ T+  S+ IIVL ++G+V E     +
Sbjct: 1484 TASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGTVKEFDSPSK 1540

Query: 734  LFAD 737
            L +D
Sbjct: 1541 LLSD 1544

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 100/396 (25%), Positives = 181/396 (45%), Gaps = 52/396 (13%)

Query: 373 EQLNGVRTVQSFVAEQREIKRFNHSIR---EIFDVGKRAAFINAKFFT--STSLVGDLSF 427
           E LN +++++ +  E+  ++R NH +R   E+ +  K     N  +F      L+   S 
Sbjct: 477 EILNAIKSIKLYAWEEPMMERLNH-VRNDMELQNFRKIGIVSNLIYFAWNCVPLMVTCST 535

Query: 428 LTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRL--FEL 485
             +    S   L  ++    L+ F +      +AI+ + +  + I++ + +  RL  F L
Sbjct: 536 FGLFSLFSDTPLSPAIVFPSLSLFNI----LNSAIYSVPSMINTIIETSVSMERLKSFLL 591

Query: 486 TDRV-----PTIRPTLGKTYTPGKGEIEFKNVSFAYPTRP-------------------- 520
           +D +       I P++ +   P    IE  N++F + ++                     
Sbjct: 592 SDEIDDSFIERIDPSMSERTLP---VIEMNNITFLWKSKEALASGQFEGNSNADEESIIG 648

Query: 521 SNQI-FKSLN-FKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNS 578
           S+QI  K+++ F+ K G  VC+VG  G GKST    +L      SG     G    KL  
Sbjct: 649 SSQIALKNIDHFEAKRGDLVCVVGRVGAGKSTFLKGILGQLPCMSGS---KGSIPPKLII 705

Query: 579 KSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDT 638
           ++    +A   QE  +M+ ++R+NI +G   +  K       K C     +   P   +T
Sbjct: 706 RA--SSLAYCSQESWIMNSSVRENILFG--HKFDKAYYDLTIKACQLLPDLKILPDGDET 761

Query: 639 YIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTF-GQLMKSK 696
            +G  G  LSGGQK R+++ARA+  + +I +LD+  SA+D E S+  + Y   G+    K
Sbjct: 762 LVGEKGISLSGGQKARLSLARAVYSRADIYLLDDVLSAVDAEVSKNIVEYVLIGKAALLK 821

Query: 697 SMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFK 732
           + TI+   + +  ++ S+ I  L N G ++E G ++
Sbjct: 822 NKTIILATNTVPILKHSQMIYALEN-GEIIEQGNYE 856

>KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1649

 Score =  130 bits (326), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 134/510 (26%), Positives = 234/510 (45%), Gaps = 76/510 (14%)

Query: 263  RLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIG 322
            ++ ++++K  L+    FFD   +G +++R   D   V + +T  +              G
Sbjct: 1128 KIFNLILKKVLYAKLRFFDSTPIGRIMNRFSRDIEAVDQELTPFVE-------------G 1174

Query: 323  MMLELSMDLSSV-LVCFVIPVVLSASIF--------GKQIRINSRELQD----ATGQLTR 369
              + L   LS+V L+ ++ P     +IF        G      SREL+     +   + +
Sbjct: 1175 AFVSLVQCLSTVILIAYITPDFFFVAIFIGIFYYLVGYFYMAGSRELKRYESISRSPIHQ 1234

Query: 370  VSEEQLNGVRTVQSFVAEQR-------EIKRFNHSIREIFDVGKRAAFINAKFFTSTSLV 422
               E L G+ T+++F  E+R       +I   N     ++   +  AF          ++
Sbjct: 1235 HFSETLVGITTIRAFGDERRFMQENLTKIDENNKPFFYLWVANRWLAF-------RIDMI 1287

Query: 423  GDLSFLTVLVYGSYLVLH-GSLTIGDLTAFMLYT-EYTGNAIFGLSTFYSEIMQGAGAAS 480
            G      +   G +++L+  SL  G     + Y   +T  A++ L   YS +     +  
Sbjct: 1288 GAC---VIFAAGIFVLLNIKSLDSGLAGISLTYAISFTEGALW-LVRLYSNVEMTMNSVE 1343

Query: 481  RLFEL--TDRVPTIRPTLGKT-YTPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGS 536
            RL E    ++ P  + T       P +G+IE  ++S  Y P+ P  ++ K++ F + P  
Sbjct: 1344 RLKEYMEVEQEPHYQSTHNPPPEWPSQGKIEVNDLSLRYAPSLP--KVIKNVTFTVDPNC 1401

Query: 537  NVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMS 596
             V IVG +G GKSTI   L  + +P SG I ID  DIT +  K LR+ I ++ Q+P L +
Sbjct: 1402 KVGIVGRTGAGKSTIITALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFT 1461

Query: 597  GTIRDNIT-YGLTEEP------------TKEEIRTVAK------QCFCHNFIVKFPYTYD 637
            GT++ N+  Y    +             T+EE+   A            N + KF +  +
Sbjct: 1462 GTVKSNLDPYDEYSDKQIFEALKRVNLVTQEELDHAANPSPDNASAVSEN-VNKFLFL-E 1519

Query: 638  TYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKS 697
              I   G+ LS GQ+Q + +AR+L++ P +++LDEAT+++D +S+  I  T     +   
Sbjct: 1520 NEISEGGSNLSQGQRQLVCLARSLLRSPKVMLLDEATASIDYQSDARIQQTIRS--EFSD 1577

Query: 698  MTIVSIAHRLSTIRRSENIIVLGNDGSVVE 727
             TI++IAHRL +I   + I+V+ + G V E
Sbjct: 1578 STILTIAHRLRSIIDYDKILVM-DAGEVKE 1606

 Score = 97.4 bits (241), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 111/471 (23%), Positives = 213/471 (45%), Gaps = 44/471 (9%)

Query: 285 VGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLEL---SMDLSSVLVCFVIP 341
           +G +I+ +  D++ VS  I   +   V++L+   V + ++ +L   S  + ++L+  ++P
Sbjct: 472 LGAIINLMAVDAFKVSE-ICAYLHSFVEALVMTIVALTLLYKLLGWSAIIGALLIVAILP 530

Query: 342 VVLS-ASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIRE 400
           +    A++ GK      +E    T +  +   E    +R ++ F  E+     F   I+ 
Sbjct: 531 LNFRLATLIGKL----QKETLSFTDKRIQKLNETFQAIRIIKFFSWEEN----FEKDIQS 582

Query: 401 IFD------VGKRAAFINAKF--FTSTSLVGDLSFLTVLVYGSYLVLHGSL--TIGDLTA 450
           I D      V +  A+    F  F + ++V  +SF        Y+ + G +  T    TA
Sbjct: 583 IRDQELKMLVKRSVAWALTAFVWFITPTIVTSVSF------AFYIYVQGEVLTTPVAFTA 636

Query: 451 FMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFK 510
             L+T    N +  LS   S ++Q   +  R+    + +        +  T  + +I F+
Sbjct: 637 LSLFT-LLRNPLDMLSDMLSYVIQSKVSLDRV---QEFLEEEETEKYEQITVHRNKIGFE 692

Query: 511 NVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI---L 567
           N +F++  +  +   K++N   K G    ++GP+G GK+++ + LL   +   G++    
Sbjct: 693 NATFSWDRKNPDFKLKNMNIDFKLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEGKVYAPC 752

Query: 568 IDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKE-EIRTVAKQCFCH 626
           +D ++   + +  +   IA   Q   L++ T+++NI +     P  E     V + C   
Sbjct: 753 LDPREDMVIENDGMTNSIAYCSQAAWLLNDTVKNNILFS---SPFNEGRYNAVIEACGLK 809

Query: 627 NFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI- 685
                      T IG  G  LSGGQKQR+++ARAL      L+LD+  SA+D  +   I 
Sbjct: 810 RDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSHTALWIY 869

Query: 686 -NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELF 735
            N   G LM+ ++  +VS  H ++   ++   +V   +G V + G+  EL+
Sbjct: 870 ENCISGPLMEGRTCILVS--HNVALTLKNAEWVVFMENGRVKDQGEPLELY 918

>Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..10453)
            [4974 nt, 1658 aa]
          Length = 1657

 Score =  129 bits (324), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 137/507 (27%), Positives = 234/507 (46%), Gaps = 71/507 (14%)

Query: 263  RLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIG 322
            ++ S+++   LH +  FFD   +G +++R   D   V + +   +   +  +I       
Sbjct: 1139 KIFSLLLNKALHANLRFFDSTPIGRIMNRFSKDMEAVDQELVPYLEAALYCII------- 1191

Query: 323  MMLELSMDLSSVLVC-------FVIPVVLSASIF---GKQIRINSRELQ--DATGQ--LT 368
                   D+SS ++        F+I  +L A ++   G      SREL+  D+  +  + 
Sbjct: 1192 -------DISSTILLITYITPEFLIIAILVAGLYYAIGVLYLAGSRELKRFDSITKSPIY 1244

Query: 369  RVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFI----NAKFFTSTSLVGD 424
            +   E L GV TV+++  E R    F     ++ D   +  F     N        +VG 
Sbjct: 1245 QHFSETLVGVTTVRAYGDEAR----FMRENLKMIDENNKPFFYLWVSNRWLAFRIDVVGA 1300

Query: 425  LSFLTVLVYGS--YLVLHGSLTIGDLTAFML--YTEYTGNAIFGLSTFYSEIMQGAGAAS 480
            L     +++GS  +++L+       L    L     +T +A++ L   YS +     +  
Sbjct: 1301 L-----VIFGSGVFVLLNIDKIDSGLAGISLSFAISFTESALW-LVRHYSNLEMNMNSVE 1354

Query: 481  RLFEL--TDRVPTIRPTLG-KTYTPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGS 536
            RL E    ++ P    +L   +  P +G+IE  +VS  Y P  P  ++ K+  F + P  
Sbjct: 1355 RLMEYMEVEQEPYKSSSLDVPSSWPEEGKIEVNDVSLRYAPNLP--RVIKNATFTVDPKM 1412

Query: 537  NVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMS 596
             V IVG +G GKSTI   L  + +P +G I ID  DI+ +  K LRR I ++ Q+P L S
Sbjct: 1413 KVGIVGRTGAGKSTIITALFRFLDPETGSIKIDNVDISTIELKKLRRSITIIPQDPTLFS 1472

Query: 597  GTIRDNIT-YG-LTEEPTKEEIRTVA-------------KQCFCHNFIVKFPYTYDTYIG 641
            GTI+ N+  Y   +E+   E ++ V              +Q        KF    +  I 
Sbjct: 1473 GTIKSNLDPYDEYSEKQIFEALKRVNLVTEKELASGNSDQQSIASGNANKF-LNVNNEIS 1531

Query: 642  PHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIV 701
              G+ LS GQ+Q + +AR+L++ P +++LDEAT+++D  S+  I  T     +    TI+
Sbjct: 1532 EGGSNLSQGQRQLVCLARSLLRCPKVILLDEATASIDYASDAKIQETIRN--EFDDSTIL 1589

Query: 702  SIAHRLSTIRRSENIIVLGNDGSVVEM 728
            +IAHRL T+   + I+V+ + G V E 
Sbjct: 1590 TIAHRLRTVIDYDKILVM-DAGEVKEF 1615

 Score = 97.1 bits (240), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 113/467 (24%), Positives = 212/467 (45%), Gaps = 44/467 (9%)

Query: 285 VGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLEL---SMDLSSVLVCFVIP 341
           +G +I+ +  D++ V+  I   +   V++++   V + ++ +L   +  + + L+  ++P
Sbjct: 484 LGSIINLMAVDTFKVA-DICAYLHHFVEAVVMTIVALILLFKLLGVAAIVGASLIIALLP 542

Query: 342 VVLS-ASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIRE 400
           +    AS+ GK  +  S E+ D   Q      E    +R ++ F  E      F   I E
Sbjct: 543 LNFKLASLLGKYQK-KSLEVTDKRIQKLN---EAFQAIRIIKFFSWEDN----FEKDILE 594

Query: 401 IFDVGKRAAFINAKFFTSTSLVGDLS--FLTVLVYGSYLVLHGS-LTIGDLTAFMLYTEY 457
           + +   R   I +  +  +S V  ++   +T   +  Y+ + G  LTI           +
Sbjct: 595 VRERELRMILIRSIVWAISSFVWFVTPTIVTGASFTYYVYVQGEVLTIP--------VAF 646

Query: 458 TGNAIFGL--------STFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEF 509
           T  ++F L        S   S ++Q   +  R+ E  +   T +     T    + +I F
Sbjct: 647 TALSLFALLKIPLDTFSDMLSFVIQSKVSLDRIQEFLEEEDT-KKYEQLTVDKYQNKIAF 705

Query: 510 KNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI- 568
           KN +  +     +   ++++   K G    I+GP+G GK+++ + LL   +   G+I++ 
Sbjct: 706 KNATTTWNKEKQDFKLRNIDIDFKIGKLNVIIGPTGSGKTSLLMALLGEMDLIDGEIIVP 765

Query: 569 --DGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCH 626
             D ++  KL++  L   IA   Q   L++ T+R+NI +     P  EE      +    
Sbjct: 766 CLDPREDLKLDANGLTNSIAYCSQAAWLLNDTVRNNILFN---SPYCEERYNAVVEASGL 822

Query: 627 NFIVKFPYTYD-TYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 685
               +     D T IG  G  LSGGQKQR+++ARAL      L+LD+  SA+D  +   I
Sbjct: 823 KRDFEILNAGDMTEIGERGITLSGGQKQRVSLARALYSNSKHLLLDDCLSAVDSHTATWI 882

Query: 686 --NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGK 730
             N   G LM++++  +VS  H ++   R+ + +V   +G +VE G+
Sbjct: 883 YDNCISGPLMENRTCILVS--HNIALTLRNADYVVKLENGKIVEHGE 927

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
            complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score =  129 bits (324), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 137/544 (25%), Positives = 252/544 (46%), Gaps = 72/544 (13%)

Query: 224  FGLTLYEFL--GG-------FSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLH 274
            F + LY F   GG       F++  FIG  A+                +L    ++  LH
Sbjct: 918  FYMGLYSFFVFGGYIFMTSQFTIVCFIGVNAS---------------KKLNLSAVRRILH 962

Query: 275  QDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLIC---GGVGIGMMLELSMDL 331
                F D   +G +++R   D+     S+  ++++ V+ ++      +G+ +M  + +  
Sbjct: 963  TPMAFLDTTPLGRILNRFTKDT----DSLDNELTENVRLMLAQFANIIGVCVMCIIYLPW 1018

Query: 332  SSVLVCFVIPV-VLSASIF---GKQI-RINSRELQDATGQLTRVSEEQLNGVRTVQSFVA 386
             ++ + F++ + VL ++ +   G++I R+ + +       L  V    L G+ T++ + +
Sbjct: 1019 FAIAIPFILLIFVLVSNHYQSAGREIKRLEAIQRSFVYNNLNEV----LGGMDTIRFYNS 1074

Query: 387  EQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLT-I 445
            E+R + + ++ I ++ + G     +         ++     L + +       H S + +
Sbjct: 1075 EERFMAKSDYLIDKMNEAGYLVVCVQRWVAVLLDMIAVCFALIIALLCVTRQFHISASSV 1134

Query: 446  GDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPT----IRPTLGKTYT 501
            G L  ++L      N +    T   +      +  RL      +PT     +P      +
Sbjct: 1135 GVLLTYVLQLPGLLNTVLRALT---QTENDMNSVERLVSYATELPTEAAYRKPESSPDPS 1191

Query: 502  -PGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYY 559
             P +G+I+F+ VSFAY P  P+  + K+L+  I  G  + I G +G GKSTI   L    
Sbjct: 1192 WPQEGKIDFEEVSFAYRPGLPA--VLKNLSMSINGGEKIGICGRTGAGKSTIMSALYRLN 1249

Query: 560  NPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNIT-YGLTEEPT------ 612
               SG+I+IDG +I+ +    LRR ++++ Q+PVL  GTIR N+  +G   +        
Sbjct: 1250 ELESGRIIIDGVNISNIGLFDLRRSLSIIPQDPVLFRGTIRKNLDPFGERSDDELWDALS 1309

Query: 613  ------KEEIRTVAKQCFCHNFIVK--FPYTYDTYIGPHGTLLSGGQKQRIAIARALIKK 664
                  KE +  V  Q    N  V+    +  D  +   G+  S G++Q +A+ARAL++ 
Sbjct: 1310 RGGSIDKESLEEVKTQKSTGNSKVQELHKFHLDQEVEEEGSNFSLGERQLLALARALVRN 1369

Query: 665  PNILILDEATSALDVESEGAINYTFGQLMKSKS-MTIVSIAHRLSTIRRSENIIVLGNDG 723
              +LILDEATS++D E++  I     +++++ S  TI+ IAHRL TI   + I+VL   G
Sbjct: 1370 SKVLILDEATSSVDYETDNKIQ---NRIIEAFSECTILCIAHRLKTILNYDRILVL-EKG 1425

Query: 724  SVVE 727
             + E
Sbjct: 1426 EIAE 1429

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/211 (30%), Positives = 103/211 (48%), Gaps = 20/211 (9%)

Query: 525 FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQ 584
           FK +N +I  G  + I GP G GK+++   +      T G + I+G+             
Sbjct: 604 FKDINLEIHKGEFIMITGPIGTGKTSLLNAMSGLMEKTEGSVQINGE------------- 650

Query: 585 IAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHG 644
             ++   P + + T+RDNI +G   + +K  +  V K C     +   P    T IG  G
Sbjct: 651 -LLMGGYPWIQNATVRDNIIFGSPFDKSKYNM--VVKACCLDADLDILPAGDMTEIGERG 707

Query: 645 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI-NYTFGQLMKSKSMTIVSI 703
             LSGGQK RI +AR + K  +I + D+  SA+D      I +     L+  K+  + + 
Sbjct: 708 INLSGGQKARINLARCVYKNKDIYLFDDVLSAVDSRVGKLIMDECLLGLLNGKTRVLAT- 766

Query: 704 AHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
            H+LS +  +  +IVLGNDGS V++G  +EL
Sbjct: 767 -HQLSLVENASRVIVLGNDGS-VDIGTVEEL 795

>TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4.6
            YHL035C
          Length = 1642

 Score =  128 bits (322), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 133/511 (26%), Positives = 230/511 (45%), Gaps = 78/511 (15%)

Query: 263  RLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLI-CGGVGI 321
            ++ ++++   +H    FFD   +G +++R   D     + +T  I     SL+ C     
Sbjct: 1123 KIFNLLLSKVMHAKLRFFDSTPIGRIMNRFSKDMEAADQELTPFIEGAFYSLVQCVS--- 1179

Query: 322  GMMLELSMDLSSVLVCFVIPVVLSASIF--------GKQIRINSRELQD----ATGQLTR 369
                      + VL+ F+ P  L  +I         G      SREL+     +   + +
Sbjct: 1180 ----------TVVLITFITPQFLFVAILVAVLYYFVGYFYLTGSRELKRLESISRSPIYQ 1229

Query: 370  VSEEQLNGVRTVQSFVAEQR----EIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDL 425
               E L GV T+++F  E R     +++ + + R  F +     +++ +      ++G L
Sbjct: 1230 HFSETLVGVTTIRAFGDESRFMRENLQKIDENNRPFFYLWVANRWLSFRI----DMIGAL 1285

Query: 426  SFLTVLVYGSYLVLH------GSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAA 479
                +   G +++L+      G   I  LT  + +TE        L   YS +     + 
Sbjct: 1286 ---VIFGAGIFVLLNIDHIDSGKAGIS-LTYAITFTE----GALWLVRLYSNVEMNMNSV 1337

Query: 480  SRLFELTD--RVPTIRPTLGK-TYTPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPG 535
             RL E  D  + P  +  L      P +G IE  ++S  Y P  P  ++ K+++F + P 
Sbjct: 1338 ERLKEYMDVEQEPYDQSILTPPVEWPQQGRIEVNDLSLRYAPNLP--KVIKNVSFTVDPR 1395

Query: 536  SNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLM 595
            S V IVG +G GKSTI   L  + +P +G I ID  DIT ++ + LRR I ++ Q+P L 
Sbjct: 1396 SKVGIVGRTGAGKSTIITALFRFLDPETGNIKIDNVDITSIDLQRLRRSITIIPQDPTLF 1455

Query: 596  SGTIRDNITYGLTEEPTKEEIRTVAKQC------------------FCHNFIVKFPYTYD 637
            +GTI+ N+     +E T ++I    K+                        I KF     
Sbjct: 1456 TGTIKSNL--DPYDEYTDQQIFEALKRVNLVTQEELDRRPTSESSSVSSENINKF-LDLS 1512

Query: 638  TYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKS 697
            + I   G  +S GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +      
Sbjct: 1513 SEISEGGGNISQGQRQLVCLARSLLRSPKIILLDEATASIDYASDAKIQETIRKEFGGN- 1571

Query: 698  MTIVSIAHRLSTIRRSENIIVLGNDGSVVEM 728
             TI++IAHRL ++   + I+V+ + G V E 
Sbjct: 1572 -TILTIAHRLRSVIDYDKILVM-DAGEVKEF 1600

 Score = 92.4 bits (228), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 104/474 (21%), Positives = 206/474 (43%), Gaps = 28/474 (5%)

Query: 270 KHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLEL-- 327
           +  ++ D E      +G +I+ +  D++ VS  I   +   V++++   V   ++  L  
Sbjct: 462 QEQINGDEESTTSANLGAIINLMAVDAFKVSE-ICAYLHAFVEAVVMALVAFVLLYHLLG 520

Query: 328 -SMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVA 386
            +  + + L+  ++P+    + +   ++   +E    T +  +   E    +R ++ F  
Sbjct: 521 FAAIVGAALIVAMMPLNFKLATWLGHLQ---KETLSVTDKRIQKLNEAFQAIRIIKFFSW 577

Query: 387 EQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLS--FLTVLVYGSYLVLHGSL- 443
           E      F   IR++ +   +     +  +  +S V  ++   +T   +  Y+ + G + 
Sbjct: 578 ENN----FEKDIRDVRETELKFLMKRSLVWAGSSFVWYITPTIVTSCAFWFYIYIQGEVL 633

Query: 444 -TIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTP 502
            T    TA  L++      +  LS   S ++Q   +  R+ E  +   T +     T   
Sbjct: 634 TTPIAFTALSLFS-LLRTPLDQLSDMLSFVIQSKVSLDRVQEFLEEKDTEKYNQLST-AK 691

Query: 503 GKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPT 562
            K +I F+N +  +     +   K+LN   K G    I+GP+G GK+++ + LL   +  
Sbjct: 692 DKKKIGFENATITWDAERPDFKLKNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMHLV 751

Query: 563 SGQILIDGQDITK---LNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKE-EIRT 618
           SG+I++   D  +   + +  +   +A   Q   L++ T+++NI +     P  E     
Sbjct: 752 SGKIIVPSLDPRQELPIEADGMTNSMAYCSQAAWLLNDTVKNNILFN---SPYNEGRYEA 808

Query: 619 VAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALD 678
           V + C              T IG  G  LSGGQKQRI++AR+L      ++LD+  SA+D
Sbjct: 809 VVEACGLKRDFSILSAGDLTEIGERGITLSGGQKQRISLARSLYSNARHVLLDDCLSAVD 868

Query: 679 VESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGK 730
             +   I  N   G LM+ ++  +VS  H  +   R+  ++V   +G V   G+
Sbjct: 869 SHTASWIYDNCITGPLMEGRTCILVS--HNTALTLRNAELVVTMENGQVKNQGE 920

>KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1650

 Score =  128 bits (322), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 123/494 (24%), Positives = 230/494 (46%), Gaps = 38/494 (7%)

Query: 259  RLVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGG 318
            R   ++ ++++K+ L+    FFD   +G +++R   D   + + +T  +     SLI   
Sbjct: 1127 RASRKIFNLLLKNVLYAKLRFFDSTPIGRIMNRFSKDIESIDQELTPYMEGAFGSLIQCV 1186

Query: 319  VGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGV 378
              I ++  ++     V    ++     A  +    R   R    +   + +   E L G+
Sbjct: 1187 STIIVIAYITPQFLIVAAIVMLLFYFVAYFYMSGARELKRLESMSRSPIHQHFSETLVGI 1246

Query: 379  RTVQSFVAEQR----EIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYG 434
             T+++F  E+R     +K+ + + R  F +     +++ +      L+G L    VL  G
Sbjct: 1247 TTIRAFSDERRFLVDNMKKIDDNNRPFFYLWVCNRWLSYRI----ELIGAL---IVLAAG 1299

Query: 435  SYLVLHGSLTIGDLTAFML--YTEYTGNAIFGLSTFYSEIMQGAGAASRLFELT--DRVP 490
            S+++L+       L    L    ++T  A++ +   YS +     +  RL E T  ++ P
Sbjct: 1300 SFILLNIKSIDSGLAGISLGFAIQFTDGALW-VVRLYSNVEMNMNSVERLKEYTTIEQEP 1358

Query: 491  T-IRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKS 549
            + +   +     P  G+IE K++S  Y      ++ K++ F +     V IVG +G GKS
Sbjct: 1359 SNVGALVPPCEWPQNGKIEVKDLSLRYAAGLP-KVIKNVTFTVDSKCKVGIVGRTGAGKS 1417

Query: 550  TIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTE 609
            TI   L  + +P +G I ID  DIT +  K LR+ I ++ Q+P L +GT++ N+     E
Sbjct: 1418 TIITALFRFLDPETGYIKIDDVDITTIGLKRLRQSITIIPQDPTLFTGTLKTNLD-PYNE 1476

Query: 610  EPTKEEIRTVAKQCFCHNFIVKFPYTYDTY----------------IGPHGTLLSGGQKQ 653
                E    + +     +  +  P T D+                 +   G+ LS GQ+Q
Sbjct: 1477 YSEAEIFEALKRVNLVSSEELGNPSTSDSTSVHSANMNKFLDLENEVSEGGSNLSQGQRQ 1536

Query: 654  RIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRS 713
             I +AR+L++ P +++LDEAT+++D  S+  I  T  +  +  + TI++IAHRL +I   
Sbjct: 1537 LICLARSLLRCPKVILLDEATASIDYNSDSKIQATIRE--EFSNSTILTIAHRLRSIIDY 1594

Query: 714  ENIIVLGNDGSVVE 727
            + I+V+ + G V E
Sbjct: 1595 DKILVM-DAGEVKE 1607

 Score = 97.8 bits (242), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 111/484 (22%), Positives = 212/484 (43%), Gaps = 40/484 (8%)

Query: 270 KHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLEL-- 327
           K  +  D E      +G +I+ +  D++ VS  I   +   ++++I   V + ++  L  
Sbjct: 467 KQHVDGDEESATTANLGAIINLMAVDAFKVSE-ICAYLHSFIEAIIMTIVALFLLYRLIG 525

Query: 328 --SMDLSSVLVCFVIPVVLSASIFG----KQIRINSRELQDATGQLTRVSEEQLNGVRTV 381
             ++  S++++CF+      AS+ G    K + I  + +Q           E    +R +
Sbjct: 526 WSALVGSAMIICFLPLNFKLASLLGTLQKKSLAITDKRIQKLN--------EAFQAIRII 577

Query: 382 QSFVAEQREIKRFNHSIREIFDVGKRAAFINA----KFFTSTSLVGDLSFLTVLVYGSYL 437
           + F  E+   K   ++  E  ++  + + + A     +F + S+V   SF  V +Y    
Sbjct: 578 KFFSWEENFEKDIQNTRDEELNMLLKRSIVWALSSLVWFITPSIVTSASF-AVYIYVQGQ 636

Query: 438 VLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLG 497
            L   +    L+ F L      N +  LS   S ++Q   +  R+ E  +   T +    
Sbjct: 637 TLTTPVAFTALSLFALLR----NPLDMLSDMLSFVIQSKVSLDRVQEFLNEEETKK---Y 689

Query: 498 KTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLH 557
           +  T  + ++  +N +F +     +   K+L    K G    IVGP+G GK+++ + LL 
Sbjct: 690 EQLTVSRNKLGLQNATFTWDKNNQDFKLKNLTIDFKIGKLNVIVGPTGSGKTSLLMGLLG 749

Query: 558 YYNPTSGQILI---DGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKE 614
                +G++ +   + ++   + +  +   IA   Q   L++ T+R+NI +     P  E
Sbjct: 750 EMELLNGKVFVPSLNPREELVVEADGMTNSIAYCSQAAWLLNDTVRNNILFN---APYNE 806

Query: 615 -EIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEA 673
                V   C              T IG  G  LSGGQKQR+++AR+L      L+LD+ 
Sbjct: 807 NRYNAVISACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARSLYSSSRHLLLDDC 866

Query: 674 TSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKF 731
            SA+D  +   I  N   G LM+ ++  +VS  H ++   ++ + +++  +G V E G+ 
Sbjct: 867 LSAVDSHTALWIYENCITGPLMEGRTCVLVS--HNVALTLKNADWVIIMENGRVKEQGEP 924

Query: 732 KELF 735
            EL 
Sbjct: 925 VELL 928

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] {ON}
            YDR135C (YCF1) - metal resistance protein, similar to
            multidrug resistance proteins and cystic fibrosis protein
            CFTR [contig 171] FULL
          Length = 1494

 Score =  127 bits (319), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 126/469 (26%), Positives = 217/469 (46%), Gaps = 39/469 (8%)

Query: 279  FFDVHKVGDLISRLGADSY----IVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSV 334
            FF+   +G +++R   D Y    ++ R+ +Q   + VK      V   +++  S     V
Sbjct: 1020 FFETTPIGRVLNRFSNDIYKVDELLGRTFSQFFVNAVK------VSFTIIVICSSTWQFV 1073

Query: 335  LVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVS-----EEQLNGVRTVQSFVAEQR 389
             V  +IP+      + +     SREL+     +TR       +E L G+ T++ +    +
Sbjct: 1074 FV--IIPLGTLYIYYQQYYLRTSRELR-RLDSVTRSPIYAHFQETLGGISTIRGY----Q 1126

Query: 390  EIKRFNHSIREIFDVGKRAAF--INAKFFTSTSL--VGDLSFLTVLVYGSYLVLHGSLTI 445
            +  RF H  +   D    A +  +NA  + +  L  +G +  L       + +  G+LT 
Sbjct: 1127 QQGRFLHINQARVDNNMSAFYPSVNANRWLAFRLEFIGSIIILGAATLSVFRLKQGALTP 1186

Query: 446  GDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVP----TIRPTLGKTYT 501
            G +   + Y      ++  +     E+     +  R+ E  +  P     I         
Sbjct: 1187 GMIGLSVSYALQITQSLNWIVRMTVEVETNIVSVERIKEYANITPEAPAVIESNRPAEDW 1246

Query: 502  PGKGEIEFKNVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYN 560
            P  G I+F+N S  Y  RP   +  +++N  IKP   + IVG +G GKS++ L L     
Sbjct: 1247 PTHGAIKFENYSARY--RPELDLSLRNINIDIKPQERIGIVGRTGAGKSSLTLALFRIIE 1304

Query: 561  PTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVA 620
               G+I+IDG     +  + LR  ++++ Q+  +  GT+R+NI    T E T EEI    
Sbjct: 1305 AAEGRIIIDGVPTDSIGLRDLRHHLSIIPQDSQVFEGTVRENI--DPTNEYTDEEIWHAL 1362

Query: 621  KQCFCHNFIVKFPY-TYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDV 679
            +     + I        ++ +   G  LS GQ+Q + +ARAL+    IL+LDEAT+A+DV
Sbjct: 1363 ELAHLKDHIKSLGKDELESMLTEGGGNLSVGQRQLMCLARALLIPTRILVLDEATAAVDV 1422

Query: 680  ESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEM 728
            E++  I  T     K++  TI++IAHR++TI  S+ I+VL + G + E 
Sbjct: 1423 ETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKIAEF 1468

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 117/502 (23%), Positives = 225/502 (44%), Gaps = 62/502 (12%)

Query: 264 LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSR-----SITQKISDGVKSLICGG 318
           L SV+ + +L   +E       GD+++ +  D   V R        Q I  G   LI   
Sbjct: 365 LTSVIYQKSLVLSNEASAASSTGDIVNLMSVD---VQRLQDLTQWGQIIWSGPFQLILCL 421

Query: 319 VGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGV 378
           + +  +L  SM +  +++  +IP   ++ I   Q ++   ++++   + TR   E LN +
Sbjct: 422 ISLYKLLGNSMWVGVIIMVIMIPA--NSVIIRYQKKLQKIQMKN-KDERTRTISEILNNI 478

Query: 379 RTVQSFVAE-----QREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVY 433
           ++++ +  E     + +  R    ++ +  +G   A  + +F     LV   +F   +  
Sbjct: 479 KSLKLYAWEVPFREKLDKVRNEKELQNLKRMGITTAIASFQFNIVPFLVSCSTFAVFVWT 538

Query: 434 GSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLF------ELTD 487
                L   L    LT F L +         L++F    ++ + + +RL       EL  
Sbjct: 539 QKDRPLSTDLVFPALTLFNLLSFPLAIIPTALTSF----IEASVSVNRLHSFLTNEELQR 594

Query: 488 RVPTIRPTLGKTYTPGKGEIEFK---NVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGP 543
                +P + KT     GE+      + +F +  +P  ++  K++NF+ K G   CIVG 
Sbjct: 595 DSVQRKPKVTKT-----GEVAINVGADATFLWQRKPEYKVALKNINFQAKKGELTCIVGK 649

Query: 544 SGKGKSTIALLLLHYYNPTSGQILIDG--QDITKLNS-KSLRRQIAVVQQEPVLMSGTIR 600
            G GKS                 LI G   D+ ++    S+   IA V Q P +M+GT++
Sbjct: 650 VGSGKSA----------------LIQGILGDLFRVKGFASVHGSIAYVSQVPWIMNGTVK 693

Query: 601 DNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARA 660
           +NI +G   +   +   T  + C     +   P   +T +G  G  LSGGQK RI++ARA
Sbjct: 694 ENILFG--HKYDADFYDTTLRACALAVDLSILPKGDETLVGEKGISLSGGQKARISLARA 751

Query: 661 LIKKPNILILDEATSALDVE-SEGAINYTFGQ--LMKSKSMTIVSIAHRLSTIRRSENII 717
           +  + +  +LD+  +A+D   ++  I +  G   L+ SK   + +  +++S +  +++I 
Sbjct: 752 VYARADTYLLDDPLAAVDEHVAKHLIEHVLGSQGLLSSKVKVLAT--NKISVLSIADHIS 809

Query: 718 VLGNDGSVVEMGKFKELFADPT 739
           +L N G +++ G ++E+ +D +
Sbjct: 810 LLEN-GEIIQQGSYEEVTSDKS 830

>KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {ON}
            Anc_4.52 YLL015W
          Length = 1536

 Score =  127 bits (319), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 84/247 (34%), Positives = 131/247 (53%), Gaps = 15/247 (6%)

Query: 502  PGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNP 561
            P +G IEFKN +  Y    S  + K+++  I P   V IVG +G GKST++L L      
Sbjct: 1281 PQRGSIEFKNYTTTYRANLS-PVLKNISVTINPSEKVGIVGRTGAGKSTLSLALFRILEA 1339

Query: 562  TSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAK 621
              G I IDG DI+++    LR  +A++ Q+     GT+R N+     ++ T  E+  V +
Sbjct: 1340 AEGTIFIDGVDISRIGLTDLRGNMAIIPQDAQAFEGTVRSNL--DPFQKHTDVELWNVIE 1397

Query: 622  QCFCHNFIVKFPYT---------YDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDE 672
                   +++              D  I  +G+ LS GQ+Q + +ARAL+ +  +L+LDE
Sbjct: 1398 LSHLKPHVLRMAEDDNLSGNLSGLDAKINENGSNLSVGQRQLLCLARALLNQSKVLVLDE 1457

Query: 673  ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFK 732
            AT+A+DVE++  I  T     K +  TI++IAHRL TI  ++ I+VL + G V E    K
Sbjct: 1458 ATAAVDVETDKIIQETIRTQFKDR--TILTIAHRLDTIMDNDKILVL-DAGGVKEFDSPK 1514

Query: 733  ELFADPT 739
             L +D +
Sbjct: 1515 NLLSDES 1521

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 102/439 (23%), Positives = 199/439 (45%), Gaps = 65/439 (14%)

Query: 334 VLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKR 393
           V++  ++PV    S   K+++  ++          +   E LN +++++ +  E+  +++
Sbjct: 434 VMMVIMLPV---NSYLSKKVKTLTKTQMKYKDARIKTITEILNSMKSIKLYAWEKPMMQK 490

Query: 394 FNHSIREIFDVG--KRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLV-----LHGSLTIG 446
            +H +R   ++G  K+    +   + + + V  L  +T   +G + +     L   L   
Sbjct: 491 LDH-VRNDLEIGNLKKIGIASNLIYFAWNCVPLL--VTCSTFGIFTLISDEPLTPELVFP 547

Query: 447 DLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRL--FELTDRVPTIRPTLGKTYTPGK 504
            L+ F +  E    AI+ + +  + +++   + +RL  F L++ +   R  + +T  P  
Sbjct: 548 ALSLFNILNE----AIYAIPSTINTMIEVTVSLNRLKKFLLSEELD--RSFIEQTGKPAN 601

Query: 505 GEI---EFKNVSFAYPTRPSNQIFKSLN-------------------FKIKPGSNVCIVG 542
             I   E +N +F + ++   Q+  S N                   F   P S  C++G
Sbjct: 602 EYIPAVEIENATFLWKSQA--QLINSENDDSEANIETTQVALKNIDHFTASPKSLTCVIG 659

Query: 543 PSGKGKSTIALLLLHYYNPTSGQI-LIDGQDITKLNSKSLR-RQIAVVQQEPVLMSGTIR 600
             G GK+T+   +L       GQ+  I G   +     S+R   IA   QE  +M+ TI+
Sbjct: 660 KVGSGKTTLLKAIL-------GQLPCISGSKESISPKLSIRGESIAYCPQEAWIMNDTIK 712

Query: 601 DNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARA 660
           +NI +G   + T   + TVA      +F +  P    T +G  G  LSGGQK R+++ARA
Sbjct: 713 ENILFGHKFDETYYTL-TVAACELLADFDI-LPDGDQTLVGEKGISLSGGQKARVSLARA 770

Query: 661 LIKKPNILILDEATSALDVE-----SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSEN 715
           +  + +I +LD+  SA+D        E  ++   G L   ++ T++   + +S ++ S+ 
Sbjct: 771 VYSRADIYLLDDILSAVDAGVSKKIVENVLDSNSGLL---RNKTVILSTNTVSVLKHSQL 827

Query: 716 IIVLGNDGSVVEMGKFKEL 734
           I  L N G +VE G + ++
Sbjct: 828 IYALEN-GIIVERGNYNDI 845

>TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_5.10
            YGR281W
          Length = 1477

 Score =  126 bits (317), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 133/506 (26%), Positives = 217/506 (42%), Gaps = 56/506 (11%)

Query: 269  MKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELS 328
            +K  +H    F D   +G +++R   D+  +   + + +   V S     VG+ +M  + 
Sbjct: 973  LKRIIHTPMSFMDTTPIGRILNRFTKDTDSLDNELIENVRLTV-SQFANIVGVCVMCIVY 1031

Query: 329  MDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATG-QLTRVSE---EQLNGVRTVQSF 384
            +   ++ V F++ + +         +   RE++     Q + V     E L G+ T++ +
Sbjct: 1032 LPWFAIAVPFLVFIFV---FIQNHYQSAGREIKRLEAIQRSFVYNNFNEILGGMDTIKFY 1088

Query: 385  VAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLT 444
             +E+R I + ++ I ++ + G     +         ++     L + +       H S +
Sbjct: 1089 KSEERYIAKSDYLIDKMNEAGYLTVCVQRWVAILVDMIAVAFALIITLLCVTRQFHISAS 1148

Query: 445  -IGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYT-- 501
             +G L  ++L      N +       S++     +  RL      +P +     K  T  
Sbjct: 1149 SVGVLLTYVLQLPGLFNTLLRA---VSQVENDMNSTERLVSYATDLP-LEAQYHKPETAP 1204

Query: 502  ----PGKGEIEFKNVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLL 556
                P +G I+F+NV FAY  RP   I  K++N +I     + I G +G GKSTI   L 
Sbjct: 1205 PESWPEEGTIKFENVDFAY--RPGLPIVLKNINLQINGTEKIGICGRTGAGKSTIMTALY 1262

Query: 557  HYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEI 616
                 TSG ILID  DI KL    LR+++A++ Q+PVL  G IR N+      E T EE+
Sbjct: 1263 RLNELTSGSILIDDVDINKLGLHELRKKLAIIPQDPVLFRGDIRKNL--DPFHERTDEEL 1320

Query: 617  RTV-----------------------AKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQ 653
              V                             H F +      D  +   G   S G++Q
Sbjct: 1321 WDVLVRGGAIAPEDLAETKAQHITEDGTSADLHKFHL------DKVVEEDGANFSLGERQ 1374

Query: 654  RIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRS 713
             +A+ RAL++   ILILDEATS++D E++  I             TI+ IAHRL TI   
Sbjct: 1375 ILALTRALVRNTKILILDEATSSVDYETDRKIQERIATAF--SHCTILCIAHRLKTILNY 1432

Query: 714  ENIIVLGNDGSVVEMGKFKELFADPT 739
            + I+VL + G V E      LF D T
Sbjct: 1433 DRILVLEH-GEVAEFDTPMNLFKDET 1457

 Score =  101 bits (252), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 110/206 (53%), Gaps = 20/206 (9%)

Query: 525 FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQ 584
           F +LNF+IK G  V I GP G GK+++      +   TSG I I+G              
Sbjct: 612 FTNLNFEIKKGEFVMITGPIGTGKTSLLNSFAGFMEKTSGTIQINGD------------- 658

Query: 585 IAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHG 644
             ++   P + + T+RDNI +G   E  +++ + V + C   + +   P    T IG  G
Sbjct: 659 -LLMGGYPWIQNATVRDNIIFGSPYE--EDKYKEVLRACSLESDLDILPAGDKTEIGERG 715

Query: 645 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 703
             LSGGQK RI +AR + K+ +I +LD+  SA+D    +  ++    +L+ +K+  + + 
Sbjct: 716 ITLSGGQKARINLARCVYKEKDIYLLDDVLSAVDSRVGKHIMDECLTKLIGNKTRLLAT- 774

Query: 704 AHRLSTIRRSENIIVLGNDGSVVEMG 729
            H+LS I ++  IIVLGNDGS VE+G
Sbjct: 775 -HQLSLIDKASRIIVLGNDGS-VEIG 798

>Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON}
            YHL035C (REAL)
          Length = 1587

 Score =  126 bits (316), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 141/509 (27%), Positives = 241/509 (47%), Gaps = 76/509 (14%)

Query: 273  LHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLI-CGGVGIGMMLELSMDL 331
            LH +  FFDV  VG +++R   D   V + +   +   +  LI C  +     + L   +
Sbjct: 1084 LHANIRFFDVTPVGRIMNRFAKDIEGVDQELIPYLEVTIFCLIQCLSI-----IFLITII 1138

Query: 332  SSVLVCFVIPVVLSASIFGKQIRINSRELQ--DATGQ--LTRVSEEQLNGVRTVQSFVAE 387
            +   +   + V++     GK      REL+  D+  +  + +   E L GV T+++F  E
Sbjct: 1139 TPRFLVVAVVVLVLYYFVGKCYLSAGRELKRIDSITKSPIFQYFSETLAGVCTIRAFGDE 1198

Query: 388  QREIKRFNHSIREIFDVGKRAAF---INAKFFT-STSLVGDLSFLTVLVYGSYLVLHGSL 443
                KRF     +  D   RA F   +  K+F     ++G  +F+ VL  GS+++L+   
Sbjct: 1199 ----KRFILENMDKIDQNNRAFFYLSVAVKWFAFRVDIIG--AFI-VLGSGSFILLN--- 1248

Query: 444  TIGDLTAFMLYTEYTGNAIF-----GLSTFYSEIMQGAGAASRLFELT---------DRV 489
             IGD+ + +     T + +F      L   YS       +  RL E +         + +
Sbjct: 1249 -IGDIDSSLAGISLTYSILFTDGALWLVRLYSTFEMNMNSVERLKEYSGIEQENYNENHI 1307

Query: 490  PTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKS 549
              ++ +L     P  G+IE  N+S  Y +     + K+++F + P + + IVG +G GKS
Sbjct: 1308 QALQNSLW----PEHGKIEVDNLSLRYASNLP-PVIKNVSFTVDPQTKIGIVGRTGAGKS 1362

Query: 550  TIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNIT-YGLT 608
            TI   L     P +G I IDG DI+K++  +LRR I ++ Q+P+L +GTI+ N+  Y   
Sbjct: 1363 TIITALFRLLKPVTGCIKIDGYDISKIDLVTLRRAITIIPQDPILFTGTIKSNLDPYDEY 1422

Query: 609  EE-------------PTKEEIRTVAKQ---CFCHNFIVKFPYTYDTYIGPHGTLLSGGQK 652
            +E              ++E   T+ ++      HN  +       T I   G  LS G+K
Sbjct: 1423 DERRIFKVLSQVNLISSRELEETLNREENFSGVHNRFLNLR----TEIVEGGLNLSQGEK 1478

Query: 653  QRIAIARALIKKPNILILDEATSALDVES----EGAINYTFGQLMKSKSMTIVSIAHRLS 708
            Q + IAR+L+++P I++LDEATS++D +S    +G I   F +       TI++IAHRL 
Sbjct: 1479 QLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRNEFSR------STILTIAHRLR 1532

Query: 709  TIRRSENIIVLGNDGSVVEMGKFKELFAD 737
            ++   + ++V+ + G V E     EL  +
Sbjct: 1533 SVIDYDKVLVM-DAGEVKEYDHPYELLKN 1560

 Score = 97.8 bits (242), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 139/524 (26%), Positives = 234/524 (44%), Gaps = 65/524 (12%)

Query: 257 SERLVARLRSVVMKHTLHQ--DSEFFDVHKVGD-----------LISRLGADSYIVSRSI 303
           S+++  R+RS+++     +    + F   KV D           +I+ +  DS+ VS  I
Sbjct: 402 SDKICLRVRSILISEIYSKALRRKLFTSPKVNDDKDSASANLGTVINLISIDSFKVSE-I 460

Query: 304 TQKISDGVKSLICGGVGIGMM-----LELSMDLSSVLVCFVIPVVLSASIFGKQIRINSR 358
           +  I   V+++I   + I ++     L     +S +LV F +   L AS+ G   R    
Sbjct: 461 SNCIYTTVQAVIMILIVIVLLFKFLGLSALAGISIILVMFPLNFKL-ASLLG---RCQEL 516

Query: 359 ELQDATGQLTRVSEEQLNGVRTVQSFVAEQR---EIKRFNH-SIREIFDVGKRAAFINAK 414
            L+    +++R++E  L  +R V+ F  E     +IK      ++ +F      A  +  
Sbjct: 517 ALRCTDERISRLNE-CLQNIRIVKYFAWENNISNDIKSSRQKELKFLFRKSLLWAVSSFL 575

Query: 415 FFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQ 474
           +F + +LV  ++F  V ++     L+  L    L+ F L        +  LS   S + Q
Sbjct: 576 WFVTPTLVTSVTF-AVYIFVQQQELNAPLAFTTLSLFTLLK----TPLDQLSNMLSFMNQ 630

Query: 475 GAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFK----SLNF 530
              +  R+ E  +   T +     T +P K +I+FK  +  +     N I K     LN 
Sbjct: 631 SKVSLERIVEFLNEEDTAKYN-QLTVSPDKNKIKFKKATLVW-NENDNDINKFRLCDLNI 688

Query: 531 KIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQD-----ITKLNSKSLRRQI 585
             + G    I+G +G GKS + + LL      SG I++ G +     I  LN   L    
Sbjct: 689 NFRIGKLNLILGSTGSGKSALLMGLLGELYLLSGSIIVPGLEPRHDMIPDLNG--LTNSF 746

Query: 586 AVVQQEPVLMSGTIRDNITY-GLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHG 644
           A   Q   L++GT+R+NI + G+ +E      + V   C     +   P    T IG  G
Sbjct: 747 AYCSQSAWLLNGTVRNNIIFNGVYDE---NRYKNVIDACGLKRDLEILPAGDSTEIGEKG 803

Query: 645 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTF---GQLMKSKSMTIV 701
             LSGGQKQRI++ARA+      ++LD+  SA+D  +   I Y     G LMK+++  +V
Sbjct: 804 ITLSGGQKQRISLARAIYSNAKHVLLDDCLSAVDSHTAIWI-YEICITGLLMKNRTCILV 862

Query: 702 SIAHRLS-TIRRSENIIVLGN-----DGSVVEM---GKFKELFA 736
           +  H +S  IR++   ++L N      G++ E+   G FKE F 
Sbjct: 863 T--HNISLAIRKAYFAVILENGKVKSQGTITELKNKGVFKEDFG 904

>ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} similar
            to uniprot|P14772 Saccharomyces cerevisiae YLL015W BPT1
            ABC type transmembrane transporter of MRP/CFTR family
            found in vacuolar membrane involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates along with Ycf1p
          Length = 1570

 Score =  126 bits (316), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 129/493 (26%), Positives = 224/493 (45%), Gaps = 55/493 (11%)

Query: 279  FFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCF 338
            FF+   +G +I+R  +D   V R++    +   K ++   V I   L +  ++   LV F
Sbjct: 1077 FFESTPIGRIINRFSSDMSTVDRNLKYNFAFFFKCVLDYFVTI---LLIGYNMPWFLV-F 1132

Query: 339  VIPVVLSASIFGKQIRINSRELQ----DATGQLTRVSEEQLNGVRTVQSFVAEQREIKRF 394
               +++    +       SREL+     A   +  +  E L G   + +F    R  +RF
Sbjct: 1133 NAGLLVVYVYYQVFYVTLSRELKRLSSTAFSPIMSLFSETLGGHMVITAF----RHSERF 1188

Query: 395  NHSIREIFDVGKRAAFINAKF-FTSTS---------LVGDLSFLTVLVYGSYLVLHGSLT 444
            +       +  K    I+A+F   ST+         + G +  +T L+  + +     +T
Sbjct: 1189 H-----FLNFNKTQFQIDAQFNLRSTNRWLSIRLQIIGGAMVLITALLTLATIGTKKQMT 1243

Query: 445  IGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGK 504
             G +   M Y     N++  +    + I     +  R++E   ++P+  P + ++  P K
Sbjct: 1244 AGLVGLLMSYVLQVTNSLMWIVRMTTMIETNIISVERIYEYC-QLPSEAPAIIESSRPEK 1302

Query: 505  -----GEIEFKNVSFAYPTRPS-NQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHY 558
                 GEI FK+ S  Y  RP  + + K +N  IKP   + +VG +G GKS+++L L   
Sbjct: 1303 SWPSMGEIIFKDYSTKY--RPELDPVLKKINLSIKPREKIGVVGRTGAGKSSLSLALFRL 1360

Query: 559  YNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRT 618
               T G I IDG DI+K+    LR  ++++ Q+     GT+R N+      + + +EI  
Sbjct: 1361 LESTGGSIEIDGVDISKIGLYDLRSHLSIIPQDAQAFEGTVRSNL--DPFNQYSVQEIWK 1418

Query: 619  VAKQCFCHNFIVKFPY--------------TYDTYIGPHGTLLSGGQKQRIAIARALIKK 664
              +       I+K                   D  I  +G  +S GQ+Q + ++RAL+ K
Sbjct: 1419 AVELAHLKPHIIKMMTDEDPDKSSPEDEISALDVKISENGNNMSMGQRQLLCLSRALLSK 1478

Query: 665  PNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGS 724
              +L+LDEAT+A+D+E++  I  T     + K  TI++IAHR+ T+  S+ I+VL + G 
Sbjct: 1479 SKVLVLDEATAAVDMETDQIIQETIRNEFQDK--TILTIAHRIDTVLDSDKILVL-DKGE 1535

Query: 725  VVEMGKFKELFAD 737
            V E      L  D
Sbjct: 1536 VKEFESPDTLLKD 1548

 Score = 80.1 bits (196), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 97/403 (24%), Positives = 178/403 (44%), Gaps = 65/403 (16%)

Query: 369 RVSEEQLNGVRTVQSFVAEQREIKRFNH-----SIREIFDVGKRAAFINAKFFTSTSLVG 423
           R + E LN +++++ +  E+  ++R NH      I+    +G     I   +     L+ 
Sbjct: 484 RATTEILNSMKSIKLYAWEKPMLQRLNHVRNDLEIKNFAKMGVVETLITFAW-NCVPLMV 542

Query: 424 DLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASR-- 481
             S   +    S   L   +    L+ F    E   +AI+ +    ++I++   +  R  
Sbjct: 543 SCSTFLLFSLISSSPLSPEIVFPALSLF----EILNDAIYSVPNAITDIIETKVSMGRVR 598

Query: 482 ------------LFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRP--------- 520
                       + EL D V   +PT           IE  N +F + +           
Sbjct: 599 TFLQTENLDDSFIHELKDEVDGPKPT-----------IEVNNATFLWQSEKTLKSNDEEA 647

Query: 521 ---SNQI-FKSLN-FKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG-QILIDGQDIT 574
              S+Q+  ++++ F+ K G+  C+VG  G GKST+   +L      SG +  I  + + 
Sbjct: 648 NVGSSQVALENIDHFEAKKGALTCVVGRVGSGKSTLLRAILGQLPCRSGPKEFISPEILV 707

Query: 575 KLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPY 634
           +       R +A   Q P +M+ +I+DNI +G   + T   +   A Q      I+    
Sbjct: 708 R------ARSVAYCPQAPWVMNASIKDNILFGHRYDETYYNLTIKACQLIPDLKILS--E 759

Query: 635 TYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQ-- 691
             +T +G  G  LSGGQK R+++ARA+  + ++ ++D+  SA+D E S+  I+   G+  
Sbjct: 760 GDETLVGEKGISLSGGQKARLSLARAVYSRADLYLMDDILSAVDAEVSKNIIDKVLGEEN 819

Query: 692 -LMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKE 733
            L+K K  TI+   + +S ++ S N+I     G +VE G +++
Sbjct: 820 GLLKHK--TIILTTNAVSVLKHS-NMIYALQGGRIVEEGTYEQ 859

>KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1507

 Score =  125 bits (314), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 138/486 (28%), Positives = 226/486 (46%), Gaps = 57/486 (11%)

Query: 268  VMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLEL 327
            ++   LH    FFD    G +++R+  D  I+ + +   +   + ++      +G +L L
Sbjct: 999  ILNRVLHAKMTFFDFTPAGRILNRITRDFEILEQELMVLLLQLLFAI----TSLGAILLL 1054

Query: 328  SMDLSSVLVCFVIPVVLSASIFGKQIRINS-----RELQDATGQLTRVS-----EEQLNG 377
               +S +   F+I   L   I+   + I S     R+L+   G +TR        E L+G
Sbjct: 1055 ---ISVIATKFLIFAFLLGIIYA--VMITSYIPAFRDLKRYEG-ITRSPIFEQFSELLSG 1108

Query: 378  VRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYL 437
              T++ F  E+  + +    +    D+  R A+         S+V     L V V GS L
Sbjct: 1109 FVTIRGFGKEKSCMGQLFRKL----DLNNRPAYY-------VSVVQLWLCLRVEVLGS-L 1156

Query: 438  VLHGSLTIGDLTA----------FMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELT- 486
            VL  + T+  L A           + Y      +    +T  S +     +  R+ E T 
Sbjct: 1157 VLGATATLSLLNAKELGAGLAGLALTYAMPFSQSALWTATVSSNVEIKMTSVERIKEYTE 1216

Query: 487  -DRVPTIRPTLGKTYTPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGSNVCIVGPS 544
             D   T    L  T   G  EI F +V   Y P  P   + K+++F + P S V IVG +
Sbjct: 1217 IDCEDTKAGALINTQWSGGAEISFDHVYVRYAPHLP--DVLKNVSFTLLPNSKVAIVGRT 1274

Query: 545  GKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNIT 604
            G GKST+ + L      T+G I I G DI  LN ++LRR++ V+ Q+P L SGTI+ NI 
Sbjct: 1275 GSGKSTVMMSLFRLIELTNGTIRIGGIDIASLNLQTLRRELTVIPQDPSLFSGTIKSNID 1334

Query: 605  -YGLTEEPTKEEIRTVAKQ--CFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARAL 661
             +G     + +E+   A++   F     V+   +  + +   G  +S GQ+Q + +ARAL
Sbjct: 1335 PFG---RYSDQELTHFARRIGLFSGTDDVRTFNSLGSLVSEGGENMSQGQRQLLCLARAL 1391

Query: 662  IKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGN 721
            ++K  ILILDEAT+++D E++  I         S    ++++AHR+STI   + +IVL  
Sbjct: 1392 LQKSKILILDEATASIDHETDATIQQVVRDF--SSGGIVITVAHRMSTIIDYDQVIVL-- 1447

Query: 722  DGSVVE 727
            D  +V+
Sbjct: 1448 DSGIVK 1453

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 88/342 (25%), Positives = 159/342 (46%), Gaps = 29/342 (8%)

Query: 408 AAFINAKFFTSTSL--VGDLS--FLTVLVYGSYLVLHGS-LTIGD-LTAFMLYTEYTGNA 461
            +F+  K F   +L  V  L+   +T   +G+ + L    +T+    TA  L+     N 
Sbjct: 534 CSFLTKKLFCWATLHLVWFLTPTLVTAATFGASIYLQKQKITVASAYTALTLFA-LLRNP 592

Query: 462 IFGLSTFYSEIMQGAGAASRLFELTDRVPTIR-PTLGKTYTPGKGEIEFKNVSFAYPTRP 520
           +  L+T    I+Q   +  R+ +  +R  T +   L  ++T    E+ F+N S  +    
Sbjct: 593 LTQLATMLGTIIQTTVSIQRIEKFLNRSNTKKHEILKDSFT----EMGFRNASLTWNRFD 648

Query: 521 SNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKS 580
           +  + K+L    +      I+GPSG GKS++ L LL   +   G I      + +     
Sbjct: 649 TGFMLKNLTIDFELHKLNVIIGPSGSGKSSVLLALLGELDLIEGSI-----RVPRGYMHD 703

Query: 581 LRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYI 640
            R   A   Q P + + T+++NI +  + +   +  + V   C     I++     +T +
Sbjct: 704 DRCSFAFCSQTPWITNATVKENIVF--SSQFNTKRYQEVLHACGLEEDILEMQEGDETVV 761

Query: 641 GPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTF-----GQLMKS 695
           G  G  LSGGQ+QR+A+ARA+      L+LD+  SA+D    G   + F     G LMK 
Sbjct: 762 GDKGMTLSGGQRQRLALARAVYSGAEHLLLDDCLSAVD---PGMAVWIFQKCIMGPLMKG 818

Query: 696 KSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFAD 737
           K  T +   H ++ +++  ++I+L ++G V ++GK ++   D
Sbjct: 819 K--TCILATHNIALVQKHADMIILLDNGRVSKIGKARDFNFD 858

>Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  125 bits (314), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 143/551 (25%), Positives = 243/551 (44%), Gaps = 64/551 (11%)

Query: 228  LYEFLGGFSVALFIGCAA--NYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFDVHKV 285
            ++ F+G +S+ L +G AA  N          S R   +L   + K  +     FF+   V
Sbjct: 1017 VWMFVGVYSL-LGVGSAAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPV 1075

Query: 286  GDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLS 345
            G +I+R  +D   V  S+    S   KS++   V I            VLV + +P  L 
Sbjct: 1076 GRIINRFSSDMDAVDSSLQYVFSFFFKSILTYLVTI------------VLVGYNMPWFLV 1123

Query: 346  ASIFGKQIRIN--------SRELQD----ATGQLTRVSEEQLNGVRTVQSFVAEQREIKR 393
             ++F   I I         SREL+     +   +  +  E LNG   + ++   +R I  
Sbjct: 1124 FNMFLLVIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYNHYERFIYL 1183

Query: 394  FNHSIREIFDVGKRAAFINAKFFTSTSLVG-DLSFLTVLVYGSYLVLHGSLTIGDLTAFM 452
                I+   D+      IN         +G  +   T L+  + +     L+ G +   M
Sbjct: 1184 NYDKIQSNIDLVFNFRSINRWLSVRLQTIGATIVLATALLALATINTKNQLSSGMVGLLM 1243

Query: 453  LYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVP---TIRP-TLGKTYTPGKGEIE 508
             Y+    +++  +      I     +  R+ E  +  P   +I P        P +G IE
Sbjct: 1244 AYSFEVTSSLTWIVRTTVMIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSEGRIE 1303

Query: 509  FKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI 568
            FKN S  Y     + + K +N  I+P   + IVG +G GKST++L L     P+ G+I+I
Sbjct: 1304 FKNYSTKY-RENLDPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIII 1362

Query: 569  DGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEP----TKEEIRTVAKQCF 624
            D  +I++L    LR  +A++ Q+     GT+R N+      +P    +++E++   +   
Sbjct: 1363 DDVNISELGLFDLRSNLAIIPQDAQAFEGTVRTNL------DPFNRYSEDELKRAIELAH 1416

Query: 625  CHNFIVKF------------------PYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPN 666
              + + K                       D  I  +G+ LS GQ+Q + +ARAL+    
Sbjct: 1417 LKSHLEKMLGNEAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSK 1476

Query: 667  ILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVV 726
            IL+LDEAT+++D+E++  I  T  +  K +  TI++IAHR+ T+  S+ IIVL + G+V 
Sbjct: 1477 ILVLDEATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DKGNVK 1533

Query: 727  EMGKFKELFAD 737
            E     +L +D
Sbjct: 1534 EFDSPSKLLSD 1544

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 100/400 (25%), Positives = 183/400 (45%), Gaps = 60/400 (15%)

Query: 373 EQLNGVRTVQSFVAEQREIKRFNHSIR---EIFDVGKRAAFINAKFFTSTSLVGDLSFLT 429
           E LN +++++ +  E+  +K+ NH +R   E+ +  K     N  +F    +      +T
Sbjct: 477 ELLNAIKSIKLYAWEEPMMKKLNH-VRNDMELKNFRKIGIVSNLIYFAWNCVP---LMVT 532

Query: 430 VLVYGSYLV-----LHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRL-- 482
              +G + +     L  S+    L+ F +      +AI+ + +  + I++ + +  RL  
Sbjct: 533 CSTFGLFSLFNDTPLSPSIVFPSLSLFNI----LNSAIYSVPSMINSIIETSVSMERLKS 588

Query: 483 FELTDRVPTIRPTLGKTYTPGKGE----IEFKNVSFAYPTRP------------------ 520
           F L+D V      + +T +P        +E  N++F + ++                   
Sbjct: 589 FLLSDEVDD--SFIERTNSPSSDSALPVLEMNNITFLWKSKEALASSQLENNSRTDEESI 646

Query: 521 --SNQI-FKSL-NFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKL 576
             S+QI  K++ +F+ K G  +C+VG  G GKST    +L       GQ+         L
Sbjct: 647 MGSSQIALKNIEHFEAKRGDLICVVGRVGAGKSTFLKAIL-------GQLPCMSGSKESL 699

Query: 577 NSKSLRR--QIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPY 634
             K + R   +A   QE  +M+ ++R+NI +G   +  K       K C     +   P 
Sbjct: 700 APKLIIRASSLAYCSQESWIMNASVRENILFG--HKFDKAYYDLTIKACQLLPDLKILPD 757

Query: 635 TYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTF-GQL 692
             +T +G  G  LSGGQK R+++ARA+  + +I +LD+  SA+D E S+  I +   G+ 
Sbjct: 758 GDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKT 817

Query: 693 MKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFK 732
              K+ TI+   + +S ++ S+ I  L N G +VE G ++
Sbjct: 818 ALLKNKTIILTTNTVSILKHSQMIYALEN-GEIVEQGNYE 856

>Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W
           (REAL)
          Length = 990

 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 144/545 (26%), Positives = 243/545 (44%), Gaps = 52/545 (9%)

Query: 228 LYEFLGGFSVALFIGCAA--NYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFDVHKV 285
           ++ F+G +S+ L +G AA  N          S R   +L   + K  +     FF+   V
Sbjct: 446 VWMFVGVYSL-LGVGSAAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPV 504

Query: 286 GDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLS 345
           G +I+R  +D   V  S+    S   KS++   V I            VLV + +P  L 
Sbjct: 505 GRIINRFSSDMDAVDSSLQYVFSFFFKSILTYLVTI------------VLVGYNMPWFLV 552

Query: 346 ASIFGKQIRIN--------SRELQD----ATGQLTRVSEEQLNGVRTVQSFVAEQREIKR 393
            ++F   I I         SREL+     +   +  +  E LNG   + ++   +R I  
Sbjct: 553 FNMFLLVIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYNHYERFIYL 612

Query: 394 FNHSIREIFDVGKRAAFINAKFFTSTSLVG-DLSFLTVLVYGSYLVLHGSLTIGDLTAFM 452
               I+   D+      IN         +G  +   T L+  + +     L+ G +   M
Sbjct: 613 NYDKIQSNIDLVFNFRSINRWLSVRLQTIGATIVLATALLALATINTKNQLSSGMVGLLM 672

Query: 453 LYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVP---TIRP-TLGKTYTPGKGEIE 508
            Y+    +++  +      I     +  R+ E  +  P   +I P        P +G IE
Sbjct: 673 AYSFEVTSSLTWIVRTTVMIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSEGRIE 732

Query: 509 FKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI 568
           FKN S  Y     + + K +N  I+P   + IVG +G GKST++L L     P+ G+I+I
Sbjct: 733 FKNYSTKYRENL-DPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIII 791

Query: 569 DGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNIT--YGLTEEPTKEEI---------- 616
           D  +I++L    LR  +A++ Q+     GT+R N+      +E+  K  I          
Sbjct: 792 DDVNISELGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRYSEDELKRAIELAHLKSHLE 851

Query: 617 RTVAKQCFCHNFIVK----FPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDE 672
           + +  +   ++  V+         D  I  +G+ LS GQ+Q + +ARAL+    IL+LDE
Sbjct: 852 KMLGNEAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDE 911

Query: 673 ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFK 732
           AT+++D+E++  I  T  +  K +  TI++IAHR+ T+  S+ IIVL + G+V E     
Sbjct: 912 ATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DKGNVKEFDSPS 968

Query: 733 ELFAD 737
           +L +D
Sbjct: 969 KLLSD 973

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 105/211 (49%), Gaps = 14/211 (6%)

Query: 529 NFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRR--QIA 586
           +F+ K G  +C+VG  G GKST    +L       GQ+         L  K + R   +A
Sbjct: 88  HFEAKRGDLICVVGRVGAGKSTFLKAIL-------GQLPCMSGSKESLAPKLIIRASSLA 140

Query: 587 VVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTL 646
              QE  +M+ ++R+NI +G   +  K       K C     +   P   +T +G  G  
Sbjct: 141 YCSQESWIMNASVRENILFG--HKFDKAYYDLTIKACQLLPDLKILPDGDETLVGEKGIS 198

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTF-GQLMKSKSMTIVSIA 704
           LSGGQK R+++ARA+  + +I +LD+  SA+D E S+  I +   G+    K+ TI+   
Sbjct: 199 LSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTIILTT 258

Query: 705 HRLSTIRRSENIIVLGNDGSVVEMGKFKELF 735
           + +S ++ S+ I  L N G +VE G ++ + 
Sbjct: 259 NTVSILKHSQMIYALEN-GEIVEQGNYESVM 288

>TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1546

 Score =  125 bits (313), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 133/540 (24%), Positives = 232/540 (42%), Gaps = 90/540 (16%)

Query: 264  LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSY----IVSRSITQKISDGVKSLICGGV 319
            L S ++   L     FF+   +G +++R   D Y    ++ R+ +Q  S+ VK       
Sbjct: 1009 LHSQMLASVLRAPMSFFETTPIGRILNRFSNDMYKVDELLGRTFSQFFSNAVK------- 1061

Query: 320  GIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQ--DATGQLTRVS--EEQL 375
             +   L +    +   + F++P+      + +     SREL+  D+  +   +S  +E L
Sbjct: 1062 -VTFTLVVICVSTWQFIFFIVPMSFLYIYYQQYYMRTSRELRRLDSVTRSPTISHFQETL 1120

Query: 376  NGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAF--INAKFFTSTSL--VGDLSFLTVL 431
             G+ T++ +  E R    F H  ++  D    A +  IN   + +  L  +G +  L   
Sbjct: 1121 GGISTIRGYSQENR----FIHINQQRVDNNMSAYYPSINCNRWLAFRLEFLGSVIILGAS 1176

Query: 432  VYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRL---FELTDR 488
              G Y +  G++T G +   + Y      ++  +     E+     +  R+    EL   
Sbjct: 1177 TLGIYRLSQGNMTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSELASE 1236

Query: 489  VPTI----RPTLGKTYTPGKGEIEFKNVSFAYPTRPS---NQIFKSLNFKIKPGSNVCIV 541
             P+I    RP +     P  G ++F +    Y TR     + + K +   IKP   + IV
Sbjct: 1237 APSIVEDKRPDVN---WPQDGAVKFNH----YYTRYRADLDYVLKDITLDIKPREKIGIV 1289

Query: 542  GPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRD 601
            G +G GKS++ L L      + G I +DG +  ++    LR +++++ Q+  +  GT+RD
Sbjct: 1290 GRTGAGKSSLTLALFRIIEASEGNINVDGINTDEIGLYDLRHKLSIIPQDSQVFEGTVRD 1349

Query: 602  NITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPY--------------------------- 634
            NI    T + T EEI    +     + I+                               
Sbjct: 1350 NI--DPTGQYTDEEIWKALELSHLKSHIINMSKHSSSDSSSNESLSPASNNSSGNNDNSN 1407

Query: 635  -----------------TYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSAL 677
                               +T +   G+ LS GQ+Q + +ARAL+   NIL+LDEAT+A+
Sbjct: 1408 SSSDGLTSSGLEDISHNALNTKLSEGGSNLSVGQRQLMCLARALLVPSNILVLDEATAAV 1467

Query: 678  DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFAD 737
            DVE++  I  T     K++  TI++IAHRL+TI  S+ I+VL + G + E    + L  D
Sbjct: 1468 DVETDQLIQETIRSAFKNR--TILTIAHRLNTIMDSDRILVL-DKGEIKEFDSPQTLLGD 1524

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 113/508 (22%), Positives = 229/508 (45%), Gaps = 77/508 (15%)

Query: 264 LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVK--SLICGG--- 318
           + SV+ + +L   +E       GD+++ +  D         Q++ D  +  ++I  G   
Sbjct: 365 MSSVIYQKSLVLSNEASGTSSTGDVVNLMSVD--------VQRLQDVAQWCNIIWSGPFQ 416

Query: 319 -----VGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEE 373
                V +  +L  SM +   ++ F++P+  ++ +   Q ++   ++++   + TR+  E
Sbjct: 417 ITLCLVSLYKLLGNSMWIGVFILIFMMPI--NSYLMRIQKKLQKIQMKNK-DERTRLISE 473

Query: 374 QLNGVRTVQSFVAE-----QREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFL 428
            LN +++++ +  E     + E  R    ++ +  +G   AF + +F     LV   +F 
Sbjct: 474 ILNNIKSLKLYAWEAPYKEKLEYVRNEKELKNLTKMGCYVAFTHFQFNIVPFLVSCSTF- 532

Query: 429 TVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFEL--- 485
            V V+     L   L    LT F L +         +++F    ++ + + +RLF     
Sbjct: 533 AVFVWTQDRPLTTDLVFPALTLFNLLSFPMAAIPIMITSF----IEASISINRLFSFLTN 588

Query: 486 -------TDRVPTIRPTLGKTYTPGKGEIEFK---NVSFAYPTRPSNQI-FKSLNFKIKP 534
                    R+P ++ T         G++  K   + +F +  +P  ++  K++NF+ + 
Sbjct: 589 EELQKDAVQRLPNVKNT---------GDVSIKLGDDATFLWKRKPEYKVALKNINFQARK 639

Query: 535 GSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVL 594
           G   CIVG  G GKS +   +L       G   + G              +A V Q P +
Sbjct: 640 GELTCIVGKVGSGKSALIQSILGDLFRVKGFATVHGD-------------VAYVSQVPWI 686

Query: 595 MSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQR 654
           M+GT+++NI +G   +  K+      K C     +   P    T +G  G  LSGGQK R
Sbjct: 687 MNGTVKENILFG--HKFDKKFYEKTIKACALTIDLSILPDGDSTLVGEKGISLSGGQKAR 744

Query: 655 IAIARALIKKPNILILDEATSALDVESEGA--INYTFGQ--LMKSKSMTIVSIAHRLSTI 710
           +++ARA+  + +  + D+  +A+D E  G   I +  G   L+ SK+  + +  ++++ +
Sbjct: 745 LSLARAVYARADTYLFDDPLAAVD-EHVGKHLIEHVLGPNGLLHSKTKVLAT--NKITVL 801

Query: 711 RRSENIIVLGNDGSVVEMGKFKELFADP 738
             ++ I +L N G +++ GK++E+ +DP
Sbjct: 802 NIADYITLLDN-GEIIQRGKYEEVTSDP 828

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  124 bits (311), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 138/520 (26%), Positives = 230/520 (44%), Gaps = 94/520 (18%)

Query: 263  RLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLI-CGGVGI 321
            ++ ++++   LH    FFD    G +++R   D   + + +T  I     SLI C     
Sbjct: 1136 KIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIEC----- 1190

Query: 322  GMMLELSMDLSSV-LVCFVIPVVLSASIF--------GKQIRINSRELQD----ATGQLT 368
                     LS+V L+ F+ P  LS +I         G      SREL+     +   + 
Sbjct: 1191 ---------LSTVILITFITPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISRSPIY 1241

Query: 369  RVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFL 428
            +   E L GV T+++F  E R ++     I E           N  FF        L+F 
Sbjct: 1242 QHFSETLVGVTTIRAFGDEGRFMQENLQKIDEN----------NKPFFYLWVANRWLAFR 1291

Query: 429  TVLVYGSYLVLHGSLTIGDLTAFMLYT-EYTGNAIFGLSTFYS-EIMQGAGAASRLF--- 483
              ++        GSL I     F+L+   +  + + G+S  Y+    +GA    RL+   
Sbjct: 1292 IDMI--------GSLVIFGAGLFILFNINHLDSGMAGISLTYAISFTEGALWLVRLYAEV 1343

Query: 484  EL----TDRVPTIRPTLGKTYT----------PGKGEIEFKNVSFAY-PTRPSNQIFKSL 528
            E+     +RV        + Y           P  G+IE  ++S  Y P  P  ++ K++
Sbjct: 1344 EMNMNSVERVKEYMEIEQEPYNQHKEVPPPQWPQDGKIEVNDLSLRYAPNLP--RVIKNV 1401

Query: 529  NFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVV 588
            +F +   S + IVG +G GKSTI   L  +  P +G I ID  DI+ ++ + LRR I ++
Sbjct: 1402 SFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITII 1461

Query: 589  QQEPVLMSGTIRDN---------------------ITYGLTEEPTKEEIRTVAKQCFCHN 627
             Q+P L SGTI+ N                     I+   +++ T  E           N
Sbjct: 1462 PQDPTLFSGTIKTNLDPYDEFSDRKIFEALKRVNLISEEQSQQGTTREADNDNSSTNSEN 1521

Query: 628  FIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 687
             + KF     + +   G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  
Sbjct: 1522 -VNKF-LDLSSEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYGSDAKIQE 1579

Query: 688  TFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVE 727
            T  +  + +  TI++IAHRL ++   + I+V+ + G V E
Sbjct: 1580 TIRK--EFQGSTILTIAHRLRSVIDYDKILVM-DAGEVKE 1616

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 105/481 (21%), Positives = 210/481 (43%), Gaps = 44/481 (9%)

Query: 270 KHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSM 329
           + +++ D E      +G +I+ +  D++ VS  I   +   +++ +   V + ++  L +
Sbjct: 460 QKSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALVLLYRL-L 517

Query: 330 DLSSVLVCFVIPVVLSASI-FGKQI-RINSRELQDATGQLTRVSEEQLNGVRTVQSFVAE 387
             ++++   +I  +L  +    K I  +  + L     ++ +++E     +R ++ F  E
Sbjct: 518 GFAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNE-AFQAIRIIKYFSWE 576

Query: 388 QREIKRFNHSIRE-----------IFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSY 436
           +   K  N +IRE           ++ +     F+     T+ S            +  Y
Sbjct: 577 ENFEKDIN-AIRENELSLLLMRSIVWSISSFVWFVTPTIVTAAS------------FAYY 623

Query: 437 LVLHGSL--TIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRP 494
           + + G +  T    TA  L+T    + +  LS   S ++Q   +  R+ +  +   T + 
Sbjct: 624 IYVQGEVLTTPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNEKDT-KK 681

Query: 495 TLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALL 554
               T  P      F+N + ++     +   K LN + K G    ++GP+G GK+++ + 
Sbjct: 682 YDQLTIDPNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMA 741

Query: 555 LLHYYNPTSGQILIDGQDITK---LNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEP 611
           LL      SG++++   +  +   +++      IA   Q   L++ T+++NI +     P
Sbjct: 742 LLGEMYLLSGKVVVPALEPRQELVVDANGTTNAIAYCSQGAWLLNDTVKNNILFN---SP 798

Query: 612 TKE-EIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILIL 670
             E   + V + C              T IG  G  LSGGQKQR+++ARAL      ++L
Sbjct: 799 FNEARYKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLL 858

Query: 671 DEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEM 728
           D+  SA+D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V + 
Sbjct: 859 DDCLSAVDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQ 916

Query: 729 G 729
           G
Sbjct: 917 G 917

>KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1653

 Score =  124 bits (311), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 108/384 (28%), Positives = 181/384 (47%), Gaps = 54/384 (14%)

Query: 373  EQLNGVRTVQSFVAEQREIK----RFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFL 428
            E L GV T+++F  E R ++    + + + R  F +     +++ +      ++G L   
Sbjct: 1239 ETLVGVTTIRAFGDESRFLRENLLKIDENNRPFFYLWVANRWLSFRI----DVIGAL--- 1291

Query: 429  TVLVYGSYLVLHGSLTIGD-------LTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASR 481
              +V+GS + +  ++   D       LT  + +TE        L  FYSE+     +  R
Sbjct: 1292 --VVFGSGIFILTNINTIDSGMAGISLTYAISFTE----GALWLVRFYSEVEMNMNSVER 1345

Query: 482  LFELT-------DRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKP 534
            + E         D V      +   + P +G IE  ++S  Y      ++ K++ F + P
Sbjct: 1346 VHEYMTIEQEPYDEVQVSDSKVPADW-PEEGRIEVSDLSLRYAAHLP-KVIKNVTFNVDP 1403

Query: 535  GSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVL 594
             + V +VG +G GKSTI   L  +    +G I IDG DIT +N   LRR I ++ Q+P L
Sbjct: 1404 RAKVGVVGRTGAGKSTIITALFRFLEAETGYIKIDGLDITSVNLTRLRRSITIIPQDPTL 1463

Query: 595  MSGTIRDNIT-YG-LTEEPTKEEIRTVA----------------KQCFCHNFIVKFPYTY 636
             SGTI+ N+  Y    +E   E +R V                 +       I +F    
Sbjct: 1464 FSGTIKSNLDPYDEYKDEEVFEALRRVNLVTEEELSSRTENNNDEASVSSKNINRF-LDL 1522

Query: 637  DTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSK 696
            ++ I   GT  S GQ+Q I +AR+L++ P IL+LDEAT+++D +S+  +  T     +  
Sbjct: 1523 ESEIAEGGTNFSQGQRQLICLARSLLRSPKILLLDEATASIDYDSDAKVQETIRT--EFS 1580

Query: 697  SMTIVSIAHRLSTIRRSENIIVLG 720
              TI++IAHRL ++   + I+V+G
Sbjct: 1581 ESTILTIAHRLRSVIDYDKILVMG 1604

 Score =  101 bits (252), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 113/470 (24%), Positives = 207/470 (44%), Gaps = 22/470 (4%)

Query: 270 KHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSM 329
           K  ++ D E     K+G +I+ +  DS+ +S  I   +   + +++   V + ++ +L +
Sbjct: 467 KENINGDEESIPSAKLGAVINLMAVDSFKISE-ICAYLHLFIGAIVMVVVALTLLFKL-I 524

Query: 330 DLSSVLVCFVIPVVLSASIF-GKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQ 388
             ++ +   VI +VL  + +    +    RE    T +  +   E    +R ++ F  E 
Sbjct: 525 GYAAFVGVLVILIVLPINFYLANWLGRLQRESLAFTDKRIQKLNETFQAIRIIKFFSWED 584

Query: 389 REIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDL--SFLTVLVYGSYLVLHGSL--T 444
                F+  I +I +         A  +  +  V  L  S +T   +  Y+ + G +  T
Sbjct: 585 N----FSSDIDKIREGELNLLLWRAISWAISGFVWYLTPSIVTTASFTFYIYVQGEVLTT 640

Query: 445 IGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGK 504
               TA  L++    + +  LS   S ++Q   +  R+ +  +   T +     T    K
Sbjct: 641 PVAFTALSLFS-LLRDPLDRLSDMLSFVIQSKVSLDRVQDFLNEEDTDKYN-QLTVATNK 698

Query: 505 GEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG 564
            +I FKN + A+     +   ++LN   K G    I+GP+G GK+++ + LL   N   G
Sbjct: 699 NQIAFKNTTVAWDNSRDSFKLRNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMNLLEG 758

Query: 565 QILIDGQDITK---LNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAK 621
           QI++   +      + S      IA   Q   L++ T+R+NI +      T+     V +
Sbjct: 759 QIVVPALNARHDLIVESDGTTNSIAYCSQAAWLLNDTVRNNILFNSPYNETR--YHNVVE 816

Query: 622 QCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVES 681
            C              T IG  G  LSGGQKQRI++ARAL      ++LD+  SA+D  +
Sbjct: 817 ACGLRRDFEILKAGDMTEIGEKGIALSGGQKQRISLARALYSNSRHVLLDDCLSAVDAHT 876

Query: 682 EGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMG 729
              +  N   G LM+ ++  +VS  H ++   R+ +++V+  DG V + G
Sbjct: 877 ALWVYDNCITGPLMEGRTCILVS--HNIALTLRNADLVVMLEDGQVKDQG 924

>Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  124 bits (310), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 139/519 (26%), Positives = 232/519 (44%), Gaps = 92/519 (17%)

Query: 263  RLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLI-CGGVGI 321
            ++ ++++   LH    FFD    G +++R   D   + + +T  I     SLI C     
Sbjct: 1136 KIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIEC----- 1190

Query: 322  GMMLELSMDLSSV-LVCFVIPVVLSASIF--------GKQIRINSRELQD----ATGQLT 368
                     LS+V L+ F+ P  LS +I         G      SREL+     +   + 
Sbjct: 1191 ---------LSTVILITFITPQFLSIAIVVSILYYFVGYFYMAGSRELKRFESISRSPIY 1241

Query: 369  RVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFL 428
            +   E L GV T+++F  E R ++     I E           N  FF        L+F 
Sbjct: 1242 QHFSETLVGVTTIRAFGDEGRFMQENLQKIDEN----------NKPFFYLWVANRWLAFR 1291

Query: 429  TVLVYGSYLVLHGSLTIGDLTAFMLYT-EYTGNAIFGLSTFYS-EIMQGAGAASRLF--- 483
              ++        GSL I     F+L+  ++  + + G+S  Y+    +GA    RL+   
Sbjct: 1292 IDMI--------GSLVIFGAGLFILFNIDHIDSGMAGISLTYAISFTEGALWLVRLYSEV 1343

Query: 484  EL----TDRVPTIRPTLGKTYT----------PGKGEIEFKNVSFAY-PTRPSNQIFKSL 528
            E+     +RV        + Y           P  G+IE  ++S  Y P  P  ++  ++
Sbjct: 1344 EMNMNSVERVKEYMKIEQEPYNQHKEVPPSQWPQDGKIEVNDLSLRYAPNLP--RVINNV 1401

Query: 529  NFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVV 588
            +F +   S + IVG +G GKSTI   L  +  P +G I ID  DI+ ++ + LRR I ++
Sbjct: 1402 SFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITII 1461

Query: 589  QQEPVLMSGTIRDNIT-YG----------------LTEEPTKEEIRTVAKQCFCHNF--- 628
             Q+P L SGTI+ N+  Y                 ++EE + +     A      N    
Sbjct: 1462 PQDPTLFSGTIKTNLDPYDEFSDKKIFEALKRVNLISEEQSHQGAVREADNDTSSNSSEN 1521

Query: 629  IVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYT 688
            I KF     + +   G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T
Sbjct: 1522 INKF-LDLSSEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQET 1580

Query: 689  FGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVE 727
              +  + +  TI++IAHRL ++   + I+V+ + G V E
Sbjct: 1581 IRK--EFQGSTILTIAHRLRSVIDYDKILVM-DAGEVKE 1616

 Score = 87.8 bits (216), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 106/482 (21%), Positives = 209/482 (43%), Gaps = 46/482 (9%)

Query: 270 KHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSM 329
           + +++ D E      +G +I+ +  D++ VS  I   +   +++ +   V + ++  L +
Sbjct: 460 QKSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALALLYHL-L 517

Query: 330 DLSSVLVCFVIPVVLSASI-FGKQI-RINSRELQDATGQLTRVSEEQLNGVRTVQSFVAE 387
             ++++   +I  +L  +    K I  +  + L     ++ +++E     +R ++ F  E
Sbjct: 518 GFAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNE-AFQAIRIIKYFSWE 576

Query: 388 QREIKRFNHSIRE-----------IFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSY 436
           +   K  N +IRE           I+ +     F+     T+ S            +  Y
Sbjct: 577 ENFEKEIN-TIRENELSLLLMRSIIWSISSFVWFVTPTIVTAAS------------FAYY 623

Query: 437 LVLHGSL--TIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRP 494
           + + G +  T    TA  L+T    + +  LS   S ++Q   +  R+ +  +   T + 
Sbjct: 624 IYVQGEVLTTPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNEKDT-KK 681

Query: 495 TLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALL 554
               T  P       +N + ++     +   K LN + K G    ++GP+G GK+++ + 
Sbjct: 682 YDQLTIDPNGKRFALENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMA 741

Query: 555 LLHYYNPTSGQILIDG----QDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEE 610
           LL      +G+I++      Q++  +++      IA   Q   L++ TI+ NI +     
Sbjct: 742 LLGEMYLLNGKIVVPALEPRQELV-VDANGTTNSIAYCSQGAWLLNDTIKHNILFN---S 797

Query: 611 PTKE-EIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILI 669
           P  E   + V + C              T IG  G  LSGGQKQR+++ARAL      ++
Sbjct: 798 PFNEARYKAVVEACGLKRDFEILKAGDLTEIGEKGIALSGGQKQRVSLARALYSNARHVL 857

Query: 670 LDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVE 727
           LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG + +
Sbjct: 858 LDDCLSAVDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRIKD 915

Query: 728 MG 729
            G
Sbjct: 916 QG 917

>YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative
           transporter of the multidrug resistance-associated
           protein (MRP) subfamily; contains a stop codon in S288C;
           adjacent ORFs YKR103W and YKR104W are merged in
           different strain backgrounds
          Length = 306

 Score =  116 bits (291), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 80/252 (31%), Positives = 134/252 (53%), Gaps = 33/252 (13%)

Query: 502 PGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNP 561
           P  G++E KN+S  Y    S++   +++FK+K G+ V IVG +G GKS+I   +    + 
Sbjct: 28  PQTGDVELKNLSLRYSPH-SSKALDNVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDW 86

Query: 562 TSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNI----------------TY 605
            +G I ID +DI  +  + LR  I+ + Q+P L  GT+R N+                  
Sbjct: 87  ENGTITIDNKDIKHIPLERLRNSISCIPQDPTLFDGTVRSNLDPFDRYSDVQIYGVLSKV 146

Query: 606 GLTEEPTKEEIRTVAKQ----CFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARAL 661
           GL EE   +E+  + +Q       H    +F    +T +   G+ LS GQ+Q + +AR++
Sbjct: 147 GLIEEC--DELCLIFEQEQPNFSSHKLRNRF-IDLNTVVKSGGSNLSQGQRQLLCLARSM 203

Query: 662 IKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGN 721
           +   NI+++DEAT+++D  S+  I  T  + M  K+ TI++IAHRL ++   + I+V+  
Sbjct: 204 LGARNIMLIDEATASIDYISDAKIQKTIRETM--KNTTILTIAHRLRSVIDYDKILVM-- 259

Query: 722 DGSVVEMGKFKE 733
                EMG+ KE
Sbjct: 260 -----EMGRVKE 266

>SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa]
            {ON} similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1558

 Score =  122 bits (307), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 86/257 (33%), Positives = 131/257 (50%), Gaps = 26/257 (10%)

Query: 502  PGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNP 561
            P +G I F+N S  Y     + + K +  +IKP   + IVG +G GKST++L L     P
Sbjct: 1292 PSRGAITFQNYSTKY-RENLDPVLKDITVEIKPQEKIGIVGRTGAGKSTLSLALFRLLEP 1350

Query: 562  TSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNIT-YGLTEEPTKEEIRTVA 620
            + G I+IDG DI KL    LR  +A++ Q+     GTI+ N+  +G   + + EEI    
Sbjct: 1351 SGGSIVIDGIDIAKLGLSDLRGNLAIIPQDAQAFEGTIKSNLDPFG---QYSDEEIWRAL 1407

Query: 621  KQCFCHNFIVKFPYTYDT------------------YIGPHGTLLSGGQKQRIAIARALI 662
            +       I+K     +T                   I  +G  LS GQ+Q + ++RAL+
Sbjct: 1408 ELSHLKPHILKMASEENTENSETTTEATRSHELLSARITENGGNLSIGQRQLLCLSRALL 1467

Query: 663  KKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGND 722
                IL+LDEAT+A+D+E++  I  T     K +  TI++IAHR+ T+  S+ I+VL + 
Sbjct: 1468 NHSKILVLDEATAAVDMETDKIIQETIKTAFKDR--TILTIAHRIDTVMDSDKIMVL-DK 1524

Query: 723  GSVVEMGKFKELFADPT 739
            G V E      L AD +
Sbjct: 1525 GEVKEFDTPTNLLADKS 1541

 Score = 84.3 bits (207), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 113/497 (22%), Positives = 214/497 (43%), Gaps = 53/497 (10%)

Query: 264 LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSI--TQKISDGVKSLICGGVGI 321
           L S+V + +L+      +    GD+++ +  D   + R    +Q I      L+   + +
Sbjct: 366 LMSMVYQKSLNLSVSAREQKSTGDILNLMSVDVLKIQRFFENSQTIIGAPIQLVVVLISL 425

Query: 322 GMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTV 381
            ++L  +     V +  +IP+    S   K+++   R          +   E LN V+++
Sbjct: 426 YILLGNATIGGLVTMAIMIPI---NSFLSKKVKTLYRTQMKYKDARIKTITEILNSVKSI 482

Query: 382 QSFVAEQREIKRFNHSIR--EIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYG--SYL 437
           + +  E+  ++R +H     E+ +  K     N  +F    +   ++  T  ++   S +
Sbjct: 483 KLYAWEKPMLERLDHCRNGLELENFKKIGIVSNLIYFAWKCIPVAVTCSTFAIFSLTSDM 542

Query: 438 VLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRL--FELTDRVPTIR-P 494
            L   +    L+ F +      + I+ + +  + I++   +  RL  F L + +      
Sbjct: 543 PLSPQIVFPSLSLFNI----LNDCIYSIPSTINNIIETGVSIKRLKDFLLAEELDDFFIE 598

Query: 495 TLGKTYTPGKGEIEFKNVSFAYPTRP----------------SNQIFKSL-NFKIKPGSN 537
            L    T     IE  N +F + +                  +    K++ +F+ + G  
Sbjct: 599 RLDANATSNSPAIEIYNATFLWKSTKGLKEDENYDEEAAVASTKVALKNIRHFEARKGDL 658

Query: 538 VCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSG 597
            CIVG  G GKST    +L      SG   +D     KL  ++  + IA   Q+P +M+ 
Sbjct: 659 TCIVGRVGSGKSTFLQAILGQLPCISG---LDEHVPPKLIIRA--KSIAYCPQQPWIMNA 713

Query: 598 TIRDNITYG--LTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRI 655
           +++DN+ +G  L E+  K  IR    +C     +   P    T +G  G  LSGGQK R+
Sbjct: 714 SLKDNVIFGHRLNEDYYKATIR----KCQLLPDLDILPDGDQTLVGEKGISLSGGQKARL 769

Query: 656 AIARALIKKPNILILDEATSALDVE-----SEGAINYTFGQLMKSKSMTIVSIAHRLSTI 710
           ++ARA+  + ++ +LD+  SA+D E      E  +N   G L   K+ T++   + +S +
Sbjct: 770 SLARAVYARADVYLLDDILSAVDAEVSKNIVEQVLNRGTGIL---KNKTVILTTNAVSVL 826

Query: 711 RRSENIIVLGNDGSVVE 727
           + S+NI  L  DG +VE
Sbjct: 827 KHSQNIYALL-DGEIVE 842

>TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1465

 Score =  122 bits (305), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 130/511 (25%), Positives = 231/511 (45%), Gaps = 60/511 (11%)

Query: 261  VARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVG 320
            V  L++V  +  LH    + D   +G +++R   D+  +   +T+ +   +       +G
Sbjct: 957  VLNLKAV--ERVLHTPMAYMDTTPIGRILNRFTKDTDSLDNELTESLRLFMTQF-ANIIG 1013

Query: 321  IGMMLELSMDLSSVLVCFVIPV-VLSASIF---GKQI-RINSRELQDATGQLTRVSEEQL 375
            + +M  + +   ++ + F++ + VL A  +   G+++ R+++ +       L  V    L
Sbjct: 1014 VCVMCIIYLPWFAIAIPFLVLIFVLIADHYQASGREVKRLDAIQRSFVYNNLNEV----L 1069

Query: 376  NGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFIN---AKFFTSTSLVGDLSFLTVLV 432
             G+ T++++ +++R + + +  I ++ + G     +    A F    ++   L    + V
Sbjct: 1070 GGMDTIKAYGSQERFLVKTDFLINKMNEAGYLLVALQRWVAIFLDMIAVAFALIISLLCV 1129

Query: 433  YGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPT- 491
               + +   S  +G L  ++L      N I    T   +      +A RL    + +P  
Sbjct: 1130 TRQFHISPAS--VGVLLTYVLQLPGLLNTILRALT---QTENDMNSAERLVYCANELPLE 1184

Query: 492  ---IRPTLGKTYT-PGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGSNVCIVGPSGK 546
                RP L    + P KGEI F++VSFAY P  P   + K ++  IK    + I G +G 
Sbjct: 1185 ADYKRPELAPPESWPSKGEIVFEDVSFAYRPGLPV--VLKGISLDIKSQEKIGICGRTGA 1242

Query: 547  GKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYG 606
            GKSTI   L      + G+I ID  DI ++    LR++++++ Q+PVL  GTIR N+   
Sbjct: 1243 GKSTIMSALYRLNELSDGKIFIDSVDIGQIGLYDLRKKLSIIPQDPVLFRGTIRKNLD-P 1301

Query: 607  LTEEP--------------TKEEIRTVAKQ--------CFCHNFIVKFPYTYDTYIGPHG 644
              E P              + EE+  V  Q           H F +      D  +   G
Sbjct: 1302 FQEHPDELLWKSLVSGGAISAEEVEVVKGQKPDSIGSLSSMHKFHL------DQKVEEEG 1355

Query: 645  TLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 704
               S G++Q +A+ RAL+++  ILILDEATS++D E++  I             TI+ IA
Sbjct: 1356 ANFSLGERQLLALTRALVRQSKILILDEATSSVDYETDNKIQSRIAAAF--GDCTILCIA 1413

Query: 705  HRLSTIRRSENIIVLGNDGSVVEMGKFKELF 735
            HRL TI   + I+VL   G + E    + L+
Sbjct: 1414 HRLKTILTYDRILVL-EQGEIEEFDTPRSLY 1443

 Score = 97.8 bits (242), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 103/212 (48%), Gaps = 22/212 (10%)

Query: 525 FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQ 584
           FK+LN  IK G  V I GP G GKS++   +  +   TSG + +DG              
Sbjct: 596 FKNLNIDIKKGDFVMITGPIGTGKSSLLSAMAGFMRKTSGTVEVDGD------------- 642

Query: 585 IAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHG 644
             ++   P + + T+RDNI +G   +  KE    V + C     I   P    T IG  G
Sbjct: 643 -LLMCGYPWIQNATVRDNIIFGSPYD--KERFDEVVRVCSLKADIDILPGGELTEIGERG 699

Query: 645 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVS 702
             LSGGQK RI +AR++ K  +I + D+  SA+D      I      G+L   K  T + 
Sbjct: 700 ITLSGGQKARINLARSVYKDKDIFLFDDVLSAVDSRVGKHIMDECLLGRL---KGKTRIL 756

Query: 703 IAHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
             H+LS I ++  +IVLG DGS  E GK ++L
Sbjct: 757 ATHQLSLIEKASVVIVLGVDGS-FEAGKLEDL 787

>KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} similar
            to uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1454

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 130/498 (26%), Positives = 229/498 (45%), Gaps = 44/498 (8%)

Query: 269  MKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELS 328
            ++  LH    F DV  +G +++R   D+     ++  +I++ V+ LI     I  +  + 
Sbjct: 949  LQRLLHAPMSFMDVTPIGRVMNRFTKDT----DTLDNEITESVRLLI---FQIANLTGII 1001

Query: 329  MDLSSVLVCFVI--PVVLSASIF-GKQIRINSRELQ--DATGQ--LTRVSEEQLNGVRTV 381
            +     +  F I  P ++   +F     + + RE++  DA  +  +     E L G+ T+
Sbjct: 1002 ILCIIYIPWFAIAMPFLVFLYVFVADHYQASGREIKRMDAVQRSFVYNNFNEVLGGMDTI 1061

Query: 382  QSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHG 441
            +++ +EQR + + +  I ++ + G     I      S  ++  +  L + +       H 
Sbjct: 1062 KAYRSEQRFLMKSDFLINKMNEAGYLVTSIQRWVAISLDMLAVIFALIIALLCVTRQFHV 1121

Query: 442  SL-TIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPT-----IRPT 495
            S  ++G +  ++L      NA+    T   +      +A RL      +P      I  T
Sbjct: 1122 SAGSVGVMVTYVLQLPGLLNALLRSQT---QTENDLNSAERLVNYAYDLPIEAKYRILET 1178

Query: 496  LGKTYTPGKGEIEFKNVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGPSGKGKSTIALL 554
                  P +G I+F+NVS AY  RP   +  K+++  I     + I G +G GKSTI   
Sbjct: 1179 QPPEQWPSEGRIKFENVSLAY--RPELPVALKNVSIDIGSNEKIGICGRTGAGKSTIMSA 1236

Query: 555  LLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNIT--YGLTEEP- 611
            L       +G+I ID  DI+ L    LR ++A++ Q+PVL  G IR N+      T+E  
Sbjct: 1237 LYRLVELKTGKITIDDIDISTLGLYELRSKLAIIPQDPVLFKGDIRRNLDPFQECTDEQL 1296

Query: 612  ----------TKEEIRTVAKQCFCHNFIV--KFPYTYDTYIGPHGTLLSGGQKQRIAIAR 659
                       ++++ ++  Q    N +    F +  D  +   G+  S G++Q +A+ R
Sbjct: 1297 WDALVRGGAIDRKDVDSIRAQHKDANGLSGDMFKFHLDQMVEDDGSNFSLGERQLLALTR 1356

Query: 660  ALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVL 719
            AL++   ILILDEATS++D  ++  I     +  +  + TI+ IAHRL TI     I+VL
Sbjct: 1357 ALVRGSKILILDEATSSVDYATDAKIQSRIVE--EFSNCTILCIAHRLKTILAYNRILVL 1414

Query: 720  GNDGSVVEMGKFKELFAD 737
             + G VVE    K+L+ D
Sbjct: 1415 -DQGQVVEFDTPKKLYND 1431

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/212 (29%), Positives = 102/212 (48%), Gaps = 20/212 (9%)

Query: 525 FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQ 584
           F  LNF +K    + I GP G GKS++   L  +   +SG + I G              
Sbjct: 592 FHGLNFDVKENEFIIITGPIGTGKSSLLNALAGFMRRSSGSMTIKGD------------- 638

Query: 585 IAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHG 644
             ++   P + + T++DNI +G   +  K + + V + C     +   P    T IG  G
Sbjct: 639 -LLLCGYPWVQNATVKDNILFGSPFD--KPKYQKVIEICSLQADLDILPAGDRTEIGERG 695

Query: 645 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 703
             LSGGQK RIA+AR++ K  +I + D+  SA+D    +  ++      +K K+  + + 
Sbjct: 696 ITLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYLKQKTRILAT- 754

Query: 704 AHRLSTIRRSENIIVLGNDGSVVEMGKFKELF 735
            H+LS I ++  +I LG DGS  ++G   EL 
Sbjct: 755 -HQLSLIDKASRVIFLGLDGS-FDIGTVPELL 784

>TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.52
            YLL015W
          Length = 1570

 Score =  120 bits (301), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 125/505 (24%), Positives = 218/505 (43%), Gaps = 69/505 (13%)

Query: 279  FFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVG---IGMMLELSMDLSSVL 335
            FF+   +G +++R  +D   +   +    S   +S++   V    +G  L   + L++VL
Sbjct: 1072 FFETTPIGRIVNRFSSDLEAIDSGLQYIFSFFFRSVLIYVVSLILVGYNLPWFIALNAVL 1131

Query: 336  VCFVIPVVLSASIFGKQIRINSRELQDAT----GQLTRVSEEQLNGVRTVQSFVAEQR-- 389
            +            +     + SREL+  T      +  +  E L G   + +F    R  
Sbjct: 1132 IMIYF-------YYQAYYIMLSRELKRLTTISYSPIMSLISETLGGFSVINAFDHTSRFN 1184

Query: 390  --EIKRFNHSIREIFDVGKRAAFINAKFFTSTSLV----GDLSFLTVLVYGSYLVLHGSL 443
                +   ++I  +F       +++ +  T  +L+    G LSF T       L     L
Sbjct: 1185 FFNFETVQYNIDCVFQFRSTNRWLSVRLQTIGNLIILATGLLSFAT-------LGTKKQL 1237

Query: 444  TIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTI-------RPTL 496
            + G +   M Y+    +++  +     +I     +  R  E  +  P         RP  
Sbjct: 1238 SSGMVGLLMSYSLQVTSSLMWIVRMTVQIETRIVSVERTLEYCELKPEALEIIENSRPPE 1297

Query: 497  GKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLL 556
            G    P +G IEF N +  Y     + + K +N  IKP   + IVG +G GKST+ L L 
Sbjct: 1298 G---WPREGAIEFNNYTTKY-RENLDPVLKDINVSIKPKEKIGIVGRTGAGKSTLTLALF 1353

Query: 557  HYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEI 616
                 T G I IDG DI+K+  + LR  +A++ Q+     GTIR N+     ++ + EE+
Sbjct: 1354 RLIEATGGSISIDGIDISKIGLEDLRSNLAIIPQDAQAFEGTIRSNL--DPFDQHSDEEL 1411

Query: 617  RTVAKQCFCHNFIVKF------------------PYTYD------TYIGPHGTLLSGGQK 652
                +       I++                   P +++      T I  +G+ +S GQ+
Sbjct: 1412 WRAVELSHLKQHILRMNEEANDRESDSSRTDITTPDSHNIKELLATPISKNGSNVSVGQR 1471

Query: 653  QRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRR 712
            Q + ++RAL+    +LILDEAT+A+D+E++  +  T     K +  TI++IAHR+ T+  
Sbjct: 1472 QLLCLSRALLNPSKVLILDEATAAIDMETDKIVQDTIKNEFKER--TILTIAHRIDTVMN 1529

Query: 713  SENIIVLGNDGSVVEMGKFKELFAD 737
             + I+VL + G V E      L +D
Sbjct: 1530 YDKILVL-DKGEVAEFDTVSNLLSD 1553

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 120/508 (23%), Positives = 235/508 (46%), Gaps = 60/508 (11%)

Query: 264 LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSI--TQKISDGVKSLICGGVGI 321
           L ++V K +L   S+    H  GD+I+ +  D   + R    +Q I      ++   V I
Sbjct: 366 LMALVYKKSLRISSDARQKHSSGDIINLMSTDVLNLQRFFENSQSIIGAPIQIVI--VLI 423

Query: 322 GMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTV 381
            + L L   + + ++  VI + ++A +  K   +   +++    +LT ++E  LN ++++
Sbjct: 424 SLYLLLDKAVFAGMISMVIMIPINAYLSRKVGSLYKTQMKYKDSRLTILTE-ILNSIKSI 482

Query: 382 QSFVAEQREIKRFNHSIR---EIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYG--SY 436
           + +  E+  +K+  H +R   E+ +  K   F N  FF    +   ++  T L++   S 
Sbjct: 483 KLYSWEKPMLKKLLH-VRNDLELENFKKIGIFSNLIFFAWNCVPLMVTCSTFLIFSMISD 541

Query: 437 LVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRL--FELTDRVPTIRP 494
           + L   +    LT F +      +AI+ + +  ++++Q   +  RL  F L +    +  
Sbjct: 542 VPLSPDIIFPSLTLFNIL----NDAIYVVPSTINDVIQANISMKRLRDFLLAEE---LDD 594

Query: 495 TLGKTYTPGKGE----IEFKNVSFAYPTRP----------------SNQIFKSL-NFKIK 533
           +  +  +P + +    IE  N +F + ++                 S    K++ NF +K
Sbjct: 595 SFIEYKSPSETDDAPVIEINNATFLWQSKKIINENSSTDEESNIETSKAALKNIDNFTVK 654

Query: 534 PGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI-LIDGQDITKLNSKSLR-RQIAVVQQE 591
            GS  CIVG  G GKSTI   +L       GQ+  I   D T+    ++R   IA   QE
Sbjct: 655 KGSLTCIVGKVGSGKSTILHAIL-------GQLPCISALDQTRAPKVTIRATSIAYCPQE 707

Query: 592 PVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGG- 650
             +M+ ++++NI +G   +     +  V + C   + +   P   +T +G  G  L GG 
Sbjct: 708 AWIMNSSVKENIVFGHKHDENYYNL--VIQACQLASDLSILPDGDETIVGEKGISLVGGV 765

Query: 651 QKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQ---LMKSKSMTIVSIAHR 706
           QK RI++ARA+  + ++ +LD+  SA+D   S+  I Y   +   L+++K  TI+   + 
Sbjct: 766 QKARISLARAVYARADVYLLDDILSAVDAHVSKNIIKYVLSKETGLLRNK--TIILSTNN 823

Query: 707 LSTIRRSENIIVLGNDGSVVEMGKFKEL 734
           ++ ++ S+ I  +   G +VE   ++ +
Sbjct: 824 VNVLKNSQKIYAI-EKGEIVEESDYENV 850

>YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC type
            transmembrane transporter of MRP/CFTR family, found in
            vacuolar membrane, involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates, along with Ycf1p
          Length = 1559

 Score =  120 bits (300), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 142/550 (25%), Positives = 258/550 (46%), Gaps = 59/550 (10%)

Query: 228  LYEFLGGFSVALFIGCAA----NYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFDVH 283
            ++ F+G +S+   IG A+    N          S R   +L   + K  +     FF+  
Sbjct: 1017 VWMFVGVYSL---IGVASAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFETT 1073

Query: 284  KVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVV 343
             VG +I+R  +D   V  ++    S   KS++   V + +++  +M    V   F++ + 
Sbjct: 1074 PVGRIINRFSSDMDAVDSNLQYIFSFFFKSILTYLVTV-ILVGYNMPWFLVFNMFLVVIY 1132

Query: 344  LSASIFGKQIRINSRELQD----ATGQLTRVSEEQLNGVRTVQSFVAEQREI----KRFN 395
            +    F     + SREL+     +   +  +  E LNG   + ++   +R I    ++  
Sbjct: 1133 IYYQTF---YIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQ 1189

Query: 396  HSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYT 455
            +++  +F+      +++ +  T   +   +   T ++  + +     L+ G +   M Y+
Sbjct: 1190 YNVDFVFNFRSTNRWLSVRLQT---IGATIVLATAILALATMNTKRQLSSGMVGLLMSYS 1246

Query: 456  -EYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVP---TIRP-TLGKTYTPGKGEIEFK 510
             E TG+  + + T  + I     +  R+ E  +  P   +I P        P KG IEFK
Sbjct: 1247 LEVTGSLTWIVRTTVT-IETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSKGGIEFK 1305

Query: 511  NVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG 570
            N S  Y     + +  ++N KI+P   V IVG +G GKST++L L     PT G+I+IDG
Sbjct: 1306 NYSTKY-RENLDPVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDG 1364

Query: 571  QDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEP----TKEEIRTVAKQCFCH 626
             DI+ +    LR  +A++ Q+     GT++ N+      +P    +++E++   +Q    
Sbjct: 1365 IDISDIGLFDLRSHLAIIPQDAQAFEGTVKTNL------DPFNRYSEDELKRAVEQAHLK 1418

Query: 627  NFIVKFPYT-----------------YDTYIGPHGTLLSGGQKQRIAIARALIKKPNILI 669
              + K  ++                  D  I  +G+ LS GQ+Q + +ARAL+ +  IL+
Sbjct: 1419 PHLEKMLHSKPRGDDSNEEDGNVNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILV 1478

Query: 670  LDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMG 729
            LDEAT+++D+E++  I  T  +  K +  TI++IAHR+ T+  S+ IIVL + GSV E  
Sbjct: 1479 LDEATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DQGSVREFD 1535

Query: 730  KFKELFADPT 739
               +L +D T
Sbjct: 1536 SPSKLLSDKT 1545

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 99/405 (24%), Positives = 185/405 (45%), Gaps = 66/405 (16%)

Query: 373 EQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLT--- 429
           E LN +++++ +  E+  + R NH +R   ++         K F    +V +L +     
Sbjct: 477 ELLNAIKSIKLYAWEEPMMARLNH-VRNDMEL---------KNFRKIGIVSNLIYFAWNC 526

Query: 430 --VLVYGSYLVLHGSLTIGDLTAFMLYTEYT-----GNAIFGLSTFYSEIMQGAGAASRL 482
             ++V  S   L    +   L+  +++   +      +AI+ + +  + I++ + +  RL
Sbjct: 527 VPLMVTCSTFGLFSLFSDSPLSPAIVFPSLSLFNILNSAIYSVPSMINTIIETSVSMERL 586

Query: 483 --FELTDRV-----PTIRPTLGKTYTPGKGEIEFKNVSFAYPTRP--------------- 520
             F L+D +       I P+  +   P    IE  N++F + ++                
Sbjct: 587 KSFLLSDEIDDSFIERIDPSADERALPA---IEMNNITFLWKSKEVLTSSQSGDNLRTDE 643

Query: 521 -----SNQI-FKSLN-FKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDI 573
                S+QI  K+++ F+ K G  VC+VG  G GKST    +L       GQ+       
Sbjct: 644 ESIIGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKSTFLKAIL-------GQLPCMSGSR 696

Query: 574 TKLNSKSLRRQ--IAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVK 631
             +  K + R   +A   QE  +M+ ++R+NI +G   +  ++      K C     +  
Sbjct: 697 DSIPPKLIIRSSSVAYCSQESWIMNASVRENILFG--HKFDQDYYDLTIKACQLLPDLKI 754

Query: 632 FPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTF- 689
            P   +T +G  G  LSGGQK R+++ARA+  + +I +LD+  SA+D E S+  I Y   
Sbjct: 755 LPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLI 814

Query: 690 GQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
           G+    K+ TI+   + +S ++ S+ I  L N G +VE G ++++
Sbjct: 815 GKTALLKNKTIILTTNTVSILKHSQMIYALEN-GEIVEQGNYEDV 858

>Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 992

 Score =  119 bits (299), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 139/505 (27%), Positives = 231/505 (45%), Gaps = 62/505 (12%)

Query: 269 MKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELS 328
           +K  LH    F D   +G +++R   D+  +   +T+ I   +  L    +G+ +M  + 
Sbjct: 487 VKGILHTPLSFMDTTPLGRILNRFTKDTDSMDNELTEDIRLMMFQL-GNIIGVIVMCIVY 545

Query: 329 MDLSSVLVCFV-IPVVLSASIF---GKQI-RINSRELQDATGQLTRVSEEQLNGVRTVQS 383
           +   ++ V F+ I  V+ A  +   G+++ R+ + +       L  V    L G+ T+++
Sbjct: 546 LPWFAIAVPFLLIMFVMIADHYQSSGREVKRLEAVQRSFVYNNLNEV----LGGLDTIRA 601

Query: 384 FVAEQREIKRFNHSIREIFDVGKRAAFIN---AKFFTSTSLVGDLSFLTVLVYGSYLVLH 440
           + ++ R + + +  I ++ + G   A +    A F    +++  L  +T+L       + 
Sbjct: 602 YRSQDRFLVKSDFLINKMNEAGYMVAALQRWVAIFLDMLAVIFAL-IITLLCVTRQFKIS 660

Query: 441 GSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRL----FELTDRVPTIRPTL 496
            S T G L  ++L      N +    T   +   G  +A RL     +L       RP +
Sbjct: 661 PSST-GVLLTYVLQLPGLLNTVLRALT---QAENGMNSAERLVTYALDLPQEAEYRRPEM 716

Query: 497 GKTYT-PGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALL 554
                 P +GEI+F+ VSFAY P+ P   + K+ +  I  G  + I G +G GKSTI   
Sbjct: 717 SPPENWPDRGEIKFEGVSFAYRPSLPP--VLKNFSLNIGSGEKIGICGRTGAGKSTIMSA 774

Query: 555 LLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNIT-YGLTEEPTK 613
           L        G+I ID  +I  L    LR ++A++ Q+PVL  GTI+ N+  +G   E T 
Sbjct: 775 LYRINEVIDGKIFIDNINIADLGLFELRSKLAIIPQDPVLFRGTIKKNLDPFG---EKTD 831

Query: 614 EEI----------------RTVAKQ---CFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQR 654
           +E+                 T A+Q      H+ + KF    +  +   G   S G+KQ 
Sbjct: 832 QELWESLVRGGAIAPEDIEETKAQQPDASGSHSKMHKF--HLEQKVEEEGGNFSLGEKQL 889

Query: 655 IAIARALIKKPNILILDEATSALDVESEGAIN----YTFGQLMKSKSMTIVSIAHRLSTI 710
           +A+ RAL++   ILILDEATS++D E++  I       FG        TI+ IAHRL+TI
Sbjct: 890 LALTRALVRNSRILILDEATSSVDYETDDKIQSRIVEAFG------DCTILCIAHRLNTI 943

Query: 711 RRSENIIVLGNDGSVVEMGKFKELF 735
              + I+VL   G V E      LF
Sbjct: 944 LNYDRILVL-EQGEVAEFDTPWNLF 967

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 107/211 (50%), Gaps = 20/211 (9%)

Query: 525 FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQ 584
           F++LNF IK G  + + GP G GK+++   +  +   + G + ++G+ ++          
Sbjct: 106 FQNLNFDIKKGEFIIVTGPIGTGKTSLLSAMAGFMARSGGSVEVNGRLLS---------- 155

Query: 585 IAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHG 644
                  P + + T+RDNI +G   E  K   R V K C   + +   P    T IG  G
Sbjct: 156 ----CGYPWIQNATVRDNIIFGSPYEKAK--YRKVIKACSLDSDLEILPAGDMTEIGERG 209

Query: 645 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 703
             LSGGQK RI +AR + K  +I + D+  SA+D    +  ++     L+  K+  + + 
Sbjct: 210 INLSGGQKARINLARCVYKDKDIYLFDDVLSAVDARVGKHIMDECLLGLLGQKTRILAT- 268

Query: 704 AHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
            H+L+ I ++  +IVLGNDGS   +G ++EL
Sbjct: 269 -HQLALIEKATRLIVLGNDGSFT-IGTYEEL 297

>KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] {ON}
            similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281W YOR1 Plasma membrane transporter of the ATP-
            binding cassette (ABC) family mediates export of many
            different organic anions including oligomycin
          Length = 1486

 Score =  119 bits (299), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 131/506 (25%), Positives = 221/506 (43%), Gaps = 50/506 (9%)

Query: 263  RLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIG 322
            RL    ++  LH    F D   +G +++R   D+  V   +T+ +   V  L    VG+ 
Sbjct: 975  RLNLKAVQRLLHTPMSFLDTTPIGRVLNRFTKDTDTVDTELTESVRLFVFQL-SNIVGVI 1033

Query: 323  MMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATG-QLTRVSE---EQLNGV 378
            +M  + +   ++ V F++ V +  +      + +SRE++     Q + V     E L G+
Sbjct: 1034 VMCIIYLPWFAIAVPFLMLVFVGVA---DHYQSSSREIKRLEAVQRSHVFNNFNEVLGGM 1090

Query: 379  RTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLV 438
             T++++  E+R + + +    ++ + G     I      +  ++     L V +      
Sbjct: 1091 DTIRAYRGERRFLTKSDFLTNKMNEAGYLVVAIQRWVAIALDMIAMAFALIVTLLCVTRQ 1150

Query: 439  LH-GSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGA----GAASRL-FELTDRVPTI 492
             H  + ++G L  ++L      N +    T     M         A+ L  E   R P +
Sbjct: 1151 FHISAASVGVLLTYVLQLPGLLNMLLRAMTQGENDMNSTERLISYATELPLEAAYRRPEM 1210

Query: 493  RPTLGKTYTPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTI 551
             P       P  G IEF +VS AY P  P   + K +   +  G  + I G +G GKSTI
Sbjct: 1211 SP---PAEWPTDGRIEFDHVSLAYRPGLP--LVLKDVTLHVAAGEKIGICGRTGAGKSTI 1265

Query: 552  ALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNIT--YGLTE 609
               L        G I IDG DI+ L    LR +++++ Q+PV+  G +R N+   +  T+
Sbjct: 1266 MSALYRMCELHDGSITIDGVDISTLGLYDLRSKLSIIPQDPVMFKGDVRKNLDPFHERTD 1325

Query: 610  EPT-----------KEEIRTVAKQCF--------CHNFIVKFPYTYDTYIGPHGTLLSGG 650
            +              E + TV  Q           H F ++     D      GT  S G
Sbjct: 1326 DELWHALVRGGAIPAESLATVRAQTHENAGSLSNMHKFHLQQEVEED------GTNFSLG 1379

Query: 651  QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI 710
            ++Q +A+ RAL+++  ILILDEATS++D E++  I     +     + TI+ IAHRL+TI
Sbjct: 1380 ERQLLALTRALVRQSKILILDEATSSVDYETDAKIQTRIVEAF--SNCTILCIAHRLNTI 1437

Query: 711  RRSENIIVLGNDGSVVEMGKFKELFA 736
               + I+VL + G V E      L+A
Sbjct: 1438 LDYDRILVL-DQGRVCEFDTPAALYA 1462

 Score = 84.7 bits (208), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 71/214 (33%), Positives = 98/214 (45%), Gaps = 26/214 (12%)

Query: 525 FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQ 584
           F +LN +I  G  V + G  G GKS++   L  +   T G I  DG              
Sbjct: 603 FDNLNIQITKGELVIVTGSVGTGKSSLLYALSGFMKKTGGDIYKDGT------------- 649

Query: 585 IAVVQQEPVLMSGTIRDNITYG--LTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGP 642
             ++   P + + T+RDNI +G    E    E IR     C     +   P    T IG 
Sbjct: 650 -MLLCGYPWIQNATVRDNILFGSPYNEARYNEIIRV----CSLQADLELLPAGDRTEIGE 704

Query: 643 HGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQLMKSKSMTI 700
            G  LSGGQK RI +ARA+ KK +I + D+  SA+D      I      G+L  S   T 
Sbjct: 705 RGITLSGGQKARINLARAVYKKKDIYLFDDVLSAVDARVGKHIMDECLMGKLEGS---TR 761

Query: 701 VSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
           V   H+LS I R+  +I +  DGS V++G  +EL
Sbjct: 762 VLATHQLSLIARASKVIYIDLDGS-VDVGSVEEL 794

>Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR103W
            (REAL)
          Length = 1595

 Score =  116 bits (291), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 136/547 (24%), Positives = 243/547 (44%), Gaps = 80/547 (14%)

Query: 227  TLYEFLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFDVHKVG 286
            T+  F+  F  A  +  A  +G        ++++ A+L S +    L     F D+  VG
Sbjct: 1046 TIIGFISSFLTAGKVWVAVLFGTNA-----TKKIFAKLLSSIFLAKLR----FHDITPVG 1096

Query: 287  DLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLSA 346
             +++R   D  I    I Q++    + L    V    ++ L   ++   + F IP+    
Sbjct: 1097 RIMNRFSKDMDI----IDQQLIPNFEGLFYSVVVCLWVIFLIGYITPRFLLFAIPLCALY 1152

Query: 347  SIFGKQIRINSRELQDA----TGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIF 402
             I G      SREL+         + ++  E + GV T+++   E+R I +       + 
Sbjct: 1153 YIVGSLYLRASRELKRIDNINVSPIHQLFTEAIKGVATIRALADERRFITQ------TLV 1206

Query: 403  DVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTI--------GDLTAFMLY 454
             + K     NA FF   +L  +     V + G+ ++   SL I          L   +L 
Sbjct: 1207 AIDKS----NAPFFY-LNLATEWITYRVDIIGALILFSSSLMIVLKAPYLDAGLAGILLS 1261

Query: 455  T--EYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYT------PGKGE 506
                +T  A + +  F S +     +  R+ E  D VP +  +    Y       P  G+
Sbjct: 1262 NAFSFTETAQWIIKVF-SGVELLMSSVERIKEYVD-VP-LESSESNNYATPLANWPQTGD 1318

Query: 507  IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
            IEF+N++  Y    S++    ++FK+K G+ V IVG +G GKS+I   +    +   G I
Sbjct: 1319 IEFENLTLRYSPH-SSKALDGVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWEDGTI 1377

Query: 567  LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNI----------------TYGLTEE 610
            +ID +DI  +  + LR  I+ + Q P L  GTIR N+                  GL E+
Sbjct: 1378 IIDNKDIKYVPLECLRNSISCIPQNPTLFEGTIRSNLDPWDQYSDVQVFEALEKVGLIEQ 1437

Query: 611  PTKEEIRTVAKQCFC----HNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPN 666
               E + ++  Q       H    +F    +T +   G+ +S GQ+Q + +AR+++   N
Sbjct: 1438 --SEGLCSLPGQKLSYPSNHKLRNRF-IDLNTVVKSGGSNISQGQRQLLCLARSMLGARN 1494

Query: 667  ILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVV 726
            I+++DEAT+++D  S+  I  T  + M++   T+++IAHRL ++   + I+V+       
Sbjct: 1495 IMLIDEATASIDYVSDAKIQKTIRETMRNT--TVLTIAHRLRSVIDYDKILVM------- 1545

Query: 727  EMGKFKE 733
            +MG+ +E
Sbjct: 1546 DMGRVEE 1552

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 73/239 (30%), Positives = 120/239 (50%), Gaps = 9/239 (3%)

Query: 501 TPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYN 560
           T  K ++ F+N +  +    ++   K+++   K  +   I+GP+G GKS++ L LL   N
Sbjct: 659 TQSKTKLGFENANMEWEAAETSFKLKNISIDFKQNTLNAIIGPTGSGKSSLLLGLLGELN 718

Query: 561 PTSGQI---LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIR 617
             SG+I    +  +D  ++    +   +A   Q P L+SGTI+DNI +G  E   +++  
Sbjct: 719 LRSGKINVPTVHSRDDLEIGIDGMANSMAYCSQSPWLISGTIKDNIVFG--EFFNQQKFD 776

Query: 618 TVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSAL 677
            V K C     I        T +G  G  LSGGQ+QRIA+ARA+      L+ D+  SA+
Sbjct: 777 DVIKCCCLEKDIKAMTAGLKTDVGEGGFSLSGGQQQRIALARAIYSSSRYLLFDDCLSAV 836

Query: 678 DVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
           D E+   I      G +MK ++  + S  H +S I +    +V+ ++G V   GK  +L
Sbjct: 837 DPETALHIYEECLCGPMMKGRTCIVTS--HNISLIIKQAQWLVILDNGEVKAQGKPSDL 893

>AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR281W (YOR1)
          Length = 1400

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 125/499 (25%), Positives = 221/499 (44%), Gaps = 50/499 (10%)

Query: 263  RLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIG 322
            RL     K  L+    F D   +G +++R   D+ ++   +T    D  +  +     + 
Sbjct: 898  RLNLSAAKRILYAPMSFIDTTPMGRILNRFTKDTDVLDNELT----DSTRMFVFQMANVV 953

Query: 323  MMLELSMD-LSSVLVCFVIPVVLSASIFGKQIRINSRELQDATG-QLTRVSE---EQLNG 377
             +  LS+  L  V +   I V+L   I G   +   RE++     Q + V     E L+G
Sbjct: 954  GVFILSIAYLPYVAIAVPISVLLLLFI-GDHYQSAGREVKRLEAIQRSFVYNNLGEVLDG 1012

Query: 378  VRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYL 437
            + T++++ A+ R +++ ++ +    + G     I A+ + +  L  DL  + + +  + L
Sbjct: 1013 LDTIRAYNAQSRFLRKSDYFLNRTNEAGY--LVIGARCWVA--LTTDLVAIAIALIVTLL 1068

Query: 438  VLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRV---PTIRP 494
             +   + I   +A +L T      +  +  +++ +++G          T RV    T  P
Sbjct: 1069 CVTRVIHITPSSAGVLLT-----VVLQMPAYFNMVLRGFTELENNMNSTQRVHYYATALP 1123

Query: 495  TLGKTY---------TPGKGEIEFKNVSFAYPTRPSNQI-FKSLNFKIKPGSNVCIVGPS 544
                 Y          P  GEI F+ VSFAY  RP   +    ++F ++ G  + I G +
Sbjct: 1124 QEAPQYLPGAAPPAGWPAAGEIVFQEVSFAY--RPGLPLALCGVSFHVRAGEKIGICGRT 1181

Query: 545  GKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNIT 604
            G GK+++   L       SG I IDG DI  L    LR  ++++ Q+P+L  GT+R N+ 
Sbjct: 1182 GAGKTSVTTALYRLSELESGSIKIDGVDIATLGLHDLRSALSIIPQDPLLFRGTVRKNL- 1240

Query: 605  YGLTEEPTKEEIRTVAKQCFCHNFIV-------KFPYTYDTYIGPHGTLLSGGQKQRIAI 657
                 +P  E            + +V          +  D  +   G   S G++Q +A+
Sbjct: 1241 -----DPFAEHTDGTLWSALVRSGVVPAGVVPTSHKFHLDQEVDEGGANFSLGERQLLAL 1295

Query: 658  ARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENII 717
            ARAL++   ILILDEATS++D  ++  +        + +  T++ +AHRL TI   + I+
Sbjct: 1296 ARALVRSTRILILDEATSSVDYATDARVQARIAA--EFRQATVLCVAHRLRTIISYDRIL 1353

Query: 718  VLGNDGSVVEMGKFKELFA 736
            VL + G V E      LFA
Sbjct: 1354 VL-DQGRVAEFDTPYRLFA 1371

 Score = 86.7 bits (213), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/213 (29%), Positives = 101/213 (47%), Gaps = 21/213 (9%)

Query: 525 FKSLN---FKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSL 581
           F  LN   F IK G  + ++G  G GK+++   +  Y   T+G + ++G           
Sbjct: 548 FTGLNDLLFSIKKGEFIIVIGAIGTGKTSLLNAVAGYMKKTTGSVHVNGS---------- 597

Query: 582 RRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIG 641
                +    P + + TIRDNI +G + + T+ +   V   C        FP    T +G
Sbjct: 598 ----LLFCGVPWIQNATIRDNIIFGSSFDQTRYD--EVVNACALEADFKIFPAGDKTEVG 651

Query: 642 PHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIV 701
             G  LSGGQK RI++ARA+ K  +I + D+  SA+D      I      L + ++ T +
Sbjct: 652 ERGITLSGGQKARISLARAIYKDRDIYLFDDIISAVDANVAAHITQK-CLLDRLQNRTRI 710

Query: 702 SIAHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
              H+L+ ++ +  +I LG DGS  +MG   EL
Sbjct: 711 LATHQLALVQEASRVIFLGQDGS-FDMGTPAEL 742

>TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1377

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 134/524 (25%), Positives = 231/524 (44%), Gaps = 102/524 (19%)

Query: 269  MKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLI---CGGVGIGMML 325
            +   +H    F +   +G +++R   D+     S+  +I D ++ ++   C  VGI    
Sbjct: 878  VNRVIHSPMWFMESTPMGRIMNRFTKDT----ESLDNQILDNLRFVVYQACTIVGI---- 929

Query: 326  ELSMDLSSVLVCFVIP-VVLSASIFGKQIRINSRELQDATGQLTRVSEEQ---------- 374
                   SVL    +P   ++    G  + +     Q +  ++ R+   Q          
Sbjct: 930  -------SVLCIIYLPWFAIAIPGLGLILFVACSHYQSSAREIKRLEAVQRSFIYNHLND 982

Query: 375  -LNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAF---------------INAKFFTS 418
             L GV T++++ AE+R    F++ +  + D    A++               +   F   
Sbjct: 983  VLGGVDTIRAYGAEER----FSYKLDYLIDKTNEASYLYTAVQRWINIVINLVGISFTLI 1038

Query: 419  TSL-----VGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIM 473
             SL     V +LS  +  V  SY++L   L    LT  +  TE   N++  L T+ +E+ 
Sbjct: 1039 VSLLCVTKVFNLSGASTGVVLSYVLLIPDLLNNTLT-MVTQTENDMNSVERLVTYATELP 1097

Query: 474  QGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPT-RPSNQIFKSLNFKI 532
            Q A          + VP+      KT+ P  GEI+F+NV + +    P+  +      KI
Sbjct: 1098 QEASHG-------EEVPS------KTW-PENGEIKFENVRYTHRDGLPA--VLDKFTLKI 1141

Query: 533  KPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEP 592
              G  V I G +G GKST+   L       SG+++ID  D++KLN  +LR ++A++ Q+P
Sbjct: 1142 AAGERVGICGRTGAGKSTVLGALYRLREVESGRVMIDDVDVSKLNLTALRSRLAIIPQDP 1201

Query: 593  VLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKF-------------------- 632
            VL  G++R N+      +P  E    V K       + KF                    
Sbjct: 1202 VLFQGSVRHNL------DPFGEYDDDVLKNALMRCTVGKFNKTGNESTEGIDTDADNGLV 1255

Query: 633  -PYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQ 691
              +  D  +  +G   S G++Q +A+ARALI+  +IL+LDEAT+A+D  ++  +     +
Sbjct: 1256 GKFRLDQDVEENGCNFSVGERQVLALARALIRNSSILVLDEATAAVDAATDAHVQRLVAE 1315

Query: 692  LMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELF 735
              K +  T++ +AHRL TI   + I+VL N G ++ +   K L 
Sbjct: 1316 AFKGR--TVLCVAHRLDTILNYDRILVLEN-GKIIGLDTPKSLL 1356

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 119/448 (26%), Positives = 202/448 (45%), Gaps = 65/448 (14%)

Query: 315 ICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFG--KQIRINSRELQDATGQLTRVSE 372
           IC G+ I  +  ++M   S +  F + +++   +FG   ++R+N  ++ D   Q   +  
Sbjct: 314 ICLGLLIKNLGGIAM---SGVGLFFVTIIVVIFLFGIVMKMRLNINQVTD---QRVSILR 367

Query: 373 EQLNGVRTVQSFVAEQ---REIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLT 429
           E LN ++ V+ +  EQ   + IK+      E   + +     N  F  + SL    S +T
Sbjct: 368 EVLNNIKMVKLYCWEQAYEKSIKKIRS--LETSKLTRMEILKNVIFSVTFSLPNICSLMT 425

Query: 430 VLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAG-----AASRLFE 484
            L   +   +HG L      A  +++  +   I  L +FY  +  G       +  R  E
Sbjct: 426 FL---ALFKIHGGLK----NAATIFSSLSLFKILSLLSFYIPLSLGTAIDIVTSLDRFQE 478

Query: 485 LTD-----RVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQI-------FKSLNFKI 532
             +         IR T  + Y      I+  + SF + T   +         F  LNF+I
Sbjct: 479 FLEAEESKETRIIRETNSEIYGDNTVAIKASHCSFRWDTEEKDNNEEKEFSGFHDLNFEI 538

Query: 533 KPGSNVCIVGPSGKGKST----IALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVV 588
             G  + IVGP G GK++    I  L+  Y N   G++ +DG                V 
Sbjct: 539 MKGELIIIVGPIGSGKTSLLNAICGLMPQYGN--EGELEVDGS--------------LVS 582

Query: 589 QQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYD-TYIGPHGTLL 647
              P + + T+RDNI +G   + +K   + V + C     + K    YD T IG  G  L
Sbjct: 583 CGYPWIQNTTVRDNILFGSKYDESK--FKRVIRMCSLEEDLEKLS-AYDMTEIGERGVTL 639

Query: 648 SGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSIAHR 706
           SGGQK RI +AR+L K+ +I + D+  SA+D    +  +     + +K+K+  + +  H+
Sbjct: 640 SGGQKSRINLARSLYKEKDIYLFDDILSAVDSRVGQSIMKECLMEGLKNKTRVLAT--HQ 697

Query: 707 LSTIRRSENIIVLGNDGSVVEMGKFKEL 734
           LS I +++ +IVLGNDG   +MG++++L
Sbjct: 698 LSLIGKADQLIVLGNDGK-FDMGRYEDL 724

>KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1568

 Score =  114 bits (286), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 123/235 (52%), Gaps = 13/235 (5%)

Query: 502  PGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNP 561
            P +GEI F++ +  Y     + + K ++ +IK    + +VG +G GKST+ L L     P
Sbjct: 1310 PKRGEITFEHYTTKY-RENLDPVLKDIDLRIKHQEKIGVVGRTGAGKSTLTLALFRILEP 1368

Query: 562  TSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNIT--YGLTEEPTKEEIRTV 619
              G+I IDG DI+ L    LRR ++++ Q+     GT+R N+      T+    + +   
Sbjct: 1369 FEGKITIDGIDISTLGLYDLRRSLSIIPQDAQAFEGTVRSNLDPFNRHTDAEIWKALELS 1428

Query: 620  AKQCFCHNFIVKFPYT-------YDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDE 672
              +      + + P          DT I  +G  LS GQ+Q + ++RAL+    ILILDE
Sbjct: 1429 HLKPHIERIVSELPDDENKPTDLLDTQISDNGNNLSMGQRQLLCLSRALLNPSKILILDE 1488

Query: 673  ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVE 727
            AT+A+D E++  I  T     K +  TI++IAHR+ T+  S+ I+VL + G V E
Sbjct: 1489 ATAAVDRETDKIIQETIRTAFKDR--TILTIAHRIDTVLDSDKIMVL-DKGEVKE 1540

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 121/510 (23%), Positives = 230/510 (45%), Gaps = 62/510 (12%)

Query: 264 LRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVG-IG 322
           L S+V + +L   +E  +    GD+++ +  D   V R   Q+  +  + L+   +  IG
Sbjct: 365 LMSLVYQKSLRLSAEAREDKANGDVLNLMSVD---VIR--IQRFFENAQILVGSPIQLIG 419

Query: 323 MMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSR----ELQDATGQLTRVSEEQLNGV 378
           +++ L + L +  +  ++ +V+   I     R+  +    ++Q    ++  V+E  LN +
Sbjct: 420 VLISLYVLLGNATIGGLVSIVIMVPINSYMTRLYKKLFKTQMQYKDKRIKTVTE-ILNSM 478

Query: 379 RTVQSFVAEQREIKRFNHSIR---EIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGS 435
           ++++ +  E+  + R NH +R   E+ ++ K A   N  FF   ++V  L   +  V  S
Sbjct: 479 KSIKLYAWEKPMLDRLNH-VRNDLELHNMKKIAIVSNFMFFC-WNIVPLLVTCSTFVLFS 536

Query: 436 YL---VLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRL--FELTDRVP 490
           YL   VL   +    LT F +      +A+F + T  S I++   +  RL  + L + + 
Sbjct: 537 YLTDQVLSPQIIFPSLTLFSM----LNDALFTVPTMISNIIEIGVSLKRLKGYLLAEELD 592

Query: 491 TIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQ----------------IFKSL-NFKIK 533
           T      +  T     +E  N  F + +  S                    KS+ NF  K
Sbjct: 593 TSFIEHARA-TASDPTVEISNAVFLWKSPKSAASSEDTDEEAEISSPGVALKSIENFSAK 651

Query: 534 PGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI-LIDGQDITKLNSKSLRR--QIAVVQQ 590
                CIVG  G GKST    +L       GQ+  +     + +  K + R   +A   Q
Sbjct: 652 KAQLTCIVGRVGSGKSTFLQAIL-------GQLPCVSSDSASGVKPKVVIRADNLAYCPQ 704

Query: 591 EPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGG 650
           +P +M+ +++DNI +G   +  +   +   K C     +   P    T +G  G  LSGG
Sbjct: 705 QPWIMNASLKDNILFGYKYD--EAMYKKTIKACQLLPDLEILPDGDQTLVGEKGISLSGG 762

Query: 651 QKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQ---LMKSKSMTIVSIAHR 706
           QK R+++ARA+  + ++ +LD+  SA+D    +  I+    +   L+K+K  T++   + 
Sbjct: 763 QKARLSLARAVYSRADLYLLDDVLSAVDSHVCKSIIDDVLDRQKGLLKNK--TVILTTNA 820

Query: 707 LSTIRRSENIIVLGNDGSVVEMGKFKELFA 736
           ++ +  S+ I +L N G +VE   ++E+ +
Sbjct: 821 VNVLVHSDMIYLLKN-GKIVESNSYEEVMS 849

>TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_5.10
            YGR281W possible pseudogene; NNN added to avoid internal
            stop codon; truncated at 5' end
          Length = 1058

 Score =  113 bits (282), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 86/281 (30%), Positives = 140/281 (49%), Gaps = 30/281 (10%)

Query: 478  AASRLFELTDRVPTIRPTLGKTYTPG-----KGEIEFKNVSFAYPTRPSNQIFKSLNFKI 532
            +  RL      +P  R +     +PG      G+I+FK+ +F Y       I K+ N  +
Sbjct: 768  SVERLVTYATNLPQERTSSKPETSPGHIWPENGKIQFKDANFRYKEGLP-LILKNFNMLV 826

Query: 533  KPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEP 592
            + G  + I G +G GKSTI   L      T G I ID  DI+ L    LR+ ++++ Q+P
Sbjct: 827  QSGEKIGICGRTGAGKSTIMNCLFRLDELTDGAIYIDDIDISTLGLHDLRKNLSIIPQDP 886

Query: 593  VLMSGTIRDNIT-YGLTEEPTKEEIRTVA----KQCFCH--------NFIVKFPYTYDTY 639
            +L  GTIR N+  +   ++ T  E   ++    +  F H          + KF  T   +
Sbjct: 887  ILFEGTIRKNLDPFSYFDDATLWEAMILSGFIDRDTFGHFSEKPVNNKELTKFHLT--AH 944

Query: 640  IGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSM- 698
            +   GT  S G+KQ +A  RA+I    +++LDEA+S++D E++  I     Q + SK   
Sbjct: 945  VEEDGTNYSLGEKQLLAFTRAIIHHSKVVVLDEASSSVDYETDAKI-----QTLISKQFS 999

Query: 699  --TIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFAD 737
              TI+ IAHRL+TI + + I+VL + G+++     + LF +
Sbjct: 1000 HNTILCIAHRLNTILKYDRILVL-DHGNIIGFENPRVLFEN 1039

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 82/251 (32%), Positives = 115/251 (45%), Gaps = 43/251 (17%)

Query: 507 IEFKNVSFAYPTRPS---------NQI------------FKSLNFKIKPGSNVCIVGPSG 545
           I+F N SF + T            NQI            F +LNF I  G  + I GP G
Sbjct: 166 IKFNNASFEWETFEDDIIKDENNINQILENKTNNCHFNGFNNLNFSIX-GEFIIITGPIG 224

Query: 546 KGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITY 605
            GK+++   +        G I IDG                 +   P + + T+RDNI +
Sbjct: 225 TGKTSLLYAMSGLMKKLEGTIEIDGN--------------LQLCGYPWVQNTTVRDNIIF 270

Query: 606 GLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKP 665
           G   E  KE+   V + C     +  F     T IG  G  LSGGQK RI +ARA+ K  
Sbjct: 271 GSKYE--KEKFDHVIRICALTEDLENFSGKDLTEIGELGITLSGGQKARINLARAIYKTS 328

Query: 666 NILILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDG 723
           +I + D+  SA+D      I  N   G L   K+  I++  H+LS I++++ I+VLGND 
Sbjct: 329 DIYLFDDILSAVDSRVGNFIMENCLLGAL-SGKTXXILA-THQLSLIKKADRIVVLGNDN 386

Query: 724 SVVEMGKFKEL 734
           S  E+G +KEL
Sbjct: 387 S-FEIGPYKEL 396

>Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (REAL)
          Length = 1580

 Score =  113 bits (283), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 81/250 (32%), Positives = 132/250 (52%), Gaps = 32/250 (12%)

Query: 502  PGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNP 561
            P  GEIEFKN+S  Y    S++   +++FK++ G+ V IVG +G GKS+I   +    + 
Sbjct: 1301 PQTGEIEFKNLSLRYSPH-SSKALDNVSFKVRTGTKVGIVGRTGAGKSSIIAAIYRLSDW 1359

Query: 562  TSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNI----------------TY 605
             SG I+ID +DI  ++ + LR  I+ + Q P L  GTIR N+                  
Sbjct: 1360 ESGTIIIDNKDIKCVSLECLRNSISCIPQNPTLFDGTIRSNLDPYNQYSDKQVFDALAKV 1419

Query: 606  GLTEEPTKEEIRTVAKQ--CFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIK 663
            GL E      + T  +Q   F  N   KF    ++ +   G+ LS GQ+Q + +AR+++ 
Sbjct: 1420 GLIERNEVLCLVTDRQQSSSFSPN---KFS-DLNSVVRSGGSNLSQGQRQLLCLARSMLG 1475

Query: 664  KPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDG 723
               I+++DEAT+++D  S+  I  T  + M++   TI++IAHRL ++     I+V+    
Sbjct: 1476 SRKIMLIDEATASIDYISDAKIQKTIRETMENT--TILTIAHRLRSVIDYNKILVM---- 1529

Query: 724  SVVEMGKFKE 733
               +MG+ KE
Sbjct: 1530 ---DMGRVKE 1536

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 121/239 (50%), Gaps = 9/239 (3%)

Query: 501 TPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYN 560
           T  K ++ FK+ +  +    ++   K+++ + K  S   I+GP+G GKS++ L LL   N
Sbjct: 658 TQSKSKVGFKDANMEWDADETSFKLKNISIEFKLNSLNAIIGPTGSGKSSLLLGLLGELN 717

Query: 561 PTSGQILI---DGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIR 617
             SGQI +   D +D  ++    +   +A   Q P L+SGTI DNI +G  E P +    
Sbjct: 718 LCSGQIYVPSVDSRDDLEVGIDGMTNSMAYCSQSPWLISGTIEDNIVFG--ERPNQRRFN 775

Query: 618 TVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSAL 677
            V K C     +        T +G  G  LSGGQ+QR+A+ARA+      L+LD+  SA+
Sbjct: 776 AVIKACCLEKDVKAMSAGLKTSVGGGGFSLSGGQQQRVALARAIYSSSRFLLLDDCLSAV 835

Query: 678 DVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
           D E+   I      G +MK ++  I S  H +S I +    +V+ ++G V   GK  +L
Sbjct: 836 DPETALNIYEKCLCGPIMKGRTCIITS--HNISLITKKAEWLVILDNGEVKGQGKPSDL 892

>Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa] {ON}
            YGR281W (YOR1) - ABC transporter [contig 363] FULL
          Length = 1471

 Score =  113 bits (283), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 123/498 (24%), Positives = 221/498 (44%), Gaps = 48/498 (9%)

Query: 269  MKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGG---VGIGMML 325
            +K  LH    F D   +G +++R   D+     ++  ++++ V+  +      VG+ +M 
Sbjct: 966  VKRLLHTPMSFLDTTPIGRVLNRFTKDT----DTLDTELTESVRLFLFQASNIVGVVIMC 1021

Query: 326  ELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATG-QLTRVSE---EQLNGVRTV 381
             + +   ++ V F++ +  + +      + +SRE++     Q + V     E L+G+ T+
Sbjct: 1022 IIYLPWFAIAVPFLLLIFAAVA---DHYQSSSREIKRLEAVQRSHVFNNFNEVLSGMDTI 1078

Query: 382  QSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHG 441
            +++  E R + + +  I ++ + G    ++        S+  D+  +   +  + L +  
Sbjct: 1079 RAYRGEARFLTKSDFLINKMNEAG----YVVVAIQRWVSIALDMIAMAFALIITLLCVTR 1134

Query: 442  SLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAG---AASRLFELTDRVPT----IRP 494
              +I   +  +L T Y       L+T    + QG     +A RL      +P      RP
Sbjct: 1135 QFSISAASVGVLLT-YVLQLPGLLNTLMRAMTQGENDMNSAERLISYATDLPLEAAYRRP 1193

Query: 495  -TLGKTYTPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIA 552
             T      P +G I+F +VS AY P  P   +   ++  ++ G  + I G +G GKSTI 
Sbjct: 1194 ETSPPESWPSEGAIDFDHVSLAYRPGLP--LVLHDVSLHVRGGEKIGICGRTGAGKSTIM 1251

Query: 553  LLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDN---------- 602
              L        G I IDG DI +L    LR ++A++ Q+PVL  G +R N          
Sbjct: 1252 SALYRMIELHDGSITIDGIDIAQLGLYELRSKLAIIPQDPVLFKGDVRKNLDPFHERSDN 1311

Query: 603  -ITYGLTEE---PTKEEIRTVAKQCFCHNFIVKF-PYTYDTYIGPHGTLLSGGQKQRIAI 657
             +   L       T++E    A        +     +  +  +   G+  S G++Q +A+
Sbjct: 1312 ELWDALVRAGAIATEDEAAARAVTRATAGALTNLHKFHLEQEVEEDGSNFSLGERQLLAL 1371

Query: 658  ARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENII 717
             RAL++   ILILDEATS++D E++  I             T++ IAHRL+TI   + I+
Sbjct: 1372 TRALVRSSRILILDEATSSVDYETDAKIQARIADAF--SECTVLCIAHRLNTILDYDRIL 1429

Query: 718  VLGNDGSVVEMGKFKELF 735
            VL + G V E      LF
Sbjct: 1430 VL-DQGRVCEFDTPHALF 1446

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/214 (31%), Positives = 96/214 (44%), Gaps = 26/214 (12%)

Query: 525 FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQ 584
           FK+LN +I  G  V + G  G GKS++   +  +    SG I  +G              
Sbjct: 594 FKNLNIEIAKGELVIVTGSVGTGKSSLLAAMSGFMKKKSGDIYKNGS------------- 640

Query: 585 IAVVQQEPVLMSGTIRDNITYG--LTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGP 642
             ++   P + + T++DNI +G    E   KE IR     C     +   P    T IG 
Sbjct: 641 -LLLCGYPWIQNTTVKDNILFGSPFDEARYKETIRV----CSLQADLDLLPAGDKTEIGE 695

Query: 643 HGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQLMKSKSMTI 700
            G  LSGGQK RI +AR++ KK +I + D+  SA+D      I      G L      T 
Sbjct: 696 RGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDARVGKHIMDECMMGAL---DGKTR 752

Query: 701 VSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
           V   H+LS I R+  +I +  DG+ V+ G   EL
Sbjct: 753 VLATHQLSLIARASKVIFIDLDGT-VDSGTLDEL 785

>TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON} 
          Length = 1485

 Score =  113 bits (282), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 139/502 (27%), Positives = 220/502 (43%), Gaps = 66/502 (13%)

Query: 273  LHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLS 332
            LH    F D + +G +++R   D+  +   +T+ +   + S I   +G+G M  + +   
Sbjct: 985  LHTPMSFMDTNPLGRILNRFTKDTDALDNELTENLRLAM-SQIANIIGVGAMCIIYLPWF 1043

Query: 333  SVLVCFVIPVVLSASIF-GKQIRINSRELQDATG-QLTRVSE---EQLNGVRTVQSFVAE 387
            ++     IP +L   +      +   RE++     Q + V     E L G+ T++++ A+
Sbjct: 1044 AI----AIPFLLLIFLLIADHYQSTGREVKRLEAIQRSFVYNNLNEMLTGMDTIKAYNAQ 1099

Query: 388  QREIKRFNHSIREIFDVGKRAAFIN------AKFFTSTSLVGDLSFLTVLVYGSYLVLHG 441
             R    F      + D    AA+I+      A  F     V     +T+L       + G
Sbjct: 1100 DR----FATKSEFLIDKMNEAAYISIAVQRWAGIFLDLVAVAFALIITLLCVTRQFHISG 1155

Query: 442  SLTIGDLTAFMLY--------------TEYTGNAIFGLSTFYSEIMQGAGAASRLFELTD 487
            + T G L  ++L               TE   N+   L ++ +++ Q         E   
Sbjct: 1156 ADT-GVLLTYVLQLPGLLNTVLRALTQTENDMNSTERLVSYATQLPQ---------EAQY 1205

Query: 488  RVPTIRPTLGKTYTPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGSNVCIVGPSGK 546
            R P   P +     P  G I F+N++FAY P  P   I K+ N  IKP   + I G +G 
Sbjct: 1206 RKPECSPPID---WPQNGHIVFENINFAYRPGLPI--ILKNFNLIIKPNEKIGICGRTGA 1260

Query: 547  GKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNI--- 603
            GKSTI   L      T+G+I+ID  DI+ L    LR ++A++ Q+PVL  G IR N+   
Sbjct: 1261 GKSTIMNALYRLTELTTGKIIIDDIDISNLGLYELRSKLAIIPQDPVLFRGNIRRNLDPF 1320

Query: 604  -TYG---LTEEPTK------EEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQ 653
              Y    L E   K      +E+ TV  Q    +      +  +  +   G   S G++Q
Sbjct: 1321 DEYQDDLLWESLVKAGAIDSQELETVKSQDKNSDAKNLHKFHLNQSVDEDGNNFSLGERQ 1380

Query: 654  RIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRS 713
             +A+ RAL+++  ILILDEATS++D E++  I             TI+ IAHRL TI   
Sbjct: 1381 VLALTRALVRQSKILILDEATSSVDYETDAKIQNLIATAF--NHCTILCIAHRLKTILNY 1438

Query: 714  ENIIVLGNDGSVVEMGKFKELF 735
            + I+VL   G V E      LF
Sbjct: 1439 DRILVL-EKGEVAEFDTPWNLF 1459

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 101/214 (47%), Gaps = 21/214 (9%)

Query: 524 IFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRR 583
           +  ++NF I  G  V + GP G GK+++   L       SG++   G             
Sbjct: 624 LLSNINFTIPKGEFVVVTGPVGSGKTSLLFALAGLMEQLSGEMNHSGD------------ 671

Query: 584 QIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPH 643
              ++   P + + TIRDNI +G   +PT    + V   C   + +   P    T +G  
Sbjct: 672 --LLLCGIPWVQNATIRDNILFGSPYDPTF--YKRVLHVCALESDLENLPAHDKTEVGER 727

Query: 644 GTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVS 702
           G  LSGGQK RI++ARA+ K  +I + D+  SA+D       ++Y     +  K+  + +
Sbjct: 728 GVTLSGGQKARISLARAVYKNKDIYLFDDVLSAVDARVGRHIMDYCMNDHLSDKTRILAT 787

Query: 703 IAHRLSTIRRSENIIVL--GNDGSVVEMGKFKEL 734
             H+LS + +++ IIVL    D    E+G FKEL
Sbjct: 788 --HQLSLVEKADRIIVLSTSKDAPHFEIGTFKEL 819

>ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLL048C
            (YBT1) and YHL035C
          Length = 1627

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 125/505 (24%), Positives = 219/505 (43%), Gaps = 69/505 (13%)

Query: 263  RLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLI-CGGVGI 321
            ++ ++V+   LH    FFD    G +++RL  D   V + +         +++ C     
Sbjct: 1109 KIFNLVLWKILHAKMRFFDATPTGRIMNRLSKDLEAVDQELIPYFEGSFAAVVQCIS--- 1165

Query: 322  GMMLELSMDLSSVLVCFVIPVVLSASIF--------GKQIRINSRELQDATGQLTRVS-- 371
                      + VL+ +V P  L  +IF        G      SREL+     +TR    
Sbjct: 1166 ----------TLVLIAYVTPQFLIMAIFIGFLYALIGYFYVTTSRELKRFE-SITRSPIY 1214

Query: 372  ---EEQLNGVRTVQSFVAEQR----EIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGD 424
                E L G+ +++++  E+R     + R + + R  F +       N        L+G 
Sbjct: 1215 QHFSETLVGITSIRAYGDERRFMLENLSRIDDNNRPFFYLW----IANRWLAFRVDLLGA 1270

Query: 425  LS--FLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRL 482
            L   F  + +Y +   L   L    LT  + +TE            YS +     +  RL
Sbjct: 1271 LVTFFSGLFIYLNIGKLDAGLAGISLTYAIFFTE----GALWFVRHYSNVEMTMNSFERL 1326

Query: 483  ---FELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGSNV 538
                E+          L     P  G I+  ++S  Y P  P  ++ K++NF ++P   V
Sbjct: 1327 KEYMEIEQEPYNENAQLPPDNWPQHGRIDVSDLSLRYAPNLP--KVIKNVNFSVEPKLKV 1384

Query: 539  CIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGT 598
             IVG +G GKSTI   +  + +P +G + ID  DIT +    LR+ I ++ Q+P L +GT
Sbjct: 1385 GIVGRTGAGKSTIITAMFRFLDPETGFVKIDNIDITTIPLHRLRQSITIIPQDPTLFTGT 1444

Query: 599  IRDNITYGLTEEPTKEEIRTVAKQCFCHNF----------------IVKFPYTYDTYIGP 642
            ++ +I    ++   K+    + +     +                 I KF    +  +  
Sbjct: 1445 LK-SILDPYSQYSDKQIYEALQRVNLLSDTDINSLSSPSTQSSGENINKF-LDLNNEVTE 1502

Query: 643  HGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVS 702
             G  LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + +  TI++
Sbjct: 1503 GGANLSQGQRQLVCLARSLLRSPKIIMLDEATASIDYTSDEKIQQTIRE--EFRDSTILT 1560

Query: 703  IAHRLSTIRRSENIIVLGNDGSVVE 727
            IAHRL +I   + ++V+ + G V E
Sbjct: 1561 IAHRLKSIIDYDKVLVM-DAGEVKE 1584

 Score = 80.9 bits (198), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 99/372 (26%), Positives = 165/372 (44%), Gaps = 31/372 (8%)

Query: 373 EQLNGVRTVQSFVAE---QREIKRFNHSIREIFDVGKRAAFINA---KFFTSTSLVGDLS 426
           E L  +R ++ F  E   ++E++       E+  + KRA   +A    +F  +++V   S
Sbjct: 542 ETLQSIRIIKFFAWETNFEKEVQAIRED--ELATLLKRAIVWSAISFLWFMVSTIVVSAS 599

Query: 427 FLTVLVYGSYLVLHGS-LTIG-DLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFE 484
           F        Y+ + G  LTI    TA  L+     N +  L+   S ++Q   +  R+  
Sbjct: 600 F------ACYIYIQGEVLTIPVAFTALSLFVMLR-NPLDVLADMLSYVVQSKVSLDRIQA 652

Query: 485 LTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPS 544
             D   T   T  +  T     + F+N + A+   PS+   ++++ +   G      GP+
Sbjct: 653 FLDEDET---TKYEQLTISGNRLAFENATIAWNDDPSSFRLRNIDIEFMIGKLNVAFGPT 709

Query: 545 GKGKSTIALLLLHYYNPTSGQILI---DGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRD 601
           G GKS++ L LL       G+I +   D ++   + +  L   IA   Q   L++ T R 
Sbjct: 710 GTGKSSLLLGLLGEMTLQEGKIYVPSLDPREDLVIQADGLTNSIAYCSQSAWLLNDTARS 769

Query: 602 NITYGLTEEPTKEE-IRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARA 660
           NI +     P  E+    V + C              T IG  G  LSGGQKQRI++ARA
Sbjct: 770 NILF---NSPYNEQRYNDVLEACGLKKDFEILSGGDLTQIGEKGMTLSGGQKQRISLARA 826

Query: 661 LIKKPNILILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIV 718
           L      L+LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++   R+ + +V
Sbjct: 827 LYSSARHLLLDDCLSAVDSHTALLIYENCIIGPLMEGRTCVLVS--HNVALTMRNADWVV 884

Query: 719 LGNDGSVVEMGK 730
           +  +G V   G+
Sbjct: 885 ILENGRVKAQGE 896

>Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 1568 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 1568

 Score =  110 bits (275), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 134/530 (25%), Positives = 230/530 (43%), Gaps = 39/530 (7%)

Query: 228  LYEFLGGFSVALFIGCA-ANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFDVHKVG 286
            L+ F+G +++   I  A  N          S R   +L   +    ++    FF+   +G
Sbjct: 1013 LWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIG 1072

Query: 287  DLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLSA 346
             +I+R   D   V   +    S   +SL+ G +   +++  +M    V   F+I +    
Sbjct: 1073 RIINRFSGDLDSVDSGLQFIFSHFFRSLL-GYIVTVILVGYNMPWFFVFNIFLIVIYF-- 1129

Query: 347  SIFGKQIRINSRELQDATG----QLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIF 402
              +     + SREL+  T      +  +  E L G   + ++   +R    FN    + F
Sbjct: 1130 -YYQAYYIVTSRELKRLTSITYSPIMSLISETLAGYLVINAYNHAKR-FSYFNFESVQ-F 1186

Query: 403  DVGKRAAFINAKFFTSTSL--VGDLSFL-TVLVYGSYLVLHGSLTIGDLTAFMLYTEYTG 459
            ++     F +   + S  L  +G L  L T L+  S +     LT G +   M Y+    
Sbjct: 1187 NIDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLMSYSLQVT 1246

Query: 460  NAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTY----TPGKGEIEFKNVSFA 515
            N++  +     +I     +  R+ E  +  P     + +T      P  G I+F + S  
Sbjct: 1247 NSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKFIDYSTK 1306

Query: 516  YPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITK 575
            Y  +  + +   +N +I+P   + IVG +G GKST+ L L      T G+I+IDG DI+ 
Sbjct: 1307 Y-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDGVDIST 1365

Query: 576  LNSKSLRRQIAVVQQEPVLMSGTIRDNIT----------YGLTE----EPTKEEI---RT 618
            L    LR  +A++ Q+     GTIR N+           +   E    +P  E I   R 
Sbjct: 1366 LGLSDLRSNLAIIPQDAQAFEGTIRTNLDPFDQHSDEELWKAIEASHLKPHLERIISNRD 1425

Query: 619  VAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALD 678
               +    N   K     +  I  +G+ LS GQ+Q + ++RAL+    IL+LDEAT+++D
Sbjct: 1426 DNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDEATASVD 1485

Query: 679  VESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEM 728
            +E++  I  T       +  TI++IAHR+ T+   + I+VL + G V E 
Sbjct: 1486 METDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-DKGEVREF 1532

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 105/432 (24%), Positives = 194/432 (44%), Gaps = 51/432 (11%)

Query: 334 VLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKR 393
           V +  +IP+    +   K+++  ++E         R   E LN +++++ +  E+  +KR
Sbjct: 437 VTMAIMIPI---NAYLSKKVKSLNKEQMKYKDIRIRTLTEILNSIKSIKLYSWEKPMLKR 493

Query: 394 FNHSIR---EIFDVGKRAAFINAKFFTSTS---LVGDLSFLTVLVYGSYLVLHGSLTIGD 447
            +H +R   E+    K     N  FF       +V   SF+ +    S + L   +    
Sbjct: 494 LDH-VRNDLELESFKKIGIVSNCIFFAWNCVPIMVTCSSFI-IFALTSGMALTPDIVFPA 551

Query: 448 LTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGE- 506
           L  F +  +    AI+ + +  + I++ + +  RL          R  + ++     G  
Sbjct: 552 LALFNILND----AIYSVPSTITNIIEVSVSLGRLKNFLATEELDRSFIEQSDPKNDGHS 607

Query: 507 --IEFKNVSFAY---------------PTRPSNQI-FKSLN-FKIKPGSNVCIVGPSGKG 547
             +E  N +F +                T  + Q+ FK++N F++K GS  CIVG  G G
Sbjct: 608 CAVEIDNATFLWKGKKNLVSSENGDEESTIDNTQVAFKNVNHFEVKEGSLTCIVGRVGSG 667

Query: 548 KSTIALLLLHYYNPTSG-QILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYG 606
           K+T+   +L      SG Q  I  + I + NS      IA   Q+  +M+ ++++NI +G
Sbjct: 668 KTTLLRAVLGQLPCISGAQESIPPKLIIRGNS------IAYCPQQAWIMNSSVKENILFG 721

Query: 607 LTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPN 666
              +  +       + C     +   P   +T +G  G  LSGGQK R+++ARA+  + +
Sbjct: 722 --HKYDEHYYNLTIEACQLTEDLKMLPDGDETIVGEKGISLSGGQKARLSLARAVYSRSD 779

Query: 667 ILILDEATSALDVE-SEGAINYTFGQ---LMKSKSMTIVSIAHRLSTIRRSENIIVLGND 722
           I +LD+  SA+D E S+  I     +   L+KSK  TI+   + +S ++ S+ I  L N 
Sbjct: 780 IYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK--TIILTTNAISVLKHSQKIYALEN- 836

Query: 723 GSVVEMGKFKEL 734
             ++E G + ++
Sbjct: 837 CEIIEEGAYDDV 848

>Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]
            {OFF} complement(118923..123713) [4791 nt, 1597 aa]
          Length = 1596

 Score =  109 bits (273), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 134/530 (25%), Positives = 230/530 (43%), Gaps = 39/530 (7%)

Query: 228  LYEFLGGFSVALFIGCA-ANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFDVHKVG 286
            L+ F+G +++   I  A  N          S R   +L   +    ++    FF+   +G
Sbjct: 1041 LWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIG 1100

Query: 287  DLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLSA 346
             +I+R   D   V   +    S   +SL+ G +   +++  +M    V   F+I +    
Sbjct: 1101 RIINRFSGDLDSVDSGLQFIFSHFFRSLL-GYIVTVILVGYNMPWFFVFNIFLIVIYF-- 1157

Query: 347  SIFGKQIRINSRELQDATG----QLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIF 402
              +     + SREL+  T      +  +  E L G   + ++   +R    FN    + F
Sbjct: 1158 -YYQAYYIVTSRELKRLTSITYSPIMSLISETLAGYLVINAYNHAKR-FSYFNFESVQ-F 1214

Query: 403  DVGKRAAFINAKFFTSTSL--VGDLSFL-TVLVYGSYLVLHGSLTIGDLTAFMLYTEYTG 459
            ++     F +   + S  L  +G L  L T L+  S +     LT G +   M Y+    
Sbjct: 1215 NIDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLMSYSLQVT 1274

Query: 460  NAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTY----TPGKGEIEFKNVSFA 515
            N++  +     +I     +  R+ E  +  P     + +T      P  G I+F + S  
Sbjct: 1275 NSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKFIDYSTK 1334

Query: 516  YPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITK 575
            Y  +  + +   +N +I+P   + IVG +G GKST+ L L      T G+I+IDG DI+ 
Sbjct: 1335 Y-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDGVDIST 1393

Query: 576  LNSKSLRRQIAVVQQEPVLMSGTIRDNIT----------YGLTE----EPTKEEI---RT 618
            L    LR  +A++ Q+     GTIR N+           +   E    +P  E I   R 
Sbjct: 1394 LGLSDLRSNLAIIPQDAQAFEGTIRTNLDPFDQHSDEELWKAIEASHLKPHLERIISNRD 1453

Query: 619  VAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALD 678
               +    N   K     +  I  +G+ LS GQ+Q + ++RAL+    IL+LDEAT+++D
Sbjct: 1454 DNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDEATASVD 1513

Query: 679  VESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEM 728
            +E++  I  T       +  TI++IAHR+ T+   + I+VL + G V E 
Sbjct: 1514 METDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-DKGEVREF 1560

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 105/432 (24%), Positives = 194/432 (44%), Gaps = 51/432 (11%)

Query: 334 VLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKR 393
           V +  +IP+    +   K+++  ++E         R   E LN +++++ +  E+  +KR
Sbjct: 465 VTMAIMIPI---NAYLSKKVKSLNKEQMKYKDIRIRTLTEILNSIKSIKLYSWEKPMLKR 521

Query: 394 FNHSIR---EIFDVGKRAAFINAKFFTSTS---LVGDLSFLTVLVYGSYLVLHGSLTIGD 447
            +H +R   E+    K     N  FF       +V   SF+ +    S + L   +    
Sbjct: 522 LDH-VRNDLELESFKKIGIVSNCIFFAWNCVPIMVTCSSFI-IFALTSGMALTPDIVFPA 579

Query: 448 LTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGE- 506
           L  F +  +    AI+ + +  + I++ + +  RL          R  + ++     G  
Sbjct: 580 LALFNILND----AIYSVPSTITNIIEVSVSLGRLKNFLATEELDRSFIEQSDPKNDGHS 635

Query: 507 --IEFKNVSFAY---------------PTRPSNQI-FKSLN-FKIKPGSNVCIVGPSGKG 547
             +E  N +F +                T  + Q+ FK++N F++K GS  CIVG  G G
Sbjct: 636 CAVEIDNATFLWKGKKNLVSSENGDEESTIDNTQVAFKNVNHFEVKEGSLTCIVGRVGSG 695

Query: 548 KSTIALLLLHYYNPTSG-QILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYG 606
           K+T+   +L      SG Q  I  + I + NS      IA   Q+  +M+ ++++NI +G
Sbjct: 696 KTTLLRAVLGQLPCISGAQESIPPKLIIRGNS------IAYCPQQAWIMNSSVKENILFG 749

Query: 607 LTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPN 666
              +  +       + C     +   P   +T +G  G  LSGGQK R+++ARA+  + +
Sbjct: 750 --HKYDEHYYNLTIEACQLTEDLKMLPDGDETIVGEKGISLSGGQKARLSLARAVYSRSD 807

Query: 667 ILILDEATSALDVE-SEGAINYTFGQ---LMKSKSMTIVSIAHRLSTIRRSENIIVLGND 722
           I +LD+  SA+D E S+  I     +   L+KSK  TI+   + +S ++ S+ I  L N 
Sbjct: 808 IYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK--TIILTTNAISVLKHSQKIYALEN- 864

Query: 723 GSVVEMGKFKEL 734
             ++E G + ++
Sbjct: 865 CEIIEEGAYDDV 876

>Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {ON}
           similar to Ashbya gossypii AGL346W
          Length = 1536

 Score = 85.1 bits (209), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 101/213 (47%), Gaps = 24/213 (11%)

Query: 525 FKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQ 584
           F  L+F++K G  + I G  G GK+++   L  + + T+G I  +G+             
Sbjct: 590 FSDLSFEVKKGELLVITGAIGTGKTSLLNALAGFMHKTNGDIQYNGR------------- 636

Query: 585 IAVVQQEPVLMSGTIRDNITYGLTEEPTKEEI-RTVAKQCFCHNFIVKFPYTYDTYIGPH 643
             +    P + + TIRDNIT+G    P  E + R V + C     +   P    T +G  
Sbjct: 637 -MLFCGAPWIQNATIRDNITFG---SPYDENLYREVMRVCSLDRDMSVLPAGDKTEVGER 692

Query: 644 GTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQLMKSKSMTIV 701
           G  LSGGQK RI +AR + K  +I + D+  SA+D     +I  +   G+L      T +
Sbjct: 693 GITLSGGQKARINLARCVYKVRDIYLFDDILSAVDARVGASIMNDCLLGKL---GDKTRI 749

Query: 702 SIAHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
              H++S   ++  +I LG DGS  ++G   EL
Sbjct: 750 LATHQISLTEQASRVIYLGTDGS-FDIGTVDEL 781

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 116/243 (47%), Gaps = 22/243 (9%)

Query: 373  EQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAF-INAKFFTSTSLVGDLSFLTVL 431
            E ++GV T++++ AE R +K+ +  I    D      F + A     + L+G ++ L  L
Sbjct: 1063 EVISGVDTIKAYHAEARFLKKSDILI----DRMNEMTFPLYASQRWVSILIGMIAVLFAL 1118

Query: 432  VYGSYLVLHGSLTIGDLTAFML--YTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTD-- 487
            +  S L + G   I   +  +L  Y     N    L    +++     +A R+    +  
Sbjct: 1119 II-SILCVTGWFNISPASTGVLLTYVLQLPNLFNTLLRAMTQLENDMNSAERVLSYANSL 1177

Query: 488  ------RVPTIRPTLGKTYTPGKGEIEFKNVSFAY-PTRPSNQIFKSLNFKIKPGSNVCI 540
                  R+P + P   K + P +G I F NV+ AY P  P   + + ++F I  G  + I
Sbjct: 1178 PKEAPYRIPEMAPP--KAW-PERGAITFDNVALAYRPGLP--LVLQDVSFHISSGEKIGI 1232

Query: 541  VGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIR 600
             G +G GKSTI   L      ++G + IDG DI  +   +LR +++++ Q+P+L  GTIR
Sbjct: 1233 CGRTGAGKSTITNALYRLVELSNGSVTIDGVDIATIGLYNLRSKLSIIPQDPLLFRGTIR 1292

Query: 601  DNI 603
             N+
Sbjct: 1293 KNL 1295

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 57/94 (60%), Gaps = 3/94 (3%)

Query: 634  YTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLM 693
            +  D  +   G+  S G++Q +A+ARAL+++  ILILDEATS++D E++  I     Q  
Sbjct: 1415 FHLDQTVEEDGSNFSVGERQFLALARALVRQTKILILDEATSSVDYETDAQIQARIVQ-- 1472

Query: 694  KSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVE 727
            + +  TI+ +AHRL TI   + I+V+   G V E
Sbjct: 1473 EFQHATIMCVAHRLKTILHYDRILVM-EKGRVAE 1505

>YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}
           NFT1Putative transporter of the multidrug
           resistance-associated protein (MRP) subfamily; adjacent
           ORFs YKR103W and YKR104W are merged in different strain
           backgrounds.
          Length = 1218

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 74/231 (32%), Positives = 118/231 (51%), Gaps = 9/231 (3%)

Query: 509 FKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI 568
           F++ S  +    ++   K+++   K  S   I+GP+G GKS++ L LL   N  SG+I +
Sbjct: 653 FEDASMEWEAAETSFKLKNISIDFKLNSLNAIIGPTGSGKSSLLLGLLGELNLLSGKIYV 712

Query: 569 ---DGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFC 625
              + +D  ++    +   +A   Q P L+SGTI+DN+ +G  E   K++   V K C  
Sbjct: 713 PTVESRDDLEIGKDGMTNSMAYCSQTPWLISGTIKDNVVFG--EIFNKQKFDDVMKSCCL 770

Query: 626 HNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 685
              I        T +G  G  LSGGQ+QRIA+ARA+      LILD+  SA+D E+   I
Sbjct: 771 DKDIKAMTAGIRTDVGDGGFSLSGGQQQRIALARAIYSSSRYLILDDCLSAVDPETALYI 830

Query: 686 --NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
                 G +MK ++  I S  H +S + +  + +V+ + G V   GK  +L
Sbjct: 831 YEECLCGPMMKGRTCIITS--HNISLVTKRADWLVILDRGEVKSQGKPSDL 879

>ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL147W
           (PXA1)
          Length = 827

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 95/199 (47%), Gaps = 35/199 (17%)

Query: 534 PGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPV 593
           PGS++ I+GP+  GKS+I  +L   + P   +        T L S      +  + Q P 
Sbjct: 597 PGSSLLILGPNSCGKSSIQRILAEIW-PIYNK--------TGLVSIPAESDLMCIAQRPY 647

Query: 594 LMSG-TIRDNITYGLTEEPTKE------EIRTVAKQCFCHNFIVKFPY--------TYDT 638
            + G T RD I Y ++ +   E      E+  + K+       VK  Y        +Y  
Sbjct: 648 FIQGGTFRDQIIYPMSVDRFYEKGHKDRELVRILKE-------VKLDYLLKRSEGLSYLD 700

Query: 639 YIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSM 698
           ++     +LSGG+KQR+  AR +  +P  L+LDEAT+A+ V+ E   +Y F  L K +  
Sbjct: 701 FVADWKDILSGGEKQRMNFARIMFHRPKFLVLDEATNAISVDME---DYLFNMLRKCR-F 756

Query: 699 TIVSIAHRLSTIRRSENII 717
             +SI+ R S I+  + ++
Sbjct: 757 NFISISQRPSLIKYHDYLL 775

>SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 106/236 (44%), Gaps = 48/236 (20%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           I+ ++VSF Y    ++ + K +N  ++  S + +VG +G GK+T+  +++    PT G +
Sbjct: 532 IQLQDVSFGY--EENSPLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTKGYV 589

Query: 567 LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCH 626
                      S++ R +I    Q  V       D++           ++ T A      
Sbjct: 590 -----------SRNPRLRIGYFTQHHV-------DSM-----------DLNTSAVDWMSK 620

Query: 627 NFIVKFPYTYDTYIGPHG----------TLLSGGQKQRIAIARALIKKPNILILDEATSA 676
            F  K    Y  ++G  G           LLSGGQK R+A A   +  P+IL+LDE ++ 
Sbjct: 621 TFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 677 LDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVE 727
           LD     A+     N+T G LM S  +++  I H  S I  SE+  V   DG++ +
Sbjct: 681 LDTAGLDALIDALKNFTGGVLMVSHDISV--IDHVCSEIWVSEDGTVKRFDGTIYD 734

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K+   T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVLVVSH 422

>Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON}
           complement(1..4131) [4131 nt, 1377 aa]
          Length = 1377

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 105/219 (47%), Gaps = 10/219 (4%)

Query: 509 FKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI 568
           F   +  +       I ++LN K K      + GP+G GKS + + LL   +   G+I +
Sbjct: 693 FSGATIGWSINNKGFILENLNVKFKSKKLNVVAGPTGAGKSLLLMSLLGETHLFKGEIHV 752

Query: 569 ---DGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFC 625
                +    ++   L   I+   Q P +++ +I++NI +G   E   +    V + C  
Sbjct: 753 PSLASKHELMIHGDGLTNSISYCSQIPWIINDSIKNNILFG--SEFNLKRYNDVIRACCL 810

Query: 626 HNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 685
            N +       ++ +G  G  LSGGQ+QR+++ARA+  K   +ILD+  SA+D +    I
Sbjct: 811 TNDLRLLQDGDNSIVGDRGQNLSGGQRQRVSLARAIYSKSMHIILDDCLSAVDSKCAKDI 870

Query: 686 NYTF---GQLMKSKSMTIVSIAHRLSTIRRSENIIVLGN 721
            Y     G LMK ++  +VS    L  I+++  +++L N
Sbjct: 871 -YDLCLTGPLMKGRTCILVSHNVEL-VIKKAAYLLILDN 907

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 73/335 (21%), Positives = 135/335 (40%), Gaps = 39/335 (11%)

Query: 231  FLGGFSVALFIGCAANYGXXXXXXXXSERLVARLRSVVMKHTLHQDSEFFDVHKVGDLIS 290
            F  G   ALF    +           +   +  LR+VV    +     FF+   +G +++
Sbjct: 1065 FFIGLCYALFSSIKSGLTYFTGINACNRIFIKILRNVVSSKLI-----FFEKTPIGSIMN 1119

Query: 291  RLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFG 350
                D     RS+  ++S  ++      +   M L L   ++   +   I + L     G
Sbjct: 1120 NFSKDI----RSLDFELSPFIEGTFSCTLQTLMSLILITYVNPNFIFPAIFIFLFCCFIG 1175

Query: 351  KQIRINSRELQD----ATGQLTRVSEEQLNGVRTVQSFVAEQREIK-------RFNHSIR 399
                  SREL+         + +   E L G+ ++++F  E R IK        +N S  
Sbjct: 1176 HSYLCCSRELKRYESITKTPIYQHFSESLAGLVSIRAFGDELRFIKVIFTRVDEYNKSFF 1235

Query: 400  EIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTA--FMLYTEY 457
             +++     +F          L+G +   T+L  G +L+ + ++    L    F     +
Sbjct: 1236 YLWEANNWLSF-------RIELIGSI---TILATGLFLLSNANMVDSGLAGITFTYAIAF 1285

Query: 458  TGNAIFGLSTFYSEIMQGAGAASRLFELT--DRVPTIRP-TLGKTYTPGKGEIEFKNVSF 514
            T +A++ +  FY+ +     +  RL+E T  ++ P  R  T      P  G+I+FKNV+ 
Sbjct: 1286 TESALWMIK-FYATMEMNMNSVERLYEYTNLEQEPYSRCITNVDNQWPNSGDIKFKNVTL 1344

Query: 515  AY-PTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGK 548
             Y P  P  ++ + + F I     + +VG +G GK
Sbjct: 1345 RYSPELP--KVLQDVTFVIGDKEKIGVVGRTGAGK 1377

>Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 96/196 (48%), Gaps = 21/196 (10%)

Query: 535 GSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVL 594
           GS++ I+GP+G GKS+I  ++   + P   +          L S      I  + Q+P  
Sbjct: 638 GSSLLILGPNGCGKSSIQRIIADVW-PVYNK--------NGLLSIPSENNIFCIPQKPYF 688

Query: 595 -MSGTIRDNITYGLTEE-------PTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTL 646
              GT+RD I Y ++ +         KE ++ +A+    +        TY   +     L
Sbjct: 689 SRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILAEVRLDYLLKRGVGLTYLDAVADWKDL 748

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 706
           LSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K      +SI+ R
Sbjct: 749 LSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISISQR 804

Query: 707 LSTIRRSENIIVLGND 722
            + I+  E ++ +G +
Sbjct: 805 PTLIKYHEMLLEIGEN 820

>YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subunit
           of a heterodimeric peroxisomal ATP-binding cassette
           transporter complex (Pxa1p-Pxa2p), required for import
           of long-chain fatty acids into peroxisomes; similarity
           to human adrenoleukodystrophy transporter ABCD1 and
           ABCD2 and ALD-related proteins; mutations in ABCD1 cause
           X-linked adrenoleukodystrophy (X-ALD), a peroxisomal
           disorder
          Length = 870

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 95/196 (48%), Gaps = 21/196 (10%)

Query: 535 GSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVL 594
           GS++ I+GP+G GKS+I  ++   + P   +          L S      I  + Q+P  
Sbjct: 638 GSSLLILGPNGCGKSSIQRIIAEIW-PVYNK--------NGLLSIPSENNIFFIPQKPYF 688

Query: 595 -MSGTIRDNITYGLTEEP-------TKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTL 646
              GT+RD I Y ++ +         KE ++ + +    +        TY   I     L
Sbjct: 689 SRGGTLRDQIIYPMSSDEFFDRGFRDKELVQILVEVKLDYLLKRGVGLTYLDAIADWKDL 748

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 706
           LSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K      +SI+ R
Sbjct: 749 LSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISISQR 804

Query: 707 LSTIRRSENIIVLGND 722
            + I+  E ++ +G +
Sbjct: 805 PTLIKYHEMLLEIGEN 820

>ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {ON}
           highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036C
          Length = 610

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 111/242 (45%), Gaps = 56/242 (23%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           + F  +SFAY   P + ++++LNF +   S + +VGP+G GKST+  ++     P +G++
Sbjct: 393 LAFDEISFAYDGNPEHNLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGDLTPQAGRV 452

Query: 567 --------------LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPT 612
                           D  D+TK   + +R + + + Q+     G +     YGLT +  
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVREKYSHISQDFQYWRGQLG---RYGLTGDGQ 509

Query: 613 KEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDE 672
           K ++ T                            LS GQ+ R+  A   ++ PNIL+LDE
Sbjct: 510 KAQMGT----------------------------LSEGQRSRVVFALLALQAPNILLLDE 541

Query: 673 ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRR-SENIIVLGN------DGSV 725
            T+ LD+ +  ++     + + + +  +V ++H    + + +++I V+ N      DGS+
Sbjct: 542 PTNGLDIPTIDSL----AEAINTFNGGVVVVSHDFRLLDKIAQDIFVVENKTAYRWDGSI 597

Query: 726 VE 727
           +E
Sbjct: 598 LE 599

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 28/35 (80%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVES 681
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON}
           YPL147W (REAL)
          Length = 870

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 95/196 (48%), Gaps = 21/196 (10%)

Query: 535 GSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVL 594
           GS++ I+GP+G GKS+I  ++   + P   +          L S      I  + Q+P  
Sbjct: 638 GSSLLILGPNGCGKSSIQRIIAEIW-PVYNK--------NGLLSIPPENNIFFIPQKPYF 688

Query: 595 -MSGTIRDNITYGLTEE-------PTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTL 646
              GT+RD I Y ++ +         KE ++ + +    +        TY   +     L
Sbjct: 689 SRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVKLDYLLKRAVGLTYLDAVADWKDL 748

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 706
           LSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K      +SI+ R
Sbjct: 749 LSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISISQR 804

Query: 707 LSTIRRSENIIVLGND 722
            + I+  E ++ +G +
Sbjct: 805 PTLIKYHEMLLEIGEN 820

>Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {ON}
           YPL147W (PXA1) - ABC family long-chain fatty acid
           transporter [contig 67] FULL
          Length = 831

 Score = 70.9 bits (172), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 98/199 (49%), Gaps = 21/199 (10%)

Query: 534 PGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPV 593
           PGS++ I+GP+G GK++I  ++   + P   +          L S    R++  + Q+P 
Sbjct: 600 PGSSMLILGPNGSGKTSIQRIIAEIW-PIYNK--------NGLLSVPAERELICIPQKPY 650

Query: 594 LMSG-TIRDNITYGLTEEP------TKEEIRTVAKQCFCHNFIVKFP-YTYDTYIGPHGT 645
            + G T R+ I Y ++ +         +E+  V K+      + +   + Y   +     
Sbjct: 651 FIQGGTFREQIIYPMSADQYFDLGYRDKELVHVLKEVKLEYLLKRDKGWRYLDAVAEWKD 710

Query: 646 LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
           +LSGG++QR+  AR +  KP  ++LDEAT+A+  + E   +Y F  ++K      ++I+ 
Sbjct: 711 VLSGGERQRMNFARIMFHKPKFVVLDEATNAISADME---DYLFN-MLKRYRFNFITISQ 766

Query: 706 RLSTIRRSENIIVLGNDGS 724
           R S I+  +  + +G D S
Sbjct: 767 RPSLIKYHDLALEIGADES 785

>CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009w GCN20 positive effector of GCN2P
          Length = 752

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 94/211 (44%), Gaps = 46/211 (21%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           I+ ++VSF Y   P   + K +N  I+  S + +VG +G GK+T+  ++L    P SG +
Sbjct: 532 IQLQDVSFGYS--PDKLLLKDVNLDIQMDSRIALVGANGCGKTTLLKVMLEQLRPLSGYV 589

Query: 567 LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCH 626
                      S++ R +I    Q  V       D++           ++ T A      
Sbjct: 590 -----------SRNPRLRIGYFTQHHV-------DSM-----------DLSTSAVDWMSK 620

Query: 627 NFIVKFPYTYDTYIGPHG----------TLLSGGQKQRIAIARALIKKPNILILDEATSA 676
            F  K    Y  ++G  G           LLSGGQK R+A A   +  P+ILILDE ++ 
Sbjct: 621 TFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNH 680

Query: 677 LDVESEGAI-----NYTFGQLMKSKSMTIVS 702
           LD     A+     N+T G LM S  +++++
Sbjct: 681 LDTTGIDALVDAMKNFTGGILMVSHDISVIN 711

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +KS   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKSYPSTVLTVSH 422

>KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {ON}
           Anc_8.661 YPL147W
          Length = 876

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 103/206 (50%), Gaps = 21/206 (10%)

Query: 527 SLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIA 586
           S+ F    GS++ I+GP+G GKS+I  ++   + P   +          L SK     + 
Sbjct: 636 SIPFLNSAGSSLLILGPNGCGKSSIQRIIAEIW-PIYNK--------NGLLSKPTEANLL 686

Query: 587 VVQQEPVLM-SGTIRDNITYGLTEEP-----TKEEIRTVAKQCFCHNFIVKFP--YTYDT 638
            V Q+P     GT+RD I Y ++ +       K+++     +    ++++K    ++Y  
Sbjct: 687 CVPQKPYFTRGGTLRDQIIYPMSSDEFFDRGLKDKLLVQVLREVKLDYLLKRDKGWSYLD 746

Query: 639 YIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSM 698
            +     +LSGG+KQR+  AR +  KP  ++LDEAT+A+  + E   +Y F  ++K    
Sbjct: 747 TVSDWKDVLSGGEKQRMNFARIMFHKPRFVVLDEATNAISADME---DYLFN-VLKRYRF 802

Query: 699 TIVSIAHRLSTIRRSENIIVLGNDGS 724
             ++I+ R S I+  + ++ + +D S
Sbjct: 803 NFITISQRPSLIKYHDLLLEISDDNS 828

>ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} similar
            to uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15
            ATP binding cassette (ABC) transporter of the plasma
            membrane general stress response factor implicated in
            cellular detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1498

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 108/222 (48%), Gaps = 18/222 (8%)

Query: 519  RPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNP--TSGQILIDGQDITKL 576
            R S +I  +++  +KPG+   ++G SG GK+T+   L         +G I +DG    KL
Sbjct: 866  RESKRILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAERVTTGVITGGIFVDG----KL 921

Query: 577  NSKSLRRQIAVVQQEPV-LMSGTIRDNITY-GLTEEPTK---EEIRTVAKQCFCHNFIVK 631
              +S  R I   QQ+ + L + T+R+++ +  +  +P      E R   ++    N +  
Sbjct: 922  RDESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQPKSVPASEKRKYVEEVI--NVLEM 979

Query: 632  FPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFG 690
             PY  D  +G  G  L+  Q++R+ I   L+ KP +LI LDE TS LD ++  +I     
Sbjct: 980  EPYA-DAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLIFLDEPTSGLDSQTAWSICQLIR 1038

Query: 691  QLMKSKSMTIVSIAHRLST--IRRSENIIVLGNDGSVVEMGK 730
            +L  ++   I+   H+ S   I+  + ++ L   G  V  G+
Sbjct: 1039 KL-ANRGQAILCTIHQPSAVLIQEFDRLLFLQKGGETVYFGE 1079

>YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}
           ARB1ATPase of the ATP-binding cassette (ABC) family
           involved in 40S and 60S ribosome biogenesis, has
           similarity to Gcn20p; shuttles from nucleus to
           cytoplasm, physically interacts with Tif6p, Lsg1p
          Length = 610

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 109/246 (44%), Gaps = 64/246 (26%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           + F ++SF Y + PS  +++ LNF +   S + +VGP+G GKST+  ++     P SG++
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 567 --------------LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPT 612
                           D  D+TK   + +R + + + Q+     G +     YGLT E  
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLTGEGQ 509

Query: 613 KEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDE 672
             ++ T                            LS GQ+ R+  A   +++PN+L+LDE
Sbjct: 510 TVQMAT----------------------------LSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 673 ATSALDVES----EGAINYTFGQLMKSKSMTIVSIAHRLSTIRR-SENIIVLGN------ 721
            T+ LD+ +      AIN   G         +V ++H    + + +++I V+ N      
Sbjct: 542 PTNGLDIPTIDSLADAINEFNG--------GVVVVSHDFRLLDKIAQDIFVVENKTATRW 593

Query: 722 DGSVVE 727
           DGS+++
Sbjct: 594 DGSILQ 599

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}
           Putative ABC transporter
          Length = 1294

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 66/248 (26%), Positives = 116/248 (46%), Gaps = 34/248 (13%)

Query: 509 FKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLL-------LHYYNP 561
           +K  +F + T+   +I +S+N   KPG    I+GPSG GKS++  L+       +     
Sbjct: 697 WKEGNFHHETK---EILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFD 753

Query: 562 TSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYG-------LTE----E 610
           TSG I+ +   +++L  K++   ++    + +L + T+++ + Y        LTE    E
Sbjct: 754 TSGSIMFNDIQVSELMFKNVCSYVSQ-DDDHLLAALTVKETLKYAAALRLHHLTEAERME 812

Query: 611 PTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILIL 670
            T   IR++  +  C N I+   +            +SGG+K+R+ +   L+  P IL+L
Sbjct: 813 RTDNLIRSLGLK-HCENNIIGNEFVKG---------ISGGEKRRVTMGVQLLNDPPILLL 862

Query: 671 DEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH--RLSTIRRSENIIVLGNDGSVVEM 728
           DE TS LD  +   I     +L + +  TI+   H  R    +R  N+++L   G     
Sbjct: 863 DEPTSGLDSFTSATILEILEKLCREQGKTIIITIHQPRSELFKRFGNVLLLAKSGRTAFN 922

Query: 729 GKFKELFA 736
           G   E+ A
Sbjct: 923 GSPDEMIA 930

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 637 DTYIGPHGTL-LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKS 695
           DT +G +    LSGG+K+R++I   +I  P+I+ LDE T+ LD  S   +  T  +L K 
Sbjct: 175 DTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTTGLDAYSAFLVIKTLKKLAKE 234

Query: 696 KSMTIVSIAHR 706
              T +   H+
Sbjct: 235 DGRTFIMSIHQ 245

>Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 84/187 (44%), Gaps = 45/187 (24%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           + F ++SF Y + PS  ++++LNF +   S + +VGP+G GKST+  ++     P SG++
Sbjct: 393 LAFDDISFHYESNPSENLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 567 --------------LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPT 612
                           D  D+TK   + +R +   V Q+     G +     YGLT E  
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPSVSQDFQYWRGQLG---RYGLTGEGQ 509

Query: 613 KEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDE 672
             ++ T                            LS GQ+ R+  A   +++PN+L+LDE
Sbjct: 510 TVQMAT----------------------------LSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 673 ATSALDV 679
            T+ LD+
Sbjct: 542 PTNGLDI 548

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 608

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 83/187 (44%), Gaps = 45/187 (24%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           + F ++SF+Y   P N +++ LNF +   S + +VGP+G GKST+  ++     P SG++
Sbjct: 391 LAFDDISFSYDDNPENNLYEKLNFGVDMDSRIALVGPNGVGKSTLLKIMTGQLMPQSGRV 450

Query: 567 --------------LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPT 612
                           D  D+TK   + +R +   + Q+     G +     YGLT E  
Sbjct: 451 SRHTHVKLGVYSQHSQDQLDLTKSPLEFVRDKYPNISQDFQYWRGQLG---RYGLTGEAQ 507

Query: 613 KEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDE 672
             ++ T                            LS GQ+ R+  A   +++PN+L+LDE
Sbjct: 508 TSQMGT----------------------------LSEGQRSRVVFALLALEQPNVLLLDE 539

Query: 673 ATSALDV 679
            T+ LD+
Sbjct: 540 PTNGLDI 546

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 225 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 279

>AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER036C
           (ARB1)
          Length = 607

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 63/265 (23%), Positives = 117/265 (44%), Gaps = 60/265 (22%)

Query: 485 LTDRVPTIR-PTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGP 543
           + DRV + R P + +   P    + F  +SF+Y   P N +++ LNF +   S   +VGP
Sbjct: 370 VADRVFSFRFPEVERLPPP---VLAFDEISFSYDGNPENNLYEKLNFGVDMDSRTALVGP 426

Query: 544 SGKGKSTIALLLLHYYNPTSGQI--------------LIDGQDITKLNSKSLRRQIAVVQ 589
           +G GKST+  ++     P  G++                D  D+TK   + +R + A + 
Sbjct: 427 NGVGKSTLLKIMTGELTPHGGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYAHIS 486

Query: 590 QEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSG 649
           ++     G +     YGLT E    ++ T                            LS 
Sbjct: 487 EDFQFWRGQLG---RYGLTGEAQTAQMAT----------------------------LSE 515

Query: 650 GQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLST 709
           GQ+ R+  A   +++PN+L+LDE T+ LD+ +  ++       + + +  +V ++H    
Sbjct: 516 GQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSL----ADAIDAFNGGVVVVSHDFRL 571

Query: 710 IRR-SENIIVLGN------DGSVVE 727
           + R +++I V+ N      DGS+++
Sbjct: 572 LDRIAKDIYVVENKTATRWDGSILD 596

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 224 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 278

>KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 103/238 (43%), Gaps = 55/238 (23%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           I+ ++VSF Y  +  N + K +N  ++  S + +VG +G GK+T+  +++    P  G +
Sbjct: 532 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLQGYV 589

Query: 567 LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCH 626
                      S++ R +I    Q  V       D++           ++ T A      
Sbjct: 590 -----------SRNGRLRIGYFTQHHV-------DSM-----------DLTTSAVDWMSK 620

Query: 627 NFIVKFPYTYDTYIGPHG----------TLLSGGQKQRIAIARALIKKPNILILDEATSA 676
            F  K    Y  ++G  G           LLSGGQK R+A A   +  P+ILILDE ++ 
Sbjct: 621 TFPGKNDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNH 680

Query: 677 LDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMG 729
           LD     A+     N++ G LM         ++H +S I    N I +  +G+V + G
Sbjct: 681 LDTTGLDALIDALKNFSGGVLM---------VSHDISVINSVCNEIWVSEEGTVKKFG 729

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K+   T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATLLVVSH 422

>TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {ON}
           Anc_8.661 YPL147W
          Length = 915

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 99/207 (47%), Gaps = 27/207 (13%)

Query: 527 SLNFKIKPGSNVCIVGPSGKGKSTIALLLLHY---YNPTSGQILIDGQDITKLNSKSLRR 583
           +L F   PGS++ I+GP+  GKS+I  ++      YN  +G + I  +D           
Sbjct: 675 TLPFSYGPGSSLLILGPNSCGKSSIQRIIAEIWPIYNK-NGLMSIPAED----------- 722

Query: 584 QIAVVQQEPVL-MSGTIRDNITYGLTEE-------PTKEEIRTVAKQCFCHNFIVKFPYT 635
           ++  + Q P     GT RD I Y +  +         K  ++ +A     +       ++
Sbjct: 723 ELMCIPQRPYFSKGGTFRDQIIYPMGSDEFFDRGLKDKLLVQILADVKLEYLLKRDKGWS 782

Query: 636 YDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKS 695
           Y   +     +LSGG+KQR+  AR L  KP  +ILDEAT+A+ V+ E   +Y F +++K 
Sbjct: 783 YFDAVFDWKDVLSGGEKQRMNFARILFHKPRFVILDEATNAISVDME---DYLF-KMLKK 838

Query: 696 KSMTIVSIAHRLSTIRRSENIIVLGND 722
                +SI+ R S ++  + ++ +  D
Sbjct: 839 YRFNFISISQRPSLVKYHDLLLEISED 865

>Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 94/196 (47%), Gaps = 21/196 (10%)

Query: 535 GSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVL 594
           GS++ I+GP+  GKS+I  ++   + P   +          L S      I  + Q+P  
Sbjct: 638 GSSLLILGPNSCGKSSIQRIIAEIW-PVYNK--------NGLLSIPSENNIFCIPQKPYF 688

Query: 595 -MSGTIRDNITYGLTEE-------PTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTL 646
              GT+RD I Y ++ +         KE ++ + +    +        TY   +     L
Sbjct: 689 SKGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVRLDYLLKRGVGLTYLDAVADWKDL 748

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 706
           LSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K      +SI+ R
Sbjct: 749 LSGGEKQRVNFARVMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISISQR 804

Query: 707 LSTIRRSENIIVLGND 722
            + I+  E ++ +G +
Sbjct: 805 PTLIKYHEMLLEIGEN 820

>KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 104/238 (43%), Gaps = 55/238 (23%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           I+ ++VSF Y  +  + + K +N  ++  S + +VG +G GK+T+  +++    PTSG +
Sbjct: 532 IQLQDVSFGYEEQ--SLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTSGYV 589

Query: 567 LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCH 626
                      S++ R +I    Q  V       D++           ++ T A      
Sbjct: 590 -----------SRNGRLRIGYFTQHHV-------DSM-----------DLNTSAVDWMSK 620

Query: 627 NFIVKFPYTYDTYIGPHG----------TLLSGGQKQRIAIARALIKKPNILILDEATSA 676
            +  K    Y  ++G  G           LLSGGQK R+A A   +  P+IL+LDE ++ 
Sbjct: 621 TYPGKTDEEYRRHLGAFGITGTLGLQQMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 677 LDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMG 729
           LD     A+      +T G LM         ++H +S I    N I +  DG+V + G
Sbjct: 681 LDTTGLEALVDALKKFTGGVLM---------VSHDISVIDSVCNEIWVSEDGNVKKFG 729

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPSTVLTVSH 422

>Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 84/187 (44%), Gaps = 45/187 (24%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           + F ++SF Y + PS  +++ LNF +   S + +VGP+G GKST+  ++     P SG++
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 567 --------------LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPT 612
                           D  D+TK   + +R + + + Q+     G +     YGLT E  
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLTGEGQ 509

Query: 613 KEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDE 672
             ++ T                            LS GQ+ R+  A   +++PN+L+LDE
Sbjct: 510 TVQMAT----------------------------LSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 673 ATSALDV 679
            T+ LD+
Sbjct: 542 PTNGLDI 548

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 84/187 (44%), Gaps = 45/187 (24%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           + F ++SF Y + PS  +++ LNF +   S + +VGP+G GKST+  ++     P SG++
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 567 --------------LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPT 612
                           D  D+TK   + +R + + + Q+     G +     YGLT E  
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLTGEGQ 509

Query: 613 KEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDE 672
             ++ T                            LS GQ+ R+  A   +++PN+L+LDE
Sbjct: 510 TVQMAT----------------------------LSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 673 ATSALDV 679
            T+ LD+
Sbjct: 542 PTNGLDI 548

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 830

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 98/209 (46%), Gaps = 20/209 (9%)

Query: 523 QIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLR 582
            I K L F+  PGS++ I+GP+G GK++I  ++   +   +   L+     + L      
Sbjct: 589 NINKKLAFQ-GPGSSMLILGPNGSGKTSIQRIIAEIWPIYNKNGLLSIPPASDL------ 641

Query: 583 RQIAVVQQEPVLMSGTIRDNITYGLTEEP-------TKEEIRTVAKQCFCHNFIVKFPYT 635
               V Q+   +  GT R+ I Y ++ +         KE    + +    +       + 
Sbjct: 642 --FCVPQKPYFIQGGTFREQIIYPMSADQYFDMGYRDKELTHILGEVKLDYLLKRDKGWR 699

Query: 636 YDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKS 695
           Y   +     +LSGG++QRI  AR +  KP  ++LDEAT+A+  + E   +Y FG L+K 
Sbjct: 700 YLDAVAEWKDVLSGGERQRINFARIMFHKPRFVVLDEATNAISADME---DYLFG-LLKR 755

Query: 696 KSMTIVSIAHRLSTIRRSENIIVLGNDGS 724
                ++I+ R S I+  +  + +  DG+
Sbjct: 756 YRFNFITISQRPSLIKYHDLALDISTDGT 784

>ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} similar to
            uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15 ATP
            binding cassette (ABC) transporter of the plasma membrane
            general stress response factor implicated in cellular
            detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1462

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 114/237 (48%), Gaps = 25/237 (10%)

Query: 507  IEFKNVSFAYPTRP-SNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNP--TS 563
              ++NV +    +  + +I  +++  +KPG+   ++G +G GK+T+   L         +
Sbjct: 819  FHWRNVCYDVQIKSETRRILDNIDGWVKPGTLTALMGATGAGKTTLLDSLAQRVTTGVLT 878

Query: 564  GQILIDGQDITKLNSKSLRRQIAVVQQEPV-LMSGTIRDNITY-GLTEEPTK---EEIRT 618
            G I +DG    KL  +S  R I   QQ+ + L + T+R+++ +  +  +P      E R 
Sbjct: 879  GSIFVDG----KLRDESFARSIGYCQQQDLHLTTATVRESLLFSAMLRQPKSVPASEKRK 934

Query: 619  VAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILI-LDEATSAL 677
              ++    N +   PY  D  +G  G  L+  Q++R+ I   L  KPN+L+ LDE TS L
Sbjct: 935  YVEEVI--NVLEMEPYA-DAIVGVAGEGLNVEQRKRLTIGVELAAKPNLLLFLDEPTSGL 991

Query: 678  DVESEGAINYTFGQLMK---SKSMTIVSIAHRLST--IRRSENIIVLGNDGSVVEMG 729
            D ++  +I     QLMK   ++   I+   H+ S   I+  + ++ L   G  V  G
Sbjct: 992  DSQTAWSI----CQLMKKLANRGQAILCTIHQPSAMLIQEFDRLLFLQKGGQTVYFG 1044

>TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1036

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 72/266 (27%), Positives = 123/266 (46%), Gaps = 40/266 (15%)

Query: 485 LTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQ-IFKSLNFKIKPGSNVCIVGP 543
           L D V T+  +  K+       + F+N+++   +  +++ I K ++  IKPG  + ++G 
Sbjct: 357 LVDEVETLDESFLKS--DNAAALSFENITYNVSSSKTDENILKGISGIIKPGQMMALLGG 414

Query: 544 SGKGKSTIA--LLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQ----------- 590
           SG GK+T+   L +       +G I ++G DI +   K   + I  V Q           
Sbjct: 415 SGAGKTTLLDILAMKRKTGQVTGSIKVNGSDIPR---KDFTKLIGFVDQDDYLLPTLTVY 471

Query: 591 EPVLMSGTIRDNITYGLTEEPTK-----EEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGT 645
           E VL S  +R   ++    + T+     EE+R +  +              D  IG    
Sbjct: 472 ETVLNSALLRLPRSFSFAAKQTRVYQVLEELRILDIK--------------DRVIGNDFE 517

Query: 646 L-LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIV-SI 703
             +SGG+K+R++IA  L+  P IL LDE TS LD  +   +     +L K+ + T+V SI
Sbjct: 518 RGISGGEKRRVSIACELVTSPLILFLDEPTSGLDANNANNVVECLVRLAKTYNRTLVLSI 577

Query: 704 AHRLSTIRRSENIIVLGNDGSVVEMG 729
               S I +  + +VL ++G +V  G
Sbjct: 578 HQPRSNIFQLFDKLVLLSNGEMVYSG 603

>CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 aa]
           {ON} highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036c ARB1
          Length = 720

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 58/245 (23%), Positives = 109/245 (44%), Gaps = 56/245 (22%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           + F ++SFAY   P N +++ LNF +   S   +VGP+G GKST+  ++     P SG++
Sbjct: 503 LAFDDISFAYDGNPENNLYEHLNFGVDMDSRTALVGPNGVGKSTLLKIMTGELMPQSGRV 562

Query: 567 --------------LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPT 612
                           D  D+TK   + +R + + + Q+     G +     YGLT +  
Sbjct: 563 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQYWRGQLG---RYGLTGDAQ 619

Query: 613 KEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDE 672
           K ++ T                            LS GQ+ R+  A   ++ PN+L+LDE
Sbjct: 620 KVQMGT----------------------------LSEGQRSRVVFALLALENPNVLLLDE 651

Query: 673 ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRR-SENIIVLGN------DGSV 725
            T+ LD+ +  ++     +     +  +V ++H    + + +++I V+ +      DGS+
Sbjct: 652 PTNGLDIPTIDSLADAINEF----NGGVVVVSHDFRLLDKIAKDIFVVEDKTATRWDGSI 707

Query: 726 VEMGK 730
           ++  K
Sbjct: 708 LDYKK 712

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +     + +K    T+V ++H
Sbjct: 337 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRFDRTLVLVSH 391

>KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.661
           YPL147W
          Length = 871

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 78/342 (22%), Positives = 139/342 (40%), Gaps = 75/342 (21%)

Query: 438 VLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQ---GAGAASRLFE-LTDRVPTIR 493
           ++H    I  LT +        N IF L      +       GAA++L +   D   T R
Sbjct: 502 LMHSMKDISQLTGYT-------NRIFNLLCILHRVHSVDFNYGAATKLMDDPADTNATSR 554

Query: 494 PTLGKTYTPGKGE------------IEFKNVSFAYPT---RPSNQIFKSLNFKIKP---- 534
             L K  +P K E            I  +N+    P+   +   ++ K L F+I P    
Sbjct: 555 HLLSKMKSPEKEEVISGTVQRKFRGIRLENIDIMIPSVRGKSGIKLIKKLTFQIPPHLDQ 614

Query: 535 -------------------------GSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILID 569
                                     S++ I+GP+G GKS+I  ++   +   +   L+ 
Sbjct: 615 LSSKTSSLQDITSMSNIPLPFLSGQASSLLILGPNGCGKSSIQRIIAEIWPIYNKNGLLS 674

Query: 570 GQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEP------TKEEIRTVAKQC 623
             D + L        + + Q+      GT RD I Y ++ +         + +  +  + 
Sbjct: 675 KPDSSSL--------LCIPQKPYFTRGGTFRDQIIYPMSSDEFFDNGFKDKVLVWILSEV 726

Query: 624 FCHNFIVKFP-YTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESE 682
                + + P ++Y   +     +LSGG+KQR+  AR L  KP  ++LDEAT+A+  + E
Sbjct: 727 HLDYLLKRAPGWSYLDEVTEWKDVLSGGEKQRMNFARILFHKPKFIVLDEATNAISADME 786

Query: 683 GAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGN-DG 723
              +Y F  L K +  + ++I+ R S I+  + ++ + + DG
Sbjct: 787 ---DYLFNMLKKFR-FSFITISQRPSLIKYHDMLLEIADRDG 824

>TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa]
           {ON} Anc_3.534 YER036C
          Length = 610

 Score = 67.4 bits (163), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 104/244 (42%), Gaps = 64/244 (26%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           + F ++SFAY  +P N ++  LNF +   S + +VGP+G GKST+  ++       SG++
Sbjct: 393 LSFDDISFAYDGKPENNLYNHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELQAQSGRV 452

Query: 567 --------------LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPT 612
                           D  D+TK   + +R +   + Q+     G +     YGLT E  
Sbjct: 453 SRHSHVKLGVYSQHSQDQLDLTKSALEFVRDKYPEISQDFQYWRGQLG---RYGLTGEAQ 509

Query: 613 KEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDE 672
             ++ T                            LS GQ+ R+  A   ++ PN+L+LDE
Sbjct: 510 TVQMGT----------------------------LSEGQRSRVVFALLALEAPNVLLLDE 541

Query: 673 ATSALDVES----EGAINYTFGQLMKSKSMTIVSIAHRLSTIRR-SENIIVLGN------ 721
            T+ LD+ +      AIN   G         +V ++H    + R +++I V+ N      
Sbjct: 542 PTNGLDIPTIDSLADAINEFNG--------GVVVVSHDFRLLDRIAKDIFVVENQTATRW 593

Query: 722 DGSV 725
           DGS+
Sbjct: 594 DGSI 597

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {ON}
           YOL075C (REAL)
          Length = 1302

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 110/246 (44%), Gaps = 31/246 (12%)

Query: 509 FKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLL-------LHYYNP 561
           FKN   +     + +I +S+N   KPG    I+GPSG GKS++  L+       L     
Sbjct: 702 FKNWKESKLHHETKEILQSVNAVFKPGMINAIMGPSGSGKSSLLNLISGRLKSSLFAKFD 761

Query: 562 TSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYG-------LTE----E 610
           TSG I+ +   +++L  K++   ++    + +L + T+++ + Y        L E    E
Sbjct: 762 TSGTIMFNDIQVSELMFKNVCSYVSQ-DDDHLLATLTVKETLKYAAALRLHHLNEAERTE 820

Query: 611 PTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILIL 670
            T   IR++  +  C N I+   +            +SGG+K+R+ +   L+  P IL+L
Sbjct: 821 RTDNLIRSLGLK-HCENNIIGNEFVKG---------ISGGEKRRVTMGVQLLSDPPILLL 870

Query: 671 DEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH--RLSTIRRSENIIVLGNDGSVVEM 728
           DE TS LD  +   I      L K    T++   H  R    +R  N+++L   G     
Sbjct: 871 DEPTSGLDSFTSATILEILENLCKEHGKTVIITIHQPRSELFKRFGNVLLLAKSGRTAFN 930

Query: 729 GKFKEL 734
           G   E+
Sbjct: 931 GSPDEM 936

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 637 DTYIGPHGTL-LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKS 695
           DT +G +    LSGG+K+R++I   +I  P+I+ LDE T+ LD  S   +  T  +L K 
Sbjct: 182 DTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTTGLDAYSAFLVIKTLKKLAKE 241

Query: 696 KSMTIVSIAHR 706
              T +   H+
Sbjct: 242 DGRTFIMSIHQ 252

>Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar to
           Ashbya gossypii ACR128C
          Length = 828

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 97/213 (45%), Gaps = 35/213 (16%)

Query: 520 PSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSK 579
           P++      N  + PGS++ I+GP+  GKS+I  ++   + P   +        T L S 
Sbjct: 583 PASSNLTQANVLLGPGSSLLILGPNSCGKSSIQRIIAEIW-PIYNK--------TGLLSI 633

Query: 580 SLRRQIAVVQQEPVLMSG-TIRDNITYGLTEEPTKE------EIRTVAKQCFCHNFIVKF 632
                +  + Q P  + G T RD I Y +  +   E      E+  V K+       VK 
Sbjct: 634 PSESDMMCIAQRPYFIQGGTFRDQIIYPMFVDTFYEKGHKDRELVRVLKE-------VKL 686

Query: 633 PY--------TYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGA 684
            Y         Y  ++     +LSGG+KQR+  AR +  +P  ++LDEAT+A+  + E  
Sbjct: 687 DYLLKRADALNYLDHVADWKDVLSGGEKQRMNFARIMFHRPKFIVLDEATNAISADME-- 744

Query: 685 INYTFGQLMKSKSMTIVSIAHRLSTIRRSENII 717
            +Y F  L K +    +SI+ R S I+  + ++
Sbjct: 745 -DYLFNMLKKFR-FNFISISQRPSLIKYHDYLL 775

>Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar to
           Ashbya gossypii AFR232C
          Length = 609

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 93/210 (44%), Gaps = 49/210 (23%)

Query: 485 LTDRVPTIR-PTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGP 543
           ++DRV + R P + +   P    + F  +SF+Y  +P N ++++LNF +   S V +VGP
Sbjct: 372 VSDRVFSFRFPEVERLPPP---VLAFDEISFSYDEKPENNLYENLNFGVDMDSRVALVGP 428

Query: 544 SGKGKSTIALLLLHYYNPTSGQI--------------LIDGQDITKLNSKSLRRQIAVVQ 589
           +G GKST+  ++     P  G++                D  D+TK   + +R +   + 
Sbjct: 429 NGVGKSTLLKIMTGELTPQGGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYGHIS 488

Query: 590 QEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSG 649
           ++     G +     YGLT E    ++ T                            LS 
Sbjct: 489 EDFQYWRGQLG---RYGLTGEGQTVQMGT----------------------------LSE 517

Query: 650 GQKQRIAIARALIKKPNILILDEATSALDV 679
           GQ+ R+  A   + +PN+L+LDE T+ LD+
Sbjct: 518 GQRSRVVFALLALDQPNVLLLDEPTNGLDI 547

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 226 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 280

>NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {ON}
           Anc_1.366
          Length = 755

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 91/210 (43%), Gaps = 46/210 (21%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           I+ ++VSF Y   P + + K +N  ++  S + +VG +G GK+T+  +++    PT G +
Sbjct: 535 IQLQDVSFGYD--PESLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEELRPTKGFV 592

Query: 567 LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCH 626
                      S++ R +I    Q  V      +  + +  T  P K +           
Sbjct: 593 -----------SRNGRLRIGYFTQHHVDSLDLTKSAVDWMSTAYPGKND----------- 630

Query: 627 NFIVKFPYTYDTYIGPHG----------TLLSGGQKQRIAIARALIKKPNILILDEA--- 673
                    Y  ++G  G           LLSGGQK R+A A   +  P+IL+LDE    
Sbjct: 631 -------EEYRRHLGSFGITGSLGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 683

Query: 674 --TSALDVESEGAINYTFGQLMKSKSMTIV 701
             TS LD   +   N++ G LM S  ++I+
Sbjct: 684 LDTSGLDALEDSLKNFSGGVLMVSHDISII 713

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 371 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLTVSH 425

>Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {ON}
           YOL075C (REAL)
          Length = 1295

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 110/237 (46%), Gaps = 33/237 (13%)

Query: 521 SNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLL--------LHYYNPTSGQILIDGQD 572
           + QI +S+N   KPG    I+GPSG GKS++  L+           +N T+G I+++   
Sbjct: 707 TKQILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSFFAKFN-TAGSIMLNDIQ 765

Query: 573 ITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYG-------LTE----EPTKEEIRTVAK 621
           +++   K++   ++    + +L + T+++ + Y        LTE    E T   IR++  
Sbjct: 766 VSEFMFKNVCSYVSQ-DDDHLLATLTVKETLKYASALRLHHLTEAERMERTDNLIRSLGL 824

Query: 622 QCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVES 681
           +  C N I+   +            +SGG+K+R+ +   L+  P IL+LDE TS LD  +
Sbjct: 825 K-HCENNIIGNEFVKG---------ISGGEKRRVTMGVQLLNDPPILLLDEPTSGLDSFT 874

Query: 682 EGAINYTFGQLMKSKSMTIVSIAH--RLSTIRRSENIIVLGNDGSVVEMGKFKELFA 736
              I     +L   +  T++   H  R    +R  N+++L   G     G   E+ A
Sbjct: 875 SATILEILEKLCTEQGKTVIITIHQPRSELFKRFGNVLLLAKSGRTAFNGSPDEMIA 931

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 52/100 (52%), Gaps = 2/100 (2%)

Query: 637 DTYIGPHGTL-LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKS 695
           DT +G +    LSGG+K+R++I   +I  P+++ LDE T+ LD  S   +  T  +L K 
Sbjct: 175 DTLVGDNSHRGLSGGEKRRLSIGTQMISNPSVMFLDEPTTGLDAYSAYLVIKTLKKLAKE 234

Query: 696 KSMT-IVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
              T I+SI    S I    + + + + G+VV   K   +
Sbjct: 235 DGRTFIMSIHQPRSDILFLLDQVCILSKGNVVYCDKMNNI 274

>Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]
           {ON} YER036C (KRE30) - Hypothetical ORF [contig 188]
           FULL
          Length = 607

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 107/246 (43%), Gaps = 64/246 (26%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           + F ++SFAY  +P N +++ LNF +   S V +VGP+G GKST+  ++       SG++
Sbjct: 390 LAFDDISFAYDGKPENNLYEHLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELATQSGRV 449

Query: 567 --------------LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPT 612
                           D  D+TK   + +R + + +  +     G +     YGLT E  
Sbjct: 450 SRHTHVKLGVYSQHSQDQLDLTKSPLEFVRDKYSHISHDFQYWRGQLG---RYGLTGEGQ 506

Query: 613 KEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDE 672
             ++ T                            LS GQ+ R+  A   ++ PN+L+LDE
Sbjct: 507 TSQMAT----------------------------LSEGQRSRVVFALLALQAPNVLLLDE 538

Query: 673 ATSALDVES----EGAINYTFGQLMKSKSMTIVSIAHRLSTIRR-SENIIVLGN------ 721
            T+ LD+ +      AIN   G         +V ++H    + + +++I V+ N      
Sbjct: 539 PTNGLDIATIDSLADAINEFNG--------GVVVVSHDFRLLDKIAKDIFVVENKTATRW 590

Query: 722 DGSVVE 727
           DGS+++
Sbjct: 591 DGSILD 596

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 224 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 278

>KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa]
           {ON} Anc_3.133 YOL075C
          Length = 1284

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 105/231 (45%), Gaps = 21/231 (9%)

Query: 519 RPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPT-------SGQILIDGQ 571
           R   +I +S+N   KPG    I+GPSG GKST+  L+      T        G +  +G 
Sbjct: 691 RERKKILRSVNATFKPGMVNAIMGPSGSGKSTLLNLISGRVKSTLFSRFTKDGSMSFNGA 750

Query: 572 DITKLNSKSLRRQIA--VVQQEPVLMSG-TIRDNITYGLTEEPTKEEIRTVAKQCFCHNF 628
           ++    S+++ +QI   V Q +  L+S  T+R+  T+    +     +    ++   +N 
Sbjct: 751 EV----SETMFKQICSYVSQDDDHLLSKLTVRE--TFKFASDLRLHHLNAKEREAKRNNL 804

Query: 629 IVKF--PYTYDTYIGPHGTL-LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 685
           I+     +  DT IG      +SGG+K+R+ +   L+  P IL+LDE TS LD  +   I
Sbjct: 805 IIALGLKHCEDTIIGNEFVKGISGGEKRRVTMGIQLLNDPPILLLDEPTSGLDSFTSSTI 864

Query: 686 NYTFGQLMKSKSMTIVSIAH--RLSTIRRSENIIVLGNDGSVVEMGKFKEL 734
                 L +    T++   H  R    ++  N+++L   G     G   E+
Sbjct: 865 LEILSNLCQEYGKTVILTIHQPRAELFKKFGNVLLLAKSGRTAFNGSPDEM 915

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 88/206 (42%), Gaps = 29/206 (14%)

Query: 518 TRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYN---PTSGQILIDGQDIT 574
           ++   ++ KS +  +  GS + ++G SG GK+T+  +L    +    T G+I    +D  
Sbjct: 30  SKTDAELVKSFSLDLPSGSIMAVMGGSGSGKTTLLNVLASKISGGLKTVGEINYIREDCG 89

Query: 575 KLNSKSLRRQIAVV--QQEPVLMSGTIRDNITYGLT---EEPTKEEIRTVA--------K 621
             +       +     QQ+ +    T RD + +      ++P  E+++ V         K
Sbjct: 90  VNDGDHPEHAVMTYLPQQDVLPARLTCRDTMMFAADLKLDKPKHEKVQIVEQLIDELGLK 149

Query: 622 QCFCHNFIVKFPYTYDTYIGPHGTL-LSGGQKQRIAIARALIKKPNILILDEATSALDVE 680
            C             DT IG      LSGG+K+R++I   +I  P+I+ LDE T+ LD  
Sbjct: 150 DC------------ADTIIGDSSHRGLSGGEKRRLSIGTQMIANPSIMFLDEPTTGLDAY 197

Query: 681 SEGAINYTFGQLMKSKSMTIVSIAHR 706
           S   +  T  +L +      +   H+
Sbjct: 198 SAYLVVKTIRKLAEDDGRIFIMSIHQ 223

>NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661
          Length = 897

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 104/220 (47%), Gaps = 29/220 (13%)

Query: 521 SNQIFKSLN------FKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDIT 574
           S Q FK +N      F    GS++ I+GP+  GK++I  ++   + P   +         
Sbjct: 645 STQDFKQINDMSSIPFIHGSGSSLLILGPNSSGKTSIQRIIAEIW-PIYNK--------N 695

Query: 575 KLNSKSLRRQIAVVQQEPVLMS-GTIRDNITYGLTEEP-----TKEEIRTVAKQCFCHNF 628
            L S   +  I  + Q P   S GT+RD I Y ++ +       K+ +     +     +
Sbjct: 696 GLLSVPSQENIFCIPQRPYFTSSGTLRDQIIYPMSSDEFFDRGLKDSLLIQILKEVNLKY 755

Query: 629 IVKFP--YTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAIN 686
           ++K     TY   +     LLSGG+KQRI  AR L  KP  ++LDEAT+A+  + E   +
Sbjct: 756 LMKRSKGLTYLDTVADWKDLLSGGEKQRINFARILFHKPRFIVLDEATNAISQDME---D 812

Query: 687 YTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLG--NDGS 724
           Y F  ++K      ++I+ R S I+  + ++ +   NDG+
Sbjct: 813 YLFN-ILKKYRFNFITISQRPSLIKYHDLLLEISDHNDGT 851

>KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]
           {ON} highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 105/240 (43%), Gaps = 48/240 (20%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           I+ ++VSF +   PS  + K +N  ++  S + IVG +G GK+T+  +L+    P  G +
Sbjct: 532 IQLQDVSFGFD--PSQLLLKDVNLDVQMDSRIAIVGANGCGKTTLLKILMEQLRPLQGYV 589

Query: 567 LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCH 626
                      S++ R ++A   Q  V       D++           ++   A     +
Sbjct: 590 -----------SRNPRLRVAYFTQHHV-------DSM-----------DLNASAVDWMSN 620

Query: 627 NFIVKFPYTYDTYIGPHG----------TLLSGGQKQRIAIARALIKKPNILILDEATSA 676
            F  +    Y  ++G  G           LLSGGQK R+A A   +  P+IL+LDE ++ 
Sbjct: 621 TFPGRTDEEYRRHLGAFGITGSLGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 677 LDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKF 731
           LD     A+      +T G LM S  ++++      + I  SEN  V   +G++ +   +
Sbjct: 681 LDTAGLDALMDALKKFTGGVLMVSHDISVIDGV--CNEIWVSENGTVRRFEGTIFDYKNY 738

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K+   T+V ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVVVVSH 422

>TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa]
           {ON} Anc_8.661 YPL147W
          Length = 872

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 91/193 (47%), Gaps = 21/193 (10%)

Query: 527 SLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIA 586
           SL F   PG+++ I+GP+  GKS+I  ++   + P   +          L S      + 
Sbjct: 632 SLPFFEGPGASLLILGPNSCGKSSIQRIIAEIW-PVYNK--------NGLLSIPSEGNLF 682

Query: 587 VVQQEPVLM-SGTIRDNITYGLTEE-------PTKEEIRTVAKQCFCHNFIVKFPYTYDT 638
            V Q+P     GT+RD I Y ++ +         K  ++ + +    +    K  +TY  
Sbjct: 683 CVPQKPYFTRGGTLRDQIIYPMSSDEFFDRGFKDKHLVQILGEVRLEYLLKRKKGWTYLD 742

Query: 639 YIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSM 698
            +     +LSGG+KQR+  AR +  KP  ++LDE T+A+  + E   +Y F  L+K    
Sbjct: 743 AVADWKDVLSGGEKQRMNFARIMFHKPRFVVLDEGTNAISADME---DYLF-NLLKRYRF 798

Query: 699 TIVSIAHRLSTIR 711
             +SI+ R S I+
Sbjct: 799 NFISISQRPSLIK 811

>TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]
           {ON} Anc_1.427 YCR011C
          Length = 1119

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 119/247 (48%), Gaps = 31/247 (12%)

Query: 507 IEFKNVSFAYPTRPSNQ----IFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNP- 561
           + F+N+S+  P+   N     I K+++  +KPG  + I+G SG GK+T+  +L       
Sbjct: 433 LSFENISYNVPSISDNNSERDILKNVSGIVKPGEIMAILGGSGAGKTTLLDILAFKRKSG 492

Query: 562 -TSGQILIDGQDITKLNSKSLRRQIAVVQQ-----------EPVLMSGTIRDNITYGLTE 609
             SG I I+G+++++   + + + I  V Q           E VL S  +R  +   +T 
Sbjct: 493 HVSGDIKINGKNVSR---EIISKMIGFVDQDDFLFPTLTVYEAVLNSALLR--LPNSMTF 547

Query: 610 EPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTL-LSGGQKQRIAIARALIKKPNIL 668
              ++ +  V ++   +N         D  IG      +SGG+K+R++IA  L+  P IL
Sbjct: 548 YQKQQRVFQVLEELRIYNI-------KDRLIGDDFERGISGGEKRRVSIACELVTSPLIL 600

Query: 669 ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR-LSTIRRSENIIVLGNDGSVVE 727
            LDE TS LD  +   +     +L K+ + T+V   H+  S I    + +VL + G +V 
Sbjct: 601 FLDEPTSGLDSNNANNVVECLVRLAKNYNRTLVLTIHQPRSNIFHLFSKLVLLSSGEMVY 660

Query: 728 MGKFKEL 734
            G+ + +
Sbjct: 661 SGEIRRV 667

>KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} similar
           to uniprot|P41909 Saccharomyces cerevisiae YPL147W PXA1
           Pxa1p and Pxa2p appear to be subunits of a peroxisomal
           ATP-binding cassette transporter necessary for transport
           of long-chain fatty acids into peroxisomes ABC family
           long-chain fatty acid transporter
          Length = 845

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 105/233 (45%), Gaps = 31/233 (13%)

Query: 510 KNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILID 569
           K VS A    P +Q    +N  +  GS++ I+GP+  GKS+I  +L   + P   +    
Sbjct: 592 KQVSLANVRDPLDQSRFMINHGM--GSSLLILGPNSCGKSSIERILTEIW-PIYNK---- 644

Query: 570 GQDITKLNSKSLRRQIAVVQQEPVLMSG-TIRDNITYGLTEEPTKEEIRTVAKQCFCHNF 628
                 L S      +  V Q P  + G T RD I Y +T E   E      K  +    
Sbjct: 645 ----NGLLSTPPSHDLFCVPQRPYFIQGGTFRDQIIYPMTYEQFHERGH---KDTYLVQI 697

Query: 629 I--VKFPY--------TYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALD 678
           +  V+  Y         Y   I     +LSGG+KQR+   R +  +P  ++LDEAT+A+ 
Sbjct: 698 LREVRLDYLLKRDRGLNYFDAIADWKDVLSGGEKQRMNFTRIMFHRPRFVVLDEATNAIS 757

Query: 679 VESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVL--GNDGSVVEMG 729
           V+ E  + +T   ++K      +SI+ R S I+  + ++ L  G D S+  +G
Sbjct: 758 VDMEDHL-FT---MLKRYRFNFISISQRPSLIKYHDYLLELTNGTDWSLQALG 806

>NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON} 
          Length = 610

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 109/242 (45%), Gaps = 56/242 (23%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           + F ++SF+Y   P N ++++L+F +   S + +VGP+G GKST+  ++     P SG++
Sbjct: 393 LAFDSISFSYDGNPENNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 567 --------------LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPT 612
                           D  D+TK   + +R +   + Q+     G +     YGLT E  
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPNISQDFQYWRGQLG---RYGLTGEGQ 509

Query: 613 KEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDE 672
             ++ T                            LS GQ+ R+  A   +++PN+L+LDE
Sbjct: 510 TVQMGT----------------------------LSEGQRSRVVFALLALEQPNVLLLDE 541

Query: 673 ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRR-SENIIVLGN------DGSV 725
            T+ LD+ +  ++     +     +  +V ++H    + + +++I V+ N      +GS+
Sbjct: 542 PTNGLDIPTIDSLAEAINEF----NGGVVVVSHDFRLLDKIAKDIFVVENKTATRWNGSI 597

Query: 726 VE 727
           +E
Sbjct: 598 LE 599

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR009W (GCN20)
          Length = 753

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 104/240 (43%), Gaps = 48/240 (20%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           I+ ++VSF Y    S  + K +N  ++  S + +VG +G GK+T+  +++    P +G +
Sbjct: 533 IQLQDVSFGYD--ESQLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPITGHV 590

Query: 567 LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCH 626
                      S++ R +I    Q  +       D++           ++   A      
Sbjct: 591 -----------SRNPRLRIGYFTQHHI-------DSM-----------DLNASAVDWMSK 621

Query: 627 NFIVKFPYTYDTYIGPHG----------TLLSGGQKQRIAIARALIKKPNILILDEATSA 676
            F  K    Y  ++G  G           LLSGGQK R+A A   +  P+ILILDE ++ 
Sbjct: 622 TFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNSPHILILDEPSNH 681

Query: 677 LDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKF 731
           LD     A+     N++ G LM S  ++++        I  SE+  V   DG++ +  K+
Sbjct: 682 LDTAGLDALVQALKNFSGGVLMVSHDISVIDSV--CDEIWVSESGTVKRFDGNIHDYKKY 739

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (64%), Gaps = 4/62 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 706
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K+   T++ ++H 
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSHD 424

Query: 707 LS 708
            S
Sbjct: 425 RS 426

>ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009W GCN20 Positive regulator of the Gcn2p kinase
           activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 65/272 (23%), Positives = 112/272 (41%), Gaps = 65/272 (23%)

Query: 478 AASRLFELTDRVPTIRPTLGKTYTPGKGE---------IEFKNVSFAYPTRPSNQIFKSL 528
           A SR+ +L +++P + P  G+     K           I+ ++V+F Y    +N + K +
Sbjct: 495 AQSRIKKL-EKLPVLEPPEGEKSVSFKFPECSKLSPPIIQLQDVTFGY--NENNLLLKDV 551

Query: 529 NFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVV 588
           N  ++  S + +VG +G GK+T+  +++    P  G +           S++ R ++   
Sbjct: 552 NLDVQLNSRIALVGANGCGKTTLLKIMMETLTPLKGYV-----------SRNPRLRLGYF 600

Query: 589 QQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHG---- 644
            Q  V                     ++   A +     F  +    Y  ++G  G    
Sbjct: 601 AQHHV------------------DAMDLNASAVEWMSKTFPGRSDEEYRRHLGSFGITGS 642

Query: 645 ------TLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI-----NYTFGQLM 693
                  LLSGGQK R+A A   +  P++LILDE ++ LD     A+     N+T G LM
Sbjct: 643 LGLQRMELLSGGQKSRVAFAALCLNNPHVLILDEPSNHLDTSGIDALVDALKNFTGGVLM 702

Query: 694 KSKSMTIVSIAHRLSTIRRSENIIVLGNDGSV 725
                    ++H +S I    N I +  DGS 
Sbjct: 703 ---------VSHDISVINSVCNEIWVSEDGSA 725

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +KS   TI+ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKSYPSTILVVSH 422

>TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {ON}
           Anc_3.534 YER036C
          Length = 610

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 95/208 (45%), Gaps = 49/208 (23%)

Query: 487 DRVPTIR-PTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSG 545
           DRV + R P + +   P    + F ++SF+Y  +P N +++ LNF +   S + +VGP+G
Sbjct: 375 DRVFSFRFPQVDRLPPP---VLAFDDISFSYDGKPENNLYEHLNFGVDMDSRIALVGPNG 431

Query: 546 KGKSTIALLLLHYYNPTSGQI--------------LIDGQDITKLNSKSLRRQIAVVQQE 591
            GKST+  ++       SG++                D  D+TK   + +R + + + Q+
Sbjct: 432 VGKSTLLKIMTGELMSQSGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQD 491

Query: 592 PVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQ 651
                G +     YGLT E      +TV                        GT LS GQ
Sbjct: 492 FQYWRGQLG---RYGLTGEA-----QTVL----------------------MGT-LSEGQ 520

Query: 652 KQRIAIARALIKKPNILILDEATSALDV 679
           + R+  A   +++PN+L+LDE T+ LD+
Sbjct: 521 RSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009W
           (GCN20) - 1:1 [contig 265] FULL
          Length = 752

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 104/240 (43%), Gaps = 48/240 (20%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           I+ ++VSF +   P   + K +N  ++  S + +VG +G GK+T+  +L+    P  G +
Sbjct: 532 IQLQDVSFGFD--PKQLLLKDVNLDVQMDSRIALVGANGCGKTTLLKILMEQLRPIQGYV 589

Query: 567 LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCH 626
                      S++ R ++A   Q  V       D++           ++ T A      
Sbjct: 590 -----------SRNPRLRVAYFTQHHV-------DSM-----------DLNTSAVDWMST 620

Query: 627 NFIVKFPYTYDTYIGPHG----------TLLSGGQKQRIAIARALIKKPNILILDEATSA 676
            F  K    Y  ++G  G           LLSGGQK R+A A   +  P+IL+LDE ++ 
Sbjct: 621 TFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 677 LDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKF 731
           LD     A+      +T G LM S  ++++      + I  SEN  V   +G++ +   +
Sbjct: 681 LDTAGLDALMDALKKFTGGVLMVSHDISVIDGV--CNEIWVSENGTVKRFEGTIFDYKNY 738

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K+   T+V ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVVVVSH 422

>YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Positive
           regulator of the Gcn2p kinase activity, forms a complex
           with Gcn1p; proposed to stimulate Gcn2p activation by an
           uncharged tRNA
          Length = 752

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 92/210 (43%), Gaps = 46/210 (21%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           I+ ++VSF Y    +N + K +N  ++  S + +VG +G GK+T+  +++    P  G +
Sbjct: 532 IQLQDVSFGYD--ENNLLLKDVNLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPLKGFV 589

Query: 567 LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCH 626
                      S++ R +I    Q  V       D++           ++ T A      
Sbjct: 590 -----------SRNPRLRIGYFTQHHV-------DSM-----------DLTTSAVDWMSK 620

Query: 627 NFIVKFPYTYDTYIGPHG----------TLLSGGQKQRIAIARALIKKPNILILDEA--- 673
           +F  K    Y  ++G  G           LLSGGQK R+A A   +  P+IL+LDE    
Sbjct: 621 SFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 674 --TSALDVESEGAINYTFGQLMKSKSMTIV 701
             T+ LD   E   N+  G LM S  ++++
Sbjct: 681 LDTTGLDALVEALKNFNGGVLMVSHDISVI 710

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSH 422

>TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {ON}
           Anc_3.133 YOL075C
          Length = 1312

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 111/246 (45%), Gaps = 31/246 (12%)

Query: 509 FKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLL-------LHYYNP 561
           F N+        + +I  S+N   KPG    I+GPSG GKS++  L+       +     
Sbjct: 713 FSNIKTGLYHHHTKEILNSINATFKPGMINAIMGPSGSGKSSLLNLISAKQKSSMFATFS 772

Query: 562 TSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSG-TIRDNITYG-------LTEEPTK 613
             G I ++  +I++   KSL   ++  Q +  L+S  T+R++  +        +  +   
Sbjct: 773 KEGSIALNDNEISEEMFKSLCAYVS--QDDDHLLSKLTVRESFKFAADLRLHYMCSDERD 830

Query: 614 EEIRTVAKQ---CFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILIL 670
           E+I T+ +      C N I+      D ++      +SGG+K+R+++   L+K P IL+L
Sbjct: 831 EKIDTLIRALGLTNCQNTIIG-----DEFVKG----ISGGEKRRVSMGIQLLKDPPILLL 881

Query: 671 DEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH--RLSTIRRSENIIVLGNDGSVVEM 728
           DE TS LD  +   +     QL      T++   H  R    ++  N+++L   G     
Sbjct: 882 DEPTSGLDSFTSLTVLEILEQLSADFGKTVIITIHQPRAELFKKFGNVLLLAKSGRTAFN 941

Query: 729 GKFKEL 734
           G  KE+
Sbjct: 942 GSPKEM 947

 Score = 40.4 bits (93), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 706
           LSGG+K+R++I   +I  P+++ LDE T+ LD  S   +  T  +L +    T +   H+
Sbjct: 196 LSGGEKRRLSIGTQMISNPSLMYLDEPTTGLDAYSAFLVIKTIKRLAQFGGRTFIMSIHQ 255

>TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa]
           {ON} Anc_3.534 YER036C
          Length = 610

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 91/208 (43%), Gaps = 49/208 (23%)

Query: 487 DRVPTIR-PTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSG 545
           DRV + R P + +   P    + F  ++F+Y   P N +++ LNF +   S + +VGP+G
Sbjct: 375 DRVFSFRFPEVERLPPP---VLAFDEINFSYDGNPENNLYEHLNFGVDMDSRIALVGPNG 431

Query: 546 KGKSTIALLLLHYYNPTSGQI--------------LIDGQDITKLNSKSLRRQIAVVQQE 591
            GKST+  ++     P +G++                D  D+TK   + +R +   + Q+
Sbjct: 432 VGKSTLLKIMTGELTPQAGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPQISQD 491

Query: 592 PVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQ 651
                G +     YGLT E    ++ T                            LS GQ
Sbjct: 492 FQYWRGQLG---RYGLTGEGQTVQMGT----------------------------LSEGQ 520

Query: 652 KQRIAIARALIKKPNILILDEATSALDV 679
           + R+  A   +++PN+L+LDE T+ LD+
Sbjct: 521 RSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W
           (REAL)
          Length = 752

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 93/210 (44%), Gaps = 46/210 (21%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           I+ ++VSF Y  +  N + K +N  ++  S + +VG +G GK+T+  +++    P  G +
Sbjct: 532 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPLKGFV 589

Query: 567 LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCH 626
                      S++ R +I    Q  V       D++           ++ T A      
Sbjct: 590 -----------SRNPRLRIGYFTQHHV-------DSM-----------DLTTSAVDWMSK 620

Query: 627 NFIVKFPYTYDTYIGPHG----------TLLSGGQKQRIAIARALIKKPNILILDEATSA 676
           +F  K    Y  ++G  G           LLSGGQK R+A A   +  P+IL+LDE ++ 
Sbjct: 621 SFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 677 LDVESEGAI-----NYTFGQLMKSKSMTIV 701
           LD     A+     N+  G LM S  ++++
Sbjct: 681 LDTTGLDALVDALKNFNGGVLMVSHDISVI 710

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSH 422

>ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} highly
            similar to gnl|GLV|CAGL0M01760g Candida glabrata
            CAGL0M01760g and similar to YOR153W uniprot|P33302
            Saccharomyces cerevisiae YOR153W PDR5 Short- lived
            membrane ABC (ATP-binding cassette) transporter actively
            exports various drugs expression regulated by Pdr1p also
            involved in steroid transport cation resistance and
            cellular detoxification during exponential growth
          Length = 1503

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 108/226 (47%), Gaps = 24/226 (10%)

Query: 521  SNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHY--YNPTSGQILIDGQDITKLNS 578
            + +I  +++  +KPG+   ++G SG GK+T+   L         +G I ++G    KL  
Sbjct: 863  TRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVITGDIFVNG----KLRD 918

Query: 579  KSLRRQIAVVQQEPV-LMSGTIRDNITY-GLTEEPTKEEIRTVAKQCFCHNFIVKF---P 633
            +S  R I   QQ+ + L + T+R+++ +  +  +P  + +    K+ +    I      P
Sbjct: 919  ESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQP--KSVPASEKRKYVEEVIKILEMEP 976

Query: 634  YTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQL 692
            Y  D  +G  G  L+  Q++R+ I   L+ KP +L+ LDE TS LD ++  +I     QL
Sbjct: 977  YA-DAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLVFLDEPTSGLDSQTAWSI----CQL 1031

Query: 693  MKSKS---MTIVSIAHRLSTIRRSE--NIIVLGNDGSVVEMGKFKE 733
            MK  S     I+   H+ S +   E   ++ L   G  V  G+  E
Sbjct: 1032 MKKLSNHGQAILCTIHQPSAMLMQEFDRLLFLQKGGKTVYFGELGE 1077

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 96/220 (43%), Gaps = 31/220 (14%)

Query: 507 IEFKNVSFAY----PTRPSN--QIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYN 560
           + +K +S+ Y    PT+ SN  QI K ++  +KP   + ++G  G G +T   LL    +
Sbjct: 128 LPWKFLSWVYRSLAPTKASNSFQILKPMDGIVKPSELLVVLGRPGSGCTT---LLKSISS 184

Query: 561 PTSGQILIDGQDIT------KLNSKSLRRQIAVVQQEPV-LMSGTIRDNITYGLTEEPTK 613
            T G  + +   I+      K  +K  R ++    +  + L   T+ + +      +  +
Sbjct: 185 NTHGFKITEDSTISYSGLSPKDINKHFRGEVVYNPEADIHLPHLTVYETLVTVARLKTAQ 244

Query: 614 EEIRTVAKQCFCHNF------IVKFPYTYDTYIGPHGTL---LSGGQKQRIAIARALIKK 664
             IR V ++ +  +            +T +T +G  G L   +SGG+++R++IA   I  
Sbjct: 245 NRIRGVDRESWARHITEVAMATYGLSHTRNTKVG--GDLVRGVSGGERKRVSIAEVTICG 302

Query: 665 PNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 704
                 D AT  LD     A    F + +++++  + S A
Sbjct: 303 SKFQCWDNATRGLD----AATALEFIKALRAQAQIVQSAA 338

>CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] {ON}
            highly similar to uniprot|P32568 Saccharomyces cerevisiae
            YDR011w SNQ2 multidrug resistance protein
          Length = 1507

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 113/239 (47%), Gaps = 24/239 (10%)

Query: 504  KGEIEFKNVSFAYPTRPS-NQIFKSLNFKIKPGSNVCIVGPSGKGKSTIA-LLLLHYYNP 561
            KG   ++NV +  P      Q+  +++   KPG+   ++G SG GK+T+   L       
Sbjct: 854  KGIFIWRNVCYTIPYDGGMRQLLDNVSGFCKPGTLTALMGESGAGKTTLLNTLAQRNVGI 913

Query: 562  TSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSG-TIRDNITY--------GLTEEPT 612
             +G +L++G+ I      S  R+   VQQ+ + +S  T+R+++ +         + EE  
Sbjct: 914  ITGDMLVNGKPI----DISFERRTGYVQQQDIHISELTVRESLQFSARMRRAQNVPEEEK 969

Query: 613  KEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILI-LD 671
             E +  + K       ++      D  +G  G  L+  Q+++++I   L+ KP++L+ LD
Sbjct: 970  MEHVERIIK-------VLDMEEYADALVGDVGRGLNVEQRKKLSIGVELVAKPDLLLFLD 1022

Query: 672  EATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENIIVLGNDGSVVEMG 729
            E TS LD +S  AI     +L K+    + +I    +T+    + +++L   G  V  G
Sbjct: 1023 EPTSGLDSQSSWAIVQLLKKLAKAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFG 1081

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 73/160 (45%), Gaps = 11/160 (6%)

Query: 533 KPGSNVCIVGPSGKGKSTI----ALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVV 588
           + G  V ++G  G G S++    A  +  +     G+I+ DG    ++  +     I   
Sbjct: 186 RAGEMVLVLGRPGAGCSSMLKVTAGEIDQFAGGVEGEIMYDGIPQKEMMKRYKPDVIYNG 245

Query: 589 QQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCF------CHNFIVKFPYTYDTYIGP 642
           +Q+      T++  + + +  +   + +  V+++ +       H  I    +TY T +G 
Sbjct: 246 EQDVHFPHLTVQQTLDFAIACKTPSKRVNDVSREEYIASTRDLHATIFGLRHTYHTKVGN 305

Query: 643 HGTL-LSGGQKQRIAIARALIKKPNILILDEATSALDVES 681
                +SGG+++R++IA AL+ K +I   D AT  LD  +
Sbjct: 306 DFVRGVSGGERKRVSIAEALVTKGSIYCWDNATRGLDAST 345

>KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {ON}
           Anc_3.534 YER036C
          Length = 608

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 93/208 (44%), Gaps = 49/208 (23%)

Query: 487 DRVPTIR-PTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSG 545
           DRV + R P + +   P    + F N+SFAY   P + ++++L+F +   S + +VGP+G
Sbjct: 373 DRVFSFRFPQVERLPPPV---LAFDNISFAYDGNPEHNLYENLDFGVDMDSRIALVGPNG 429

Query: 546 KGKSTIALLLLHYYNPTSGQI--------------LIDGQDITKLNSKSLRRQIAVVQQE 591
            GKST+  ++       +G++                D  D+TK   + +R + + + Q+
Sbjct: 430 VGKSTLLKIMTGQLMAQAGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSSISQD 489

Query: 592 PVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQ 651
                G +     YGLT E    ++ T                            LS GQ
Sbjct: 490 FQYWRGQLG---RYGLTGESQTVQMGT----------------------------LSEGQ 518

Query: 652 KQRIAIARALIKKPNILILDEATSALDV 679
           + R+  A   +++PN+L+LDE T+ LD+
Sbjct: 519 RSRVVFALLALEQPNVLLLDEPTNGLDI 546

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 225 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 279

>TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1595

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 106/227 (46%), Gaps = 22/227 (9%)

Query: 519  RPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHY--YNPTSGQILIDGQDITKL 576
            + + +I  +++  +KPG+   ++G SG GK+T+   L         +G + IDG    K 
Sbjct: 964  KETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVFIDG----KP 1019

Query: 577  NSKSLRRQIAVVQQEPV-LMSGTIRDNITY-GLTEEPTKEEIRTVAKQCFCHNF--IVKF 632
              +S  R I   QQ+ + L + T+R+++ +     +P   E+    K  +  +   I++ 
Sbjct: 1020 RDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPA--EVSIAEKNAYVEDIIKILEM 1077

Query: 633  PYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQ 691
                D  +G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  AI     Q
Sbjct: 1078 EKYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAI----CQ 1133

Query: 692  LMK---SKSMTIVSIAHRLSTIRRSE--NIIVLGNDGSVVEMGKFKE 733
            LM+   ++   I+   H+ S I   E   ++ +   G     G+  E
Sbjct: 1134 LMRKLCNQGQAILCTIHQPSAILMQEFDRLLFMQRGGQTCYFGELGE 1180

>TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON} 
          Length = 1551

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 105/225 (46%), Gaps = 22/225 (9%)

Query: 521  SNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHY--YNPTSGQILIDGQDITKLNS 578
            + +I  +++  +KPG+   ++G SG GK+T+   L         +G + IDG    K   
Sbjct: 908  TRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVFIDG----KPRD 963

Query: 579  KSLRRQIAVVQQEPV-LMSGTIRDNITY-GLTEEPTKEEIRTVAKQCFCHNF--IVKFPY 634
            +S  R I   QQ+ + L + T+R+++ +     +P   E+    K  +  +   I++   
Sbjct: 964  ESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPA--EVSIAEKNAYVEDIIKILEMEK 1021

Query: 635  TYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQLM 693
              D  +G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  AI     QLM
Sbjct: 1022 YADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAI----CQLM 1077

Query: 694  K---SKSMTIVSIAHRLSTIRRSE--NIIVLGNDGSVVEMGKFKE 733
            +   ++   I+   H+ S I   E   ++ +   G     G+  E
Sbjct: 1078 RKLCNQGQAILCTIHQPSAILMQEFDRLLFMQRGGQTCYFGELGE 1122

>NDAI0B02870 Chr2 complement(726822..730625) [3804 bp, 1267 aa] {ON}
           Anc_3.133 YOL075C
          Length = 1267

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 106/238 (44%), Gaps = 37/238 (15%)

Query: 509 FKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLL--------LHYYN 560
           FKN+          +I +S+N   KPG    I+GPSG GKST+  L+           +N
Sbjct: 668 FKNIRGGLSHEEVKEILQSVNAVFKPGMINAIMGPSGSGKSTLLNLISGRIKQSVFSKFN 727

Query: 561 PTSGQILIDGQDITKLNSKSLRRQIAVVQQEP--VLMSGTIRDNITYG-------LTEE- 610
            TSG+I+ +   I++   K +    + V Q+   +L   T+R+   +        LT E 
Sbjct: 728 -TSGKIMFNDVQISEDMFKGV---CSYVSQDDNHLLAKLTVRETFKFAADLRLHHLTSEQ 783

Query: 611 ---PTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNI 667
               T E IR +  +  C N I+   +            +SGG+K+R+++   L+  P I
Sbjct: 784 RAIKTDELIRALGLK-HCENNIIGNEFIKG---------ISGGEKRRVSMGIQLLNDPPI 833

Query: 668 LILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH--RLSTIRRSENIIVLGNDG 723
           L+LDE TS LD  +   I     +L    S T++   H  R    +   N+++L   G
Sbjct: 834 LLLDEPTSGLDSFTSATILEILKKLATEYSKTVIITIHQPRSELFKEFGNVLLLAKSG 891

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 99/218 (45%), Gaps = 20/218 (9%)

Query: 527 SLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQ-- 584
           S +  +  GS + ++G SG GK+T+  +L    +  SG +  +G     L  +    Q  
Sbjct: 39  SFSLDLPSGSVMAVMGGSGSGKTTLLNVLA---SKISGGLKTEGTINYVLEGEVTENQHV 95

Query: 585 -IAVVQQEPVLMSG-TIRDNITYG--LTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYI 640
            +A + Q+ VL +  T R+ + Y   L  + T+EE   +  Q       +      DT +
Sbjct: 96  KMAYLPQQDVLSARLTCRETLKYAADLKLDKTEEEKAIIVDQLIRE---LGLKDCADTEV 152

Query: 641 GPHGTL-LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMT 699
           G      LSGG+++R++    +I  P+I+ LDE T+ LD  S   +  T  +L      T
Sbjct: 153 GDSTHKGLSGGEQRRLSAGTQMISNPSIMFLDEPTTGLDAYSAYLVVKTLKKLAIEDGRT 212

Query: 700 IVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFAD 737
            +   H+     RS+ + +L N   V  + K K ++ D
Sbjct: 213 FIMSIHQ----PRSDILFLLDN---VCILSKGKVVYCD 243

>TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {ON}
           Anc_1.366 YFR009W
          Length = 751

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 100/234 (42%), Gaps = 48/234 (20%)

Query: 507 IEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 566
           I+ ++VSF Y  +  N + K +N  ++  S + +VG +G GK+T+  ++++   P  G +
Sbjct: 531 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMNQLKPLKGYV 588

Query: 567 LIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCH 626
             +G           R +I    Q  V      +  + +   + P K +           
Sbjct: 589 SSNG-----------RLRIGYFTQHHVDSMDLTKSAVDWMSVKYPGKTD----------- 626

Query: 627 NFIVKFPYTYDTYIGPHG----------TLLSGGQKQRIAIARALIKKPNILILDEAT-- 674
                    Y  ++G  G           LLSGGQK R+A A   +  P+IL+LDE +  
Sbjct: 627 -------EEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 679

Query: 675 ---SALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSV 725
              + LD   E   N++ G LM S  ++++    +   I  SEN  V   DG++
Sbjct: 680 LDNTGLDALVESLKNFSGGVLMVSHDISVIDSVCK--EIWVSENGTVRRFDGTI 731

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 647 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 705
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K+   T++ ++H
Sbjct: 367 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPSTLLVVSH 421

>TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5.500
            YDR406W
          Length = 1509

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/225 (25%), Positives = 106/225 (47%), Gaps = 18/225 (8%)

Query: 519  RPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHY--YNPTSGQILIDGQDITKL 576
            +   +I  +++  +KPG+   ++G SG GK+T+   L         +G+I ++G    +L
Sbjct: 876  KEDRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLADRTTMGVITGEIFVNG----RL 931

Query: 577  NSKSLRRQIAVVQQEPV-LMSGTIRDNITY-GLTEEPTKEEIRTVAKQCFCHNFIVKFPY 634
              +S  R I   QQ+ + L + T+R+++ +     +P K  I    K       I++  +
Sbjct: 932  RDESFPRTIGYCQQQDLHLKTSTVRESLRFSAYLRQPAKVSIEEKNKYVEEVIKILEMEH 991

Query: 635  TYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQLM 693
              D  +G  G  L+  Q++R+ I   L+ KP +L+ LDE TS LD ++  +I     QLM
Sbjct: 992  YADAVVGVAGEGLNVEQRKRLTIGVELVAKPALLVF