Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0I02660na 1ON59459427470.0
NCAS0D02260na 1ON59759722510.0
Suva_16.40na 1ON60657419840.0
YPL265W (DIP5)na 1ON60859719790.0
Skud_16.12na 1ON60760419770.0
CAGL0A01199gna 1ON61356819650.0
Smik_6.473na 1ON60659019620.0
KNAG0L02460singletonON58856319450.0
TPHA0M00130singletonON61156219010.0
Kpol_358.3na 1ON57556918850.0
SAKL0G14916gna 1ON58157518500.0
KAFR0B06430singletonON59359518410.0
TBLA0A07060na 1ON62553317970.0
KLTH0B01166gna 1ON57757517890.0
KLLA0E16281gna 1ON60559317700.0
Kwal_33.15545na 1ON57655917400.0
KNAG0L02470singletonON63856317240.0
Ecym_2480na 1ON58654016590.0
ACL135Wna 1ON58858616380.0
ZYRO0D17908gna 1ON5185248241e-102
YOR348C (PUT4)7.44ON6275958051e-98
SAKL0B10956g7.44ON5725557968e-98
Ecym_80357.44ON5635357922e-97
TBLA0A054601.84ON6085237943e-97
KLLA0C02343g1.83ON5815457915e-97
TDEL0A08030singletonON5145037813e-96
SAKL0C02640gsingletonON5485267809e-96
ZYRO0F16632g1.84ON6075157771e-94
Smik_15.5327.44ON6315197772e-94
ZYRO0F16654g1.83ON5805367733e-94
Kwal_26.69407.44ON5705147723e-94
TDEL0H040707.44ON5775537714e-94
SAKL0C02662g1.83ON5485467677e-94
NCAS0E022607.44ON5935717709e-94
KLTH0D01474g7.44ON6245157702e-93
Suva_8.4027.44ON6835737743e-93
Kpol_2000.641.84ON6105817673e-93
Ecym_10871.83ON5705577635e-93
SAKL0C02728g1.84ON5625147592e-92
CAGL0J08162g1.84ON5974977603e-92
KLTH0F02398g1.83ON5555587521e-91
NDAI0F041901.84ON5995107561e-91
SAKL0F09790gsingletonON5585537521e-91
SAKL0C02684gsingletonON5885407551e-91
CAGL0E05632g7.44ON5985427552e-91
Skud_15.5157.44ON6265197572e-91
YNL268W (LYP1)1.84ON6115677562e-91
Skud_14.711.84ON6125317562e-91
TPHA0B044701.84ON5995717552e-91
TDEL0C061701.84ON5734897532e-91
CAGL0J08184g1.83ON5725227496e-91
Suva_14.751.84ON6115067527e-91
Ecym_10881.84ON5675327489e-91
Skud_14.701.83ON5735387481e-90
KNAG0F004801.84ON5975367482e-90
KLTH0F02420g1.84ON6215357493e-90
TBLA0A054501.83ON6064907473e-90
KAFR0D039401.83ON5975547464e-90
Skud_5.261.83ON5905747454e-90
Smik_14.681.84ON6115877464e-90
Kwal_33.134111.84ON5605557425e-90
Kwal_23.4026singletonON5345257406e-90
YNL270C (ALP1)1.83ON5735557436e-90
Smik_5.241.83ON5905337446e-90
KNAG0E003907.44ON5995637439e-90
Smik_14.671.83ON5735387392e-89
NDAI0E038007.44ON6215457423e-89
NCAS0A006101.84ON6075057395e-89
Suva_5.41.83ON5905677376e-89
Kpol_367.77.44ON5845687351e-88
KAFR0D007001.83ON5745917289e-88
NDAI0A006101.83ON5655517261e-87
YEL063C (CAN1)1.83ON5905547245e-87
Kpol_2000.651.83ON5955167221e-86
NCAS0B085701.83ON5325427162e-86
TPHA0B044801.83ON6035017212e-86
AFR156W7.44ON5585487163e-86
TDEL0C061801.83ON5835067183e-86
Kwal_33.134011.83ON5595417163e-86
NCAS0A006001.83ON5445277144e-86
TPHA0H028507.44ON6015797151e-85
TDEL0E05750singletonON5485337102e-85
Smik_6.482na 2ON5585417085e-85
KNAG0C05920singletonON5995107106e-85
NDAI0F042001.83ON5665437078e-85
Suva_13.517singletonON5474987032e-84
KLLA0F23419g7.44ON5735607052e-84
KLLA0C02365g1.84ON5795287043e-84
Suva_14.731.83ON4974606941e-83
AFR667C1.84ON5635416939e-83
AFR668W1.83ON5564936921e-82
TBLA0C01240singletonON6295716943e-82
Kwal_8.590na 3ON6295466943e-82
KLTH0A00308gsingletonON5415426804e-81
KNAG0C007901.83ON5795156731e-79
SAKL0F16544gsingletonON5674986693e-79
KLTH0B00154gna 3ON5565116572e-77
Skud_16.2na 2ON4964986495e-77
ZYRO0C18502g7.44ON5755396493e-76
ZYRO0D03762g1.244ON6005796487e-76
KLTH0F04048gsingletonON5835506321e-73
CAGL0K05753g1.50ON6605706371e-73
KLLA0B14685gna 4ON5715226283e-73
Ecym_26643.285ON5755426214e-72
KAFR0C051607.44ON5845656206e-72
Kpol_1010.325.158ON5995346191e-71
Kwal_23.2817na 4ON5805446162e-71
TDEL0C00930singletonON5955436163e-71
SAKL0C01232gsingletonON6135426148e-71
Ecym_47895.158ON5885516121e-70
KAFR0E018505.158ON5605146055e-70
KNAG0C02140singletonON5985896077e-70
SAKL0D04664g1.244ON5935596069e-70
Ecym_60211.244ON6005306051e-69
Kpol_543.791.244ON6055465999e-69
Skud_11.2751.244ON6025855981e-68
NDAI0D021605.158ON5875945953e-68
YCL025C (AGP1)1.50ON6335975965e-68
Skud_3.381.50ON6335975956e-68
NDAI0G060301.368ON5995705921e-67
KLLA0A11770g5.158ON5815365911e-67
SAKL0D02926g3.285ON5835445901e-67
Smik_3.531.50ON6335805922e-67
Kwal_27.126811.244ON5935545902e-67
KLTH0B02046g5.158ON5895525892e-67
NDAI0B052201.244ON6115545893e-67
NDAI0F043901.50ON6675485923e-67
Suva_11.2731.244ON6015185884e-67
SAKL0G14014g5.158ON6055425884e-67
TPHA0A047005.158ON5695195854e-67
Smik_11.3021.244ON5535365845e-67
Suva_2.716singletonON6035285876e-67
KLTH0E15642g1.244ON5965895858e-67
TPHA0B010901.244ON6065265851e-66
CAGL0L03267g1.244ON5975445851e-66
TDEL0D00200singletonON5675285821e-66
Skud_7.5255.158ON6035475841e-66
KLLA0C01606g1.50ON6205495851e-66
AGR040C3.285ON5735275821e-66
Suva_3.1891.50ON6335955852e-66
NDAI0A006401.50ON6415395843e-66
NCAS0A071105.158ON5925635813e-66
CAGL0B03773g5.158ON6055575823e-66
SAKL0D02948gna 5ON5945865814e-66
Kpol_2000.921.50ON6375485834e-66
NCAS0B079001.244ON6195605816e-66
NCAS0A089201.368ON5995935797e-66
Suva_2.6881.50ON6615845827e-66
KAFR0D041401.50ON6375645818e-66
KAFR0C004003.284ON5825635771e-65
Kpol_526.103.397ON5805415761e-65
KAFR0D005001.50ON6175855782e-65
KLTH0F01606gna 6ON6045685753e-65
YKR039W (GAP1)1.244ON6025855753e-65
SAKL0D02970g3.284ON6015945743e-65
Kwal_33.132041.50ON6075945744e-65
YBR068C (BAP2)3.284ON6095505728e-65
Kpol_1065.133.284ON5965595711e-64
AFR698C1.50ON6095215711e-64
KAFR0D04120na 6ON6485465731e-64
KAFR0A011203.284ON5925585701e-64
KLLA0A06886gsingletonON5875445691e-64
YDR508C (GNP1)1.50ON6635225722e-64
TPHA0B047501.50ON6395595712e-64
TPHA0E036601.50ON6475225713e-64
KLLA0A10813g1.368ON5845905673e-64
SAKL0C01650g1.50ON6135465684e-64
TPHA0A002405.158ON6035605674e-64
KAFR0D00510na 7ON6176015675e-64
ZYRO0F13838g8.342ON8365585775e-64
NDAI0C029505.158ON6095885667e-64
KNAG0J022003.284ON6075595641e-63
TBLA0A051801.50ON6765915681e-63
Suva_7.4855.158ON6035875631e-63
Smik_4.7901.50ON6635545661e-63
NDAI0A074903.284ON5965565631e-63
NCAS0I015303.284ON5955495622e-63
Smik_16.1155.158ON6035185622e-63
KNAG0C005901.50ON6345475633e-63
KNAG0F002701.50ON6345325623e-63
Skud_2.1913.284ON6095685613e-63
KNAG0H011503.284ON6175445596e-63
Kwal_26.9612singletonON5435555556e-63
NCAS0D018705.158ON5955725586e-63
Kpol_1052.163.284ON6135885597e-63
CAGL0B01012g1.50ON6235855599e-63
KNAG0G009005.158ON6135405571e-62
TBLA0C012101.368ON6005265561e-62
YOL020W (TAT2)1.368ON5925515552e-62
Skud_4.7841.50ON6635225592e-62
NCAS0B085801.50ON6276115562e-62
KAFR0D04130na 7ON6445415573e-62
AGR319W5.158ON6265825553e-62
YGR191W (HIP1)5.158ON6035625543e-62
TBLA0A05190na 6ON6675925557e-62
SAKL0D00836gna 8ON6015915517e-62
KNAG0J022103.285ON5815015498e-62
Skud_15.1381.368ON5925945509e-62
KAFR0D00520na 6ON5985865509e-62
AAR038W3.397ON5665565471e-61
TDEL0F046608.342ON8405505601e-61
Kpol_534.221.368ON5926025491e-61
Kpol_1052.143.285ON6025105482e-61
TBLA0B077605.158ON6585185503e-61
NCAS0A106803.284ON5935715463e-61
Kwal_33.13215na 6ON5985325464e-61
Skud_2.1923.285ON6195405474e-61
Kwal_33.154075.158ON5875515454e-61
Kwal_33.14276na 8ON5965885455e-61
Suva_15.1481.368ON5925325455e-61
TPHA0M012003.284ON6075445455e-61
SAKL0H15092g8.342ON8505795558e-61
AGR039Cna 5ON5865535429e-61
AFR230C1.244ON6045195431e-60
TBLA0I020103.285ON6284845432e-60
Suva_2.2033.284ON6045865412e-60
Smik_2.2013.284ON6095835412e-60
Suva_4.3073.284ON6095465403e-60
Kpol_543.78singletonON6055245385e-60
KNAG0A050408.342ON8345525477e-60
Suva_4.3083.285ON6185555387e-60
CAGL0L07546g3.284ON6345425371e-59
KLTH0F01584g1.50ON5965915351e-59
AEL030W1.368ON5825335332e-59
Smik_15.1461.368ON5935715323e-59
CAGL0D02178g1.368ON5775515304e-59
Suva_4.3813.397ON5905395305e-59
CAGL0H08393g3.284ON6125555308e-59
AGR038C3.284ON5805485271e-58
KLLA0A06930g1.244ON5875155262e-58
TPHA0A025001.368ON5905655244e-58
TDEL0C065101.50ON6425605266e-58
YDR046C (BAP3)3.284ON6045645236e-58
Kpol_2002.441.50ON6275875231e-57
Skud_4.3003.284ON6045635221e-57
Smik_4.2843.284ON6045635211e-57
Smik_2.2023.285ON6175545212e-57
Smik_2.2723.397ON5975375202e-57
NCAS0A004201.50ON6795705242e-57
Ecym_8297na 9ON5695545173e-57
SAKL0C13992gsingletonON5525635146e-57
Sklu_YGOB_Anc_1.3681.368ON5414575127e-57
Kwal_34.16254singletonOFF4814585087e-57
Kwal_YGOB_34.162541.368ON4914585089e-57
TDEL0F02830na 10ON5615165112e-56
NCAS0J00140na 11ON5585905112e-56
YBR132C (AGP2)3.397ON5965235104e-56
ZYRO0F17446g1.50ON6335535124e-56
NDAI0A056203.284ON5715575094e-56
YLL061W (MMP1)na 12ON5835875086e-56
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0I02660
         (594 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...  1062   0.0  
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              871   0.0  
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   768   0.0  
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   766   0.0  
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   766   0.0  
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   761   0.0  
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   760   0.0  
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             753   0.0  
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     736   0.0  
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   730   0.0  
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   717   0.0  
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   713   0.0  
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   696   0.0  
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   693   0.0  
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   686   0.0  
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   674   0.0  
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             668   0.0  
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   643   0.0  
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   635   0.0  
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   322   e-102
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   314   1e-98
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   311   8e-98
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   309   2e-97
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   310   3e-97
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   309   5e-97
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            305   3e-96
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   305   9e-96
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   303   1e-94
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   303   2e-94
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   302   3e-94
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   301   3e-94
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   301   4e-94
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   300   7e-94
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     301   9e-94
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   301   2e-93
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   302   3e-93
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   300   3e-93
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   298   5e-93
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   296   2e-92
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   297   3e-92
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   294   1e-91
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   295   1e-91
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   294   1e-91
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   295   1e-91
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   295   2e-91
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   296   2e-91
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   295   2e-91
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   295   2e-91
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   295   2e-91
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   294   2e-91
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   293   6e-91
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   294   7e-91
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   292   9e-91
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   292   1e-90
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                292   2e-90
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   293   3e-90
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   292   3e-90
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   291   4e-90
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   291   4e-90
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   291   4e-90
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   290   5e-90
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   289   6e-90
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   290   6e-90
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   291   6e-90
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   290   9e-90
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   289   2e-89
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     290   3e-89
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              289   5e-89
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   288   6e-89
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   287   1e-88
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   285   9e-88
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   284   1e-87
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   283   5e-87
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   282   1e-86
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            280   2e-86
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   282   2e-86
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   280   3e-86
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   281   3e-86
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   280   3e-86
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   279   4e-86
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   280   1e-85
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            278   2e-85
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   277   5e-85
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            278   6e-85
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            276   8e-85
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   275   2e-84
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   276   2e-84
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   275   3e-84
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   271   1e-83
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   271   9e-83
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   271   1e-82
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   271   3e-82
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   271   3e-82
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   266   4e-81
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              263   1e-79
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   262   3e-79
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   257   2e-77
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   254   5e-77
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   254   3e-76
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   254   7e-76
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   248   1e-73
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   249   1e-73
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   246   3e-73
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   243   4e-72
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   243   6e-72
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   243   1e-71
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   241   2e-71
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   241   3e-71
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   241   8e-71
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   240   1e-70
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   237   5e-70
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   238   7e-70
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   238   9e-70
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   237   1e-69
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   235   9e-69
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   234   1e-68
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    233   3e-68
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   234   5e-68
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   233   6e-68
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   232   1e-67
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   232   1e-67
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   231   1e-67
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   232   2e-67
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   231   2e-67
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   231   2e-67
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   231   3e-67
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   232   3e-67
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   231   4e-67
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   231   4e-67
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   229   4e-67
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   229   5e-67
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   230   6e-67
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   229   8e-67
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   229   1e-66
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   229   1e-66
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                228   1e-66
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   229   1e-66
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   229   1e-66
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   228   1e-66
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   229   2e-66
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   229   3e-66
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   228   3e-66
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   228   3e-66
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   228   4e-66
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   229   4e-66
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   228   6e-66
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   227   7e-66
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   228   7e-66
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              228   8e-66
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                226   1e-65
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   226   1e-65
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      227   2e-65
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   226   3e-65
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   226   3e-65
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   225   3e-65
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   225   4e-65
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   224   8e-65
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   224   1e-64
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   224   1e-64
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   225   1e-64
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   224   1e-64
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   223   1e-64
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   224   2e-64
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   224   2e-64
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   224   3e-64
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   223   3e-64
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   223   4e-64
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   223   4e-64
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      223   5e-64
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   226   5e-64
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    222   7e-64
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   221   1e-63
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   223   1e-63
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   221   1e-63
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   222   1e-63
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   221   1e-63
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              221   2e-63
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   221   2e-63
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   221   3e-63
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   221   3e-63
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   220   3e-63
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              219   6e-63
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   218   6e-63
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   219   6e-63
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   219   7e-63
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   219   9e-63
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   219   1e-62
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   218   1e-62
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   218   2e-62
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   219   2e-62
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   218   2e-62
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              219   3e-62
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   218   3e-62
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   218   3e-62
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   218   7e-62
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   216   7e-62
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   216   8e-62
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   216   9e-62
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   216   9e-62
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   215   1e-61
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   220   1e-61
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   216   1e-61
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   215   2e-61
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   216   3e-61
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   214   3e-61
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   214   4e-61
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   215   4e-61
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   214   4e-61
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   214   5e-61
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   214   5e-61
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   214   5e-61
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   218   8e-61
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   213   9e-61
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   213   1e-60
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   213   2e-60
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   213   2e-60
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   213   2e-60
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   212   3e-60
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   211   5e-60
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   215   7e-60
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   211   7e-60
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   211   1e-59
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   210   1e-59
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   209   2e-59
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   209   3e-59
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   208   4e-59
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   208   5e-59
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   208   8e-59
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   207   1e-58
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   207   2e-58
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   206   4e-58
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   207   6e-58
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   206   6e-58
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   206   1e-57
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   205   1e-57
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   205   1e-57
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   205   2e-57
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   204   2e-57
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   206   2e-57
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   203   3e-57
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   202   6e-57
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   201   7e-57
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   200   7e-57
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   200   9e-57
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   201   2e-56
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      201   2e-56
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   201   4e-56
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   201   4e-56
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            200   4e-56
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   200   6e-56
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   204   7e-56
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   201   8e-56
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   200   8e-56
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   199   1e-55
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   199   1e-55
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   199   1e-55
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   199   2e-55
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   198   2e-55
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   202   2e-55
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   199   3e-55
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   197   3e-55
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   197   4e-55
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   197   4e-55
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              198   6e-55
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   196   7e-55
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   197   8e-55
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      196   8e-55
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   196   9e-55
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   201   1e-54
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   201   1e-54
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   196   2e-54
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   200   2e-54
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   196   2e-54
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   195   2e-54
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   195   3e-54
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   195   3e-54
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   195   3e-54
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   194   3e-54
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   199   4e-54
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              194   4e-54
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   194   4e-54
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   194   7e-54
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   194   9e-54
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   192   3e-53
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    191   4e-53
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   192   4e-53
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   192   4e-53
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   192   4e-53
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   192   5e-53
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   192   6e-53
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   191   9e-53
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   191   1e-52
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    191   1e-52
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   189   1e-52
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   190   2e-52
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   189   4e-52
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   192   1e-51
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   191   1e-51
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   191   2e-51
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   187   3e-51
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              188   4e-51
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   186   5e-51
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                186   6e-51
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              186   8e-51
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   185   2e-50
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   185   3e-50
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   183   3e-50
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   183   5e-50
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              182   7e-50
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   182   1e-49
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   182   2e-49
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   184   3e-49
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   181   6e-49
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   181   7e-49
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   183   2e-48
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   181   9e-48
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   177   1e-47
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   176   2e-47
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                176   4e-47
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   177   1e-46
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   173   3e-46
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   172   1e-45
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              171   2e-45
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   170   5e-45
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   169   1e-44
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   169   1e-44
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   171   2e-44
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      168   2e-44
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   161   5e-42
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   162   1e-41
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   155   5e-40
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     144   9e-38
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     144   1e-37
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   147   2e-37
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   147   2e-37
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   148   4e-37
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   145   1e-36
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   105   6e-25
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         104   8e-24
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      77   3e-16
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          79   7e-16
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      73   1e-13
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     72   6e-13
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    60   8e-10
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          55   4e-08
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    53   3e-07
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              44   3e-04
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      38   0.015
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    39   0.029
SAKL0C11088g Chr3 (1000546..1001085) [540 bp, 179 aa] {ON} no si...    35   0.20 
Smik_6.7 Chr6 (9124..9204,9208..9294,9405..9470,9474..9617,9624....    36   0.21 
ACL181C Chr3 complement(40324..46104) [5781 bp, 1926 aa] {ON} Sy...    33   1.8  
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    33   1.9  
TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {O...    33   2.7  
KLTH0H01936g Chr8 (173705..175792) [2088 bp, 695 aa] {ON} simila...    31   8.2  
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    31   8.7  
KLLA0C15521g Chr3 complement(1347098..1348741) [1644 bp, 547 aa]...    31   8.7  
KAFR0B04270 Chr2 (885178..888192) [3015 bp, 1004 aa] {ON} Anc_5....    31   9.6  

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score = 1062 bits (2747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/594 (89%), Positives = 529/594 (89%)

Query: 1   MTIRQIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNID 60
           MTIRQIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNID
Sbjct: 1   MTIRQIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNID 60

Query: 61  GKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFT 120
           GKTEGTRLKKALKARHVSM                       PVSTLIAYAFVGLLVFFT
Sbjct: 61  GKTEGTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLLVFFT 120

Query: 121 MACLGEMATYIPLDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVD 180
           MACLGEMATYIPLDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVD
Sbjct: 121 MACLGEMATYIPLDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVD 180

Query: 181 KEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPD 240
           KEKVNPGVWVTIFLVVIVSIN            WLSSFKV                  PD
Sbjct: 181 KEKVNPGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFILMLGGGPD 240

Query: 241 HDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPR 300
           HDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPR
Sbjct: 241 HDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPR 300

Query: 301 KSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGI 360
           KSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLI            PFVVAIINSGI
Sbjct: 301 KSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVAIINSGI 360

Query: 361 NALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSV 420
           NALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSV
Sbjct: 361 NALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSV 420

Query: 421 LFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYV 480
           LFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYV
Sbjct: 421 LFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYV 480

Query: 481 APFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKT 540
           APFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKT
Sbjct: 481 APFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKT 540

Query: 541 KVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKFLGNIF 594
           KVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKFLGNIF
Sbjct: 541 KVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKFLGNIF 594

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  871 bits (2251), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/597 (71%), Positives = 475/597 (79%), Gaps = 3/597 (0%)

Query: 1   MTIRQI-PSNSTSDQYEEYFEQLPKKEFK-LPIQEEELINDDLERNIS-SASSQDENDSY 57
           MTIR++    +TSD+YEEYF+   K + K  P QE EL++DDLE NIS S S++D+NDSY
Sbjct: 1   MTIREVLTEETTSDRYEEYFDPQKKVDSKTFPTQERELLHDDLENNISLSTSAEDQNDSY 60

Query: 58  NIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLV 117
           N+DGKTEGTRLKK L+ R VSM                       PVS LIAYAFVGLLV
Sbjct: 61  NVDGKTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLV 120

Query: 118 FFTMACLGEMATYIPLDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQY 177
           FFTMA LGEMA+YIPLDGFTSYA+RY DPALGFAVGY YLFKYFILPPNQLTAAALVIQY
Sbjct: 121 FFTMASLGEMASYIPLDGFTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAALVIQY 180

Query: 178 WVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXX 237
           W+ +EKVNPGVW+TIFLVVIV+IN            WLSSFKV                 
Sbjct: 181 WIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFALIILLFILMLGG 240

Query: 238 XPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQ 297
            P+HDRLGFR+W+HPG+F  YS  ITGDTG+FVAFVSVFVYAT+AYLG EL GIV  EA+
Sbjct: 241 GPNHDRLGFRHWKHPGAFNNYSPAITGDTGKFVAFVSVFVYATFAYLGTELVGIVVGEAR 300

Query: 298 NPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIIN 357
           NPRKS+PKAIKLTMYRI+IFYLISI LLGMCV YDDPLL+            PFVVAI+N
Sbjct: 301 NPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVAIVN 360

Query: 358 SGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALS 417
           SGI  LPHI NACVLVFVFSACNSDLYV+SRSLYSLAIDNKAPKIFA+TNRWGIPYY+L 
Sbjct: 361 SGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYYSLG 420

Query: 418 VSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTF 477
           +SVLFCLLAYM VSS SAKIFNYFVNVVSIFG+LSWI IL+TY+ FDRAVRAQG+DKSTF
Sbjct: 421 LSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDKSTF 480

Query: 478 AYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFT 537
           +YVAP Q YGA+F+LFFC LIALIKNFTVFL HQFDYK FITGYIG+PVFF  YFGYK  
Sbjct: 481 SYVAPGQRYGAYFALFFCSLIALIKNFTVFLGHQFDYKTFITGYIGIPVFFISYFGYKLI 540

Query: 538 YKTKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKFLGNIF 594
           YKTK+IDPL+VDLYTFKAAIDQEEEDGK+ D  + ERIK NG+NFEWFYDKFL NIF
Sbjct: 541 YKTKIIDPLEVDLYTFKAAIDQEEEDGKLEDIARKERIKANGRNFEWFYDKFLSNIF 597

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/574 (66%), Positives = 434/574 (75%), Gaps = 7/574 (1%)

Query: 28  KLPIQEEELINDDLERN------ISSASSQDENDSYNI-DGKTEGTRLKKALKARHVSMX 80
           K P++E+E+ N DLE N       +S S    +DS+ + DGK E TRL+K LKARH+SM 
Sbjct: 33  KFPVKEQEIYNIDLEENNVSSRSSTSTSPSARDDSFAVPDGKDETTRLRKDLKARHISMI 92

Query: 81  XXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSYA 140
                                 PVS LIAY FVGLLVFFTMACLGEMA+YIPLDGFTSYA
Sbjct: 93  AIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFFTMACLGEMASYIPLDGFTSYA 152

Query: 141 SRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSI 200
           SRY DPALGFA+GY YLFKYFILPPNQLTAAALVIQYWV +++VNPGVW+TIFLVVIV+I
Sbjct: 153 SRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVNPGVWITIFLVVIVAI 212

Query: 201 NXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSE 260
           N            WLSSFKV                  PDHDRLGFRYWR PG+FKEYS 
Sbjct: 213 NIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPDHDRLGFRYWRDPGAFKEYST 272

Query: 261 TITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLI 320
            ITG  G+FVAF SVFVY+ ++Y GIELTGIV +EA+NPRKS+PKAIKLT+YRI++FYL 
Sbjct: 273 AITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAKNPRKSVPKAIKLTVYRIIVFYLC 332

Query: 321 SIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACN 380
           ++FLLGMCVAY+DP L+            PFVVAI NSGI  LPHI N CVLVFVFSACN
Sbjct: 333 TVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNSGIKVLPHIFNGCVLVFVFSACN 392

Query: 381 SDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNY 440
           SDLYVSSR+LY+LAID KAPKIFAKT++WG+PYYAL VSVLFC LAYM VS+ SAKIFNY
Sbjct: 393 SDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALMVSVLFCCLAYMNVSAGSAKIFNY 452

Query: 441 FVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIAL 500
           FVNVVS+FGILSWI+ILI YI FDRA RAQGVDKS FAYVAP Q YGA+F+LFFC LIAL
Sbjct: 453 FVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKFAYVAPGQRYGAYFALFFCILIAL 512

Query: 501 IKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQE 560
           IKNFTVFL H FDYK FITGYIGLP++ F + GYK  YKTKV+ P   DLYT K   D+E
Sbjct: 513 IKNFTVFLGHTFDYKTFITGYIGLPIYVFSWVGYKLIYKTKVVKPADADLYTLKEIYDRE 572

Query: 561 EEDGKMADAEKAERIKQNGKNFEWFYDKFLGNIF 594
           EE GK+ D EK ER+++NGKN EWFY+KFLGNIF
Sbjct: 573 EEQGKLQDQEKEERLQRNGKNLEWFYEKFLGNIF 606

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  766 bits (1979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/597 (64%), Positives = 447/597 (74%), Gaps = 11/597 (1%)

Query: 7   PSNSTS--DQYEEYFEQLPKKEFKLPIQEEELINDDLERN------ISSASSQDENDSYN 58
           P NS+S    ++ Y+ +     F  P++E+E+ N DLE N       +S S    +DS+ 
Sbjct: 14  PRNSSSLDSDHDAYYSKQNPDNF--PVKEQEIYNIDLEENNVSSRSSTSTSPSARDDSFA 71

Query: 59  I-DGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLV 117
           + DGK E TRL+K LKARH+SM                       PV+ LIAYAFVGLLV
Sbjct: 72  VPDGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLV 131

Query: 118 FFTMACLGEMATYIPLDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQY 177
           F+TMACLGEMA+YIPLDGFTSYASRY DPALGFA+GY YLFKYFILPPNQLTAAALVIQY
Sbjct: 132 FYTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 191

Query: 178 WVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXX 237
           W+ +++VNPGVW+TIFLVVIV+IN            WLSSFKV                 
Sbjct: 192 WISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGG 251

Query: 238 XPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQ 297
            P+HDRLGFRYWR PG+FKEYS  ITG  G+FV+FV+VFVY+ ++Y GIELTGIV +EA+
Sbjct: 252 GPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAE 311

Query: 298 NPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIIN 357
           NPRKS+PKAIKLT+YRI++FYL ++FLLGMCVAY+DP L+            PFVVAI N
Sbjct: 312 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 371

Query: 358 SGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALS 417
           SGI  LPHI NACVLVFVFSACNSDLYVSSR+LY+LAID KAPKIFAKT+RWG+PY AL 
Sbjct: 372 SGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALI 431

Query: 418 VSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTF 477
           +SVLFC LAYM VSS SAKIFNYFVNVVS+FGILSWI+ILI YI FD+A RAQG+DKS F
Sbjct: 432 LSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 491

Query: 478 AYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFT 537
           AYVAP Q YGA+F+LFFC LIALIKNFTVFL H+FDYK FITGYIGLPV+   + GYK  
Sbjct: 492 AYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLI 551

Query: 538 YKTKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKFLGNIF 594
           YKTKVI    VDLYTFK   D+EEE+G+M D EK ER+K NGKN EWFY+KFLGNIF
Sbjct: 552 YKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFLGNIF 608

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/604 (64%), Positives = 448/604 (74%), Gaps = 13/604 (2%)

Query: 1   MTIRQIPSNSTS---DQYEEYFEQLPKKEFKLPIQEEELINDDLERN-ISSASS-----Q 51
           +T    P NS+S   D+   Y +Q P      P++E+E+ N DLE N +SS SS      
Sbjct: 7   LTSAASPRNSSSLDSDRDAYYSKQNPDS---FPVKEQEIYNIDLEENNVSSRSSTFTSPS 63

Query: 52  DENDSYNI-DGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAY 110
             +DS+ + DGK E TRL+K LKARH+SM                       PV+ LIAY
Sbjct: 64  ARDDSFAVPDGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAMLIAY 123

Query: 111 AFVGLLVFFTMACLGEMATYIPLDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTA 170
           AFVGLLVFFTMACLGEMA+YIPLDGFTSYASRY DPALGFA+GY YLFKYFILPPNQLTA
Sbjct: 124 AFVGLLVFFTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTA 183

Query: 171 AALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXX 230
           AALVIQYWV +++VNPGVW+TIF+VVIV+IN            WLSSFKV          
Sbjct: 184 AALVIQYWVSRDRVNPGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLILLL 243

Query: 231 XXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTG 290
                   PDHDRLGFRYWR PG+FKEYS  I G  G+FV+F++VFVY+ ++Y GIELTG
Sbjct: 244 FIIMLGGGPDHDRLGFRYWRDPGAFKEYSAAIGGGKGKFVSFLAVFVYSLFSYTGIELTG 303

Query: 291 IVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXP 350
           IV +EAQNPRKS+PKAIKLT+YRI++FYL ++FLLGMCVAY+DP LI            P
Sbjct: 304 IVCSEAQNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAAASP 363

Query: 351 FVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWG 410
           FVVAI NSGI  LPHI NACVLVFVFSACNSDLYVSSR+LY+LAID KAPKIF+KTN+WG
Sbjct: 364 FVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWG 423

Query: 411 IPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQ 470
           +PY AL  SVLFC LAYM VS+ SAKIFNYFVNVVS+FGILSWI+ILI YI FD+A RAQ
Sbjct: 424 VPYNALIFSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQ 483

Query: 471 GVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFC 530
           G+DKS FAYVAP Q YGA+F+L FC  IALIKNFTVFL H+FDYK FITGYIGLPV+ F 
Sbjct: 484 GIDKSKFAYVAPGQRYGAYFALVFCIFIALIKNFTVFLGHKFDYKTFITGYIGLPVYVFS 543

Query: 531 YFGYKFTYKTKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKFL 590
           + GYK  YKTKVI    VDLYTFK   D+EEE GK+ D EK ER+K+NGKN EWFY+KFL
Sbjct: 544 WVGYKLIYKTKVIKSTDVDLYTFKEIYDREEEQGKIEDQEKEERLKKNGKNMEWFYEKFL 603

Query: 591 GNIF 594
           G+IF
Sbjct: 604 GHIF 607

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/568 (66%), Positives = 440/568 (77%), Gaps = 6/568 (1%)

Query: 32  QEEELINDDLERNISSASSQDEN----DSYNIDGKTEGTRLKKALKARHVSMXXXXXXXX 87
           +++ L  +D++ N+S+ SS+ E+    D Y  DGK E TRL+K LKARH+SM        
Sbjct: 47  KKDGLDINDMD-NLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGSIG 105

Query: 88  XXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSYASRYCDPA 147
                          P+S  IAYAFVG+LVFFTMA LGEMA+YIPLDGFTSYASRYCDPA
Sbjct: 106 TGLLIGTGNSLYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYASRYCDPA 165

Query: 148 LGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXX 207
           LGFAVGYAYL KY ILPPNQLTAAALVIQYW+D+E+VNPGVW+TIFLV+IV++N      
Sbjct: 166 LGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKF 225

Query: 208 XXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTG 267
                 WLS+FKV                  P HDRLGFR++ HPG+FK YS++I G  G
Sbjct: 226 FGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKG 285

Query: 268 RFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGM 327
           +FVAFV+V VYA +AYLGIELTGIVAAEA NPRKSIPKAIKLTMYRI++FYL++IFLLGM
Sbjct: 286 KFVAFVAVLVYALFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGM 345

Query: 328 CVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSS 387
           CVAYDDPLL             P+VVAIINSGI ALPHI NACVL+FVFSACNSDLYV+S
Sbjct: 346 CVAYDDPLLKKAKTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVAS 405

Query: 388 RSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSI 447
           R+LY LAIDNKAPKIFA TNRWG+PYY+L +S  FCLLAYM VSS SAKIFNYFVNVVSI
Sbjct: 406 RTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSI 465

Query: 448 FGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVF 507
           FG+LSWISILITY+CF RAV+AQ VD+S FAY APFQPYG++F+L FC LIA IKNFTVF
Sbjct: 466 FGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVF 525

Query: 508 LNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQEEEDGKMA 567
           LNH FDYKNFITGYIG+PVF   YFGYKF  KTK+  P +VDLYTFKAAID+EEE GK+A
Sbjct: 526 LNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGKIA 585

Query: 568 DAEKAERIKQNG-KNFEWFYDKFLGNIF 594
           DAE+ ER+K +  K ++WFY+K LGNIF
Sbjct: 586 DAERRERLKNSKTKGWDWFYEKVLGNIF 613

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/590 (64%), Positives = 442/590 (74%), Gaps = 9/590 (1%)

Query: 12  SDQYEEYFEQLPKKEFKLPIQEEELINDDLERN------ISSASSQDENDSYNI-DGKTE 64
            + ++ Y+ +     F  P++E+E+ N DLE N       +S S    +DS+ I DGK E
Sbjct: 19  ENDHDAYYSKQDADNF--PVKEQEIYNIDLEENNVSSRSSTSTSPSARDDSFAIADGKDE 76

Query: 65  GTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACL 124
            TRLKK LKARH+SM                       PV+ LIAYAFVGLLVFFTMACL
Sbjct: 77  NTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFFTMACL 136

Query: 125 GEMATYIPLDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKV 184
           GEMA+YIPLDGFTSYASRY DPALGFA+GY YLFKYFILPPNQLTAAALVIQYW+ +++V
Sbjct: 137 GEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRV 196

Query: 185 NPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRL 244
           NPGVW+TIFLVVIV+IN            WLSSFKV                  PDHDRL
Sbjct: 197 NPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPDHDRL 256

Query: 245 GFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIP 304
           GFRYWR PG+FKEYS  ITG TG+F +FV+VFVY+ ++Y GIELTGIV +EA+NPRKS+P
Sbjct: 257 GFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVP 316

Query: 305 KAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALP 364
           KAIKLT+YRI++FYL ++FLLGMCVAY+DP L+            PFVVAI NSGI  LP
Sbjct: 317 KAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVLP 376

Query: 365 HIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCL 424
           HI NACVLVFVFSACNSDLYVSSR+LY+LAID KAPKIFAKT++WG+PY AL +SVLFC 
Sbjct: 377 HIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCC 436

Query: 425 LAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQ 484
           LAYM VSS SAKIFNYFVNVVS+FGILSWI+ILI YI FD+A RAQG+DKS FAYVAP Q
Sbjct: 437 LAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQ 496

Query: 485 PYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVID 544
            YGA+F+L FC LIALIKNFTVFL H+FDYK FITGYIGLPV+   + GYK  YKTKVI 
Sbjct: 497 RYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKVIK 556

Query: 545 PLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKFLGNIF 594
              VDLYTFK   D+EEE+G++ D E+ ER+++NGKN EWFY+KFLG IF
Sbjct: 557 STDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRIF 606

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/563 (68%), Positives = 444/563 (78%), Gaps = 1/563 (0%)

Query: 32  QEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXX 91
            ++E    D+E+  + + + D+ +    DGK    RLKK LKARHVSM            
Sbjct: 27  NKKEPFQIDIEKESTESVALDDTNE-QFDGKCSDQRLKKDLKARHVSMIAIGGSLGTGLL 85

Query: 92  XXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSYASRYCDPALGFA 151
                      PVS LI+Y+FVG+LVFF M+C+GEMA YIPLDGFTSYASRYCDPALGFA
Sbjct: 86  IGTGNSLAVAGPVSMLISYSFVGVLVFFVMSCIGEMAAYIPLDGFTSYASRYCDPALGFA 145

Query: 152 VGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXX 211
           VGYAYL KYFILPPNQLTAAALVIQYW+ +EKVNPGVW+TI LVVIV IN          
Sbjct: 146 VGYAYLVKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIVLVVIVVINTFGVKFFGEF 205

Query: 212 XXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVA 271
             WLSSFKV                  P HDRLGFRYW+HPG+FKEYS++I GD GRFV+
Sbjct: 206 EFWLSSFKVIVMLGLIILMFIIMLGGTPTHDRLGFRYWKHPGAFKEYSKSIHGDIGRFVS 265

Query: 272 FVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAY 331
           FVS FVY  + YLGIELTGIVAAEA+NPRK+IPKAIKLTM+RI+IFY+I+IFLLGMCV+ 
Sbjct: 266 FVSCFVYGLFCYLGIELTGIVAAEAENPRKNIPKAIKLTMWRIIIFYIITIFLLGMCVSS 325

Query: 332 DDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLY 391
           +DPLL+            PFVVAI+NSGI ALPHI NACVL+FVFSACNSDLYV+SR+LY
Sbjct: 326 NDPLLLEAKTKSTSAAASPFVVAIVNSGIEALPHIFNACVLMFVFSACNSDLYVASRNLY 385

Query: 392 SLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGIL 451
           SLAIDNKAPKIFAKTNR+GIPY +L V+VLFCLLAYM VSS SAKIFNYFVNVVSI G+L
Sbjct: 386 SLAIDNKAPKIFAKTNRFGIPYNSLGVAVLFCLLAYMSVSSGSAKIFNYFVNVVSITGVL 445

Query: 452 SWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQ 511
           +WISILITYICFDRAVRAQG+DKSTFAYVAP QPYGA+FSLFFCCL+ALIKNFTVFLNH+
Sbjct: 446 TWISILITYICFDRAVRAQGIDKSTFAYVAPLQPYGAYFSLFFCCLLALIKNFTVFLNHK 505

Query: 512 FDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQEEEDGKMADAEK 571
           FDY+NFITGYIGLP+FF CYFGYKF  KTK+  P +VDL++FKAAIDQEEEDG++ DA  
Sbjct: 506 FDYRNFITGYIGLPLFFICYFGYKFVKKTKIRKPEEVDLFSFKAAIDQEEEDGRIKDAAT 565

Query: 572 AERIKQNGKNFEWFYDKFLGNIF 594
           AERIK+NGKN+EWFY+ +LG IF
Sbjct: 566 AERIKKNGKNWEWFYETYLGKIF 588

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/562 (64%), Positives = 430/562 (76%), Gaps = 4/562 (0%)

Query: 37  INDDLERNISSASSQDENDSYNI-DGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXX 95
           +ND   +N     +  ++D YN+ DGK +GTRLKK LKARH+SM                
Sbjct: 50  VNDQTRQNTLDDDASADSDGYNVMDGKDDGTRLKKDLKARHISMIAIGGSLGTGLLIGTG 109

Query: 96  XXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSYASRYCDPALGFAVGYA 155
                  P S LIAY FVG LVFFTMA LGEMA YIPLDGFTSYASRYCDPALGFAVGY+
Sbjct: 110 TALRTAGPASILIAYTFVGTLVFFTMAALGEMAAYIPLDGFTSYASRYCDPALGFAVGYS 169

Query: 156 YLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWL 215
           YLFKYFI+ PNQLTAAALVIQYWVD++ VNPGVW+TIFLVVI++IN            WL
Sbjct: 170 YLFKYFIITPNQLTAAALVIQYWVDRDTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWL 229

Query: 216 SSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSET---ITGDTGRFVAF 272
           SSFK+                  P+HDRLGFRYW+ PG+FK YS +   I G TG+FVAF
Sbjct: 230 SSFKIMVMIGVMIFLFVIMLGGGPNHDRLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAF 289

Query: 273 VSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYD 332
           V+VFVYA +AYLGIELTGIVAAEA+NPR++IP+AIKLT++RI+ FY+ +IFLLGMCVAYD
Sbjct: 290 VNVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYD 349

Query: 333 DPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYS 392
           DPLL+            PFVVAI NSG++ LPHI N CVL+FVFSACNSDLYV +RSLYS
Sbjct: 350 DPLLLAAANAQTSAAASPFVVAIQNSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYS 409

Query: 393 LAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILS 452
           LA+D KAPKIFAKTNRWG+PY A+   VLFCLLAYM VSS SA+IFNYFVNVVSIFG+LS
Sbjct: 410 LAVDGKAPKIFAKTNRWGVPYNAMGGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLS 469

Query: 453 WISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQF 512
           W SILIT+I FDRAVRAQG+D+STFAYVAPFQPYG++F+LFFC L+ALIKNF+VFL ++F
Sbjct: 470 WSSILITFIYFDRAVRAQGIDRSTFAYVAPFQPYGSYFALFFCVLLALIKNFSVFLGNEF 529

Query: 513 DYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKA 572
           DYK FITGYIGLPV+ F + GYK  YKTK + P + DL ++KAA+D+EEE+GK+ +AE+ 
Sbjct: 530 DYKTFITGYIGLPVYAFSFIGYKLYYKTKTVKPHEADLNSYKAAVDREEEEGKIKEAERK 589

Query: 573 ERIKQNGKNFEWFYDKFLGNIF 594
           ER+K   K+ EWFY+K++ +IF
Sbjct: 590 ERLKHGKKDLEWFYEKYISSIF 611

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/569 (63%), Positives = 433/569 (76%), Gaps = 7/569 (1%)

Query: 32  QEEELINDD---LERNISSA--SSQDENDSYNI-DGKTEGTRLKKALKARHVSMXXXXXX 85
           ++ +LI +D   LE+N +S+  S + E+DS  I DGK +G RLKK LKARH+SM      
Sbjct: 8   KDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIGGS 67

Query: 86  XXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSYASRYCD 145
                            P S LIAY+FVG+LVFF MACLGEMATYIPLDGFTSYA+RYCD
Sbjct: 68  LGTGLLIGTGTALRTGGPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSYATRYCD 127

Query: 146 PALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXX 205
           PALGFAVGY YLFKYFI+ PNQLTA ALVIQYW+D+E VNPGVW+TIFLVVIV IN    
Sbjct: 128 PALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGV 187

Query: 206 XXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGD 265
                   WLSSFK+                  P+HDRLGFRYW++PG+FK YSE+ITG 
Sbjct: 188 RYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGS 247

Query: 266 TGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLL 325
            G+FV+FV+VFVYA +AYLGIELTGIVAAEA+NPR++IP+AIKLTMYRI++FY+++IFLL
Sbjct: 248 KGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLL 307

Query: 326 GMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYV 385
           GMCVAY+DP L+            PFVVAI NSG+ ALPHI N CVL+FVFSACNSDLYV
Sbjct: 308 GMCVAYNDPRLLAAAHASTSAAASPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYV 367

Query: 386 SSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVV 445
            +RSLYSLAID KAPK+FAKTNRWG+PY AL    LFCLLAYM VSS SA+IFNYFVNVV
Sbjct: 368 GTRSLYSLAIDGKAPKLFAKTNRWGVPYNALFGCFLFCLLAYMNVSSGSAQIFNYFVNVV 427

Query: 446 SIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFT 505
           SIFGILSWISILITYI F RA  AQ VD+++FAY APFQPYGA+ +LFFC LIA IKNFT
Sbjct: 428 SIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFT 487

Query: 506 VFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQEEEDGK 565
           VF+  +FDYK+FITGYIGLP++   YFGYK  YKTK++   + DLY+FK AID+EE +GK
Sbjct: 488 VFIG-EFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAIDREEAEGK 546

Query: 566 MADAEKAERIKQNGKNFEWFYDKFLGNIF 594
           + +AE  ER+K + K+ +WFY+K+LG IF
Sbjct: 547 IKEAEAKERLKNSKKSLKWFYEKYLGYIF 575

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/575 (62%), Positives = 429/575 (74%), Gaps = 6/575 (1%)

Query: 24  KKEFKLPIQEEELINDDLER----NISSASSQDENDSYNIDGKTEGTRLKKALKARHVSM 79
           +K+ +  +      + D+E     N    SSQ+ +   NIDGK +G RLKK L+ARHVSM
Sbjct: 9   RKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESH--LNIDGKHDGIRLKKELEARHVSM 66

Query: 80  XXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSY 139
                                  PVS LIAY+FVG LV+  M CLGEMATYIPLDGFTSY
Sbjct: 67  IAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFTSY 126

Query: 140 ASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVS 199
           ASRYCDPALGFAVGY+YLFKY I+ PNQLTAAALV+QYWV +EKVNPGVW+TIFLV+IV+
Sbjct: 127 ASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVT 186

Query: 200 INXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYS 259
           IN            WLSSFKV                  P HDRLGFR+++ PG+F+ YS
Sbjct: 187 INVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYS 246

Query: 260 ETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYL 319
           E I+G  G+FV+FV+VFVYA +AYLG EL GIVAAE +NPR+++P+AIKLT+YRIV+FYL
Sbjct: 247 EAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYL 306

Query: 320 ISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSAC 379
           ++IFLLGM VAY+DPLL+            PFVVAI N+GI  LPHI NACVL+FVFSAC
Sbjct: 307 VTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNAGIPVLPHIFNACVLMFVFSAC 366

Query: 380 NSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFN 439
           NSDLYV+SRSLY LAIDNKAPKIFAKTN+WG+PY +L + +LFCLLAYM VSS SA++FN
Sbjct: 367 NSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFN 426

Query: 440 YFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIA 499
           YFVNVVSIFG++SWI+ILITYI FDRA+RAQGVDKST AY AP    GA+F+LFFCCLIA
Sbjct: 427 YFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIA 486

Query: 500 LIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQ 559
           LIKNFTVFL H+FDYKNFITGYIG+PVF  C+FGYK+   TK + P + DLYTFK  ID 
Sbjct: 487 LIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELIDL 546

Query: 560 EEEDGKMADAEKAERIKQNGKNFEWFYDKFLGNIF 594
           EEE+GK+ DA + E+++ + KNF+WFY+KFLG IF
Sbjct: 547 EEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/595 (61%), Positives = 432/595 (72%), Gaps = 17/595 (2%)

Query: 8   SNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERN-ISSASSQD----ENDSYNIDGK 62
            NS + ++E     L K+       ++  I+ DLE+N IS ASS++    + D ++ DGK
Sbjct: 8   GNSNNSKFE--MTDLQKQS------DQVTISSDLEQNSISIASSRNSSIGDRDIFD-DGK 58

Query: 63  TEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMA 122
           TEG RLKK LKARHVSM                       P S  I Y+FVG+LVFFTM+
Sbjct: 59  TEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFFTMS 118

Query: 123 CLGEMATYIPLDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKE 182
           CLGEMA +IPLDGFTSYASRY DPALGFAVGY+YL KY ILP NQLTA A+V+QYWVD++
Sbjct: 119 CLGEMAAFIPLDGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWVDRD 178

Query: 183 KVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHD 242
            +NPGV++TIFL++IV+IN            WLSSFKV                  P+HD
Sbjct: 179 TLNPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGPNHD 238

Query: 243 RLGFRYWRHPGSFKEYSETITGD---TGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNP 299
           RLGFRYWR PGSFK YS +I      TG+FV+F S FVYA + YLGIELTGIVAAEAQNP
Sbjct: 239 RLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEAQNP 298

Query: 300 RKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSG 359
           RK+IPKAIKLTMYRI+IFY+I+I LL MCVAY+DPLL+            PFVVAI NSG
Sbjct: 299 RKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIENSG 358

Query: 360 INALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVS 419
           IN LPHI N CVL FV SA NSDLYV+SRSLYSLAIDNKAPK F KTN+WGIPY++L+ S
Sbjct: 359 INILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSLAFS 418

Query: 420 VLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAY 479
             F  LAYM VSS+++ +FNYFVN VSIFG++SWI IL+TYI FD+A +AQG+DKS F Y
Sbjct: 419 TAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSNFTY 478

Query: 480 VAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYK 539
           VAP+QPYGA+F+LFFCC++AL+KNFTVFL  QFDYKNFITGYIG+PVFF C+ GYK  YK
Sbjct: 479 VAPWQPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYKIVYK 538

Query: 540 TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKFLGNIF 594
           TK   P +VDL T KA IDQEEEDGK+ DAE+ ER+K   K++ WFYD+FLG IF
Sbjct: 539 TKTHRPEEVDLVTLKALIDQEEEDGKIEDAEREERLKNGNKDWAWFYDRFLGKIF 593

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/533 (64%), Positives = 396/533 (74%), Gaps = 2/533 (0%)

Query: 62  KTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTM 121
            T+G  LKK L+ARHVSM                       P S  IAY+FVG+LVFFTM
Sbjct: 95  HTDG--LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTM 152

Query: 122 ACLGEMATYIPLDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDK 181
           A +GEMA+YIP+DGFTSYASRY DPALGFAVGY YLFKY IL PNQLTAA+LVIQYW+D+
Sbjct: 153 AAIGEMASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212

Query: 182 EKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDH 241
           + VNPGVW+TIFLVVIV IN            WLSSFKV                  PDH
Sbjct: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDH 272

Query: 242 DRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRK 301
           DRLGFRYW+HPG+FK YS+ I G  G+FVAFVSVFVYA +AYLGIELTGIVAAEA NPRK
Sbjct: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332

Query: 302 SIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGIN 361
           S+P+A+KLT++RIVIFYL++IFLLGMCVAY+DP L+            PFVVAI NSGI 
Sbjct: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIR 392

Query: 362 ALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVL 421
            LPHI NACVL+FVFSACNSDLYV SRSLYSLA+D KAP IF +T  WG+P+Y+L V VL
Sbjct: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452

Query: 422 FCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVA 481
           F LLAYM VSS SA++FNYFVNVVSIFG+LSWI I ITYI F RAV+ QGVD+S FAY A
Sbjct: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512

Query: 482 PFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTK 541
           PFQPYG +FSL +C  IA IKNFTVFL H FDYKNFITGYIGLPVF   YFGYKF  KTK
Sbjct: 513 PFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTK 572

Query: 542 VIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKFLGNIF 594
           ++   +VDL+T K   DQ+E +GK+ D EK  R+++N  + EW Y+KFLGNIF
Sbjct: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/575 (61%), Positives = 413/575 (71%)

Query: 20  EQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSM 79
           E L KK   +    E L  D     +   +S       ++DGK EG RLKKAL+ARHVSM
Sbjct: 3   ESLEKKNAGILYSNETLEEDVAFDKLERGASGASAAGASVDGKHEGIRLKKALEARHVSM 62

Query: 80  XXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSY 139
                                  P S LI+Y+FVGLLV+  MACLGEMA +IPLDGFTSY
Sbjct: 63  IAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTVMACLGEMAAFIPLDGFTSY 122

Query: 140 ASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVS 199
           ASRY DPALGFAVGY YLFKYFI+ PNQLTA A+V+QYWV +EKVNPGVW+TIFLV+IV 
Sbjct: 123 ASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVL 182

Query: 200 INXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYS 259
           IN            WLSS KV                  P+HDR GFRYWR PG+FK YS
Sbjct: 183 INTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRYWRDPGAFKPYS 242

Query: 260 ETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYL 319
           E I+G  G+FV+F SVF  A +AY G EL GIVAAEA+NPR+S+P+AIKLT+YRIV+FY+
Sbjct: 243 EAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYV 302

Query: 320 ISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSAC 379
           ISI LLGM VAY+DPLLI            PFVVAI N+GI  LPHI NACVL+FVFSAC
Sbjct: 303 ISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAGIPVLPHIFNACVLLFVFSAC 362

Query: 380 NSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFN 439
           NSDLYV+SR+LY LAID KAPKIFAKTN WG+PYY+L+VSVLFCLLAYM VSS SA+IFN
Sbjct: 363 NSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFN 422

Query: 440 YFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIA 499
           YFVNVVSIFG+LSWISILITY+ F +AV AQ  DKS F+Y APFQP+  W SLFFCCLI 
Sbjct: 423 YFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIG 482

Query: 500 LIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQ 559
           LIKN+TVFL H FDYK FI+GYIG+PV+  CY GYK  +++K+I P  VDLYTFKAAID 
Sbjct: 483 LIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKPEDVDLYTFKAAIDA 542

Query: 560 EEEDGKMADAEKAERIKQNGKNFEWFYDKFLGNIF 594
           EEE+GK+ + E+ E++K + KN  WFYD FLG IF
Sbjct: 543 EEEEGKLLELERKEQLKSSPKNLTWFYDTFLGWIF 577

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/593 (57%), Positives = 417/593 (70%), Gaps = 22/593 (3%)

Query: 21  QLPKKEFKLPIQEEELINDD---LERN------------ISSASSQDENDSYNI------ 59
           QL + +    I++++L  DD   +ER+            +   +S   +D  N+      
Sbjct: 10  QLSRVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSE 69

Query: 60  -DGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVF 118
            DGK +G RLKKAL+ARHVSM                       P + LIAYAFVGLLVF
Sbjct: 70  FDGKHDGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVF 129

Query: 119 FTMACLGEMATYIPLDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYW 178
           F M+CLGEMA YIPLDGFTSY++RY DPALGFAVGYAYLFKY+I+ PNQLTA ALVIQYW
Sbjct: 130 FVMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189

Query: 179 VDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXX 238
           VD++KVNPGVW+TI LV I++IN            ++S+ K+                  
Sbjct: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGG 249

Query: 239 PDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQN 298
           P+H+ LGF+YW++PG+FKEYS  ITG  GRFV+F SVFV A +AYLG EL GIV +E +N
Sbjct: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKN 309

Query: 299 PRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINS 358
           PRK++PKAIKLTMYRI++FYLISIFLLGMCV ++DPLLI            PFVVAI+N+
Sbjct: 310 PRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNA 369

Query: 359 GINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSV 418
           GI  LPHI+NAC+L+FVFSA NSDLYV+SRSLY LAIDNKAP+IFAKTN+ G+PY++L V
Sbjct: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429

Query: 419 SVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFA 478
            VLF LLAYM VSS S+++F YFVN VSIFG+LSWISILITYI FD+A R QG+DKST A
Sbjct: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLA 489

Query: 479 YVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTY 538
           Y +P QPYGAWFSLFFC LI LIKNF  FL   FDYK+FITGYIG+P +   Y GYK  Y
Sbjct: 490 YQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWY 549

Query: 539 KTKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKFLG 591
           KTK+I   +VDL +FK A+D EEE+GKM D E+A  +  +GK+ +W Y+K  G
Sbjct: 550 KTKIIPSEEVDLVSFKEAVDLEEEEGKMLDEERAAHLAAHGKDLKWCYEKIFG 602

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/559 (59%), Positives = 408/559 (72%), Gaps = 2/559 (0%)

Query: 38  NDDLERNISSASSQDE--NDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXX 95
           N+ LE  I +  S+ +  + S  +DGK EG RLKK L+ARHVSM                
Sbjct: 18  NETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMIAIGGSLGTGLLIGTG 77

Query: 96  XXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSYASRYCDPALGFAVGYA 155
                  PVS LI+Y+FVGLLV+  M+CLGEMA +IPLDGFTSYASRY DPA+GFAVGY+
Sbjct: 78  SSLASAGPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTSYASRYVDPAVGFAVGYS 137

Query: 156 YLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWL 215
           YLFKYFI+ PNQLTA A+V+Q+WV +++VNPGVW+TIFL +IV IN            WL
Sbjct: 138 YLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWL 197

Query: 216 SSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSV 275
           SS KV                  P+HDR GFR+WR PG+FK YSE I+G  G+FV+F SV
Sbjct: 198 SSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKPYSEAISGSKGKFVSFASV 257

Query: 276 FVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPL 335
           F  A +AY G EL GIVAAEA+NPR+S+P+AIKLT+YRIV+FY+I+I LLGM VAY+DP 
Sbjct: 258 FALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPR 317

Query: 336 LIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAI 395
           L+            PFVVAI N+ I  LPHI N CVLVFVFSACNSDLYV+SRSLY LAI
Sbjct: 318 LLKAKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAI 377

Query: 396 DNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWIS 455
           D KAP+IFA TN+WG+PYY+L +SVLFCLLAYM VSS SA++FNYFVNVVSIFG+LSWI+
Sbjct: 378 DGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWIT 437

Query: 456 ILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYK 515
           ILITYI FD+A+R Q  DKS+ +Y A FQP+  + +LFFCCLI LIKN+TVFL H+FDYK
Sbjct: 438 ILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYK 497

Query: 516 NFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERI 575
            FI+GYIG+PV+  CY GYK  Y+TK+I P  VDLYTFK AID EEE+ K+ + E+ E +
Sbjct: 498 TFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFKDAIDAEEEEYKLLEKERLENM 557

Query: 576 KQNGKNFEWFYDKFLGNIF 594
           + + KNF+WFY+ FLG IF
Sbjct: 558 ENSPKNFKWFYETFLGWIF 576

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/563 (60%), Positives = 405/563 (71%), Gaps = 8/563 (1%)

Query: 23  PKKEFKLPIQEEEL-INDDLERNISSAS----SQDENDSYNIDGKTEGTRLKKALKARHV 77
           PK +    +   +L +N +++ + SS S    + D   S   DGK EG RLKK LK+RH+
Sbjct: 15  PKGDNAKEVTASKLALNIEVQSDQSSKSLCDSASDVLASEIGDGKYEGIRLKKQLKSRHI 74

Query: 78  SMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFT 137
           SM                       PVSTLIAY FVG++VFFTMACLGEMAT+IPLDGFT
Sbjct: 75  SMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFFTMACLGEMATFIPLDGFT 134

Query: 138 SYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVI 197
           SYASRYCDPALGFAVGYAYL KYFILPPNQLTAAA+V+QYWV ++ VNPG+WVT+   VI
Sbjct: 135 SYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYWVPRDTVNPGIWVTLVFAVI 194

Query: 198 VSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKE 257
             IN            WLSS KV                    HDRLGFRYW+HPG+F +
Sbjct: 195 TVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGAGSHDRLGFRYWKHPGAFND 254

Query: 258 YSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIF 317
           YS+ I+G  G+FV+FV+V V   +AYLGIELTGIVAAEA NPR+S+PKAIKLT YRI++F
Sbjct: 255 YSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEASNPRRSVPKAIKLTFYRILVF 314

Query: 318 YLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFS 377
           Y++SIFLLGMCV Y+D  L+            PF +AI+N+GI  LP I N C+L+FVFS
Sbjct: 315 YVVSIFLLGMCVPYNDEKLVTTNENSLTAS--PFSIAILNAGITVLPDIFNGCLLIFVFS 372

Query: 378 ACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKI 437
           A NSDLYV+SR+LYSLA+DNKAPKIFA TNRWGIPY +L VS LFCLLAYM VSS+SA++
Sbjct: 373 AANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVSCLFCLLAYMTVSSSSAQV 432

Query: 438 FNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCL 497
           F YFVNVVSI G+L+WISILITYICFDRAVRAQ VDKSTFAYVAPFQPYGA+ SLFFCCL
Sbjct: 433 FKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAYVAPFQPYGAYVSLFFCCL 492

Query: 498 IALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAI 557
           IA+IKNFTVFL H FDYK FITGYIGLP+F  CYFGYK T K+++     VDL + K+ +
Sbjct: 493 IAIIKNFTVFLGH-FDYKTFITGYIGLPIFVLCYFGYKITCKSEIRSARYVDLVSQKSLV 551

Query: 558 DQEEEDGKMADAEKAERIKQNGK 580
           D+E+ + ++ +  K E +  N K
Sbjct: 552 DREQVEYELIEQLKREEMIANTK 574

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/540 (58%), Positives = 381/540 (70%), Gaps = 2/540 (0%)

Query: 57  YNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLL 116
           +  DGK +G RLKK L+ARHVSM                       P++ LIAY+ +G +
Sbjct: 47  WGYDGKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWV 106

Query: 117 VFFTMACLGEMATYIPLDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQ 176
           VF  M+CLGEMA YIPLDGFTSYA+RY DPALGFAVGY YLFKY +L PNQLTAAALV+Q
Sbjct: 107 VFTVMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQ 166

Query: 177 YWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXX 236
           YWV + KVNPGVW+T+FL VI++IN            WLSSFKV                
Sbjct: 167 YWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLG 226

Query: 237 XXPDHDRLGFRYWRHPGSFKEYSE--TITGDTGRFVAFVSVFVYATYAYLGIELTGIVAA 294
             P H+RLGFRYW+ PG FK YS   +I G  G+FV+F SVFVYA +AYLG EL GIVAA
Sbjct: 227 GGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAA 286

Query: 295 EAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVA 354
           E +NPR+++P+AIKLT+YRIV+FYL ++FLLG+ VAY+DPLL+            P+VVA
Sbjct: 287 ECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVA 346

Query: 355 IINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYY 414
           I N+GI  LPHI NACVL FVFSACNSDLYV SRSLY LAID KAPKIFAKTN WG+PY 
Sbjct: 347 IKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYN 406

Query: 415 ALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDK 474
           +L++  LFC LAYM VSS++  +F+YFVNV SIFG+LSWISILITYI FDRA R QG+DK
Sbjct: 407 SLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDK 466

Query: 475 STFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGY 534
           +T +Y APFQP  AW +L FC ++AL+KNFTVFL   FDYK FITGYIG+PV+  C+  Y
Sbjct: 467 NTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCY 526

Query: 535 KFTYKTKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKFLGNIF 594
           K  +KTK I    VDL+T+K AID EEE+GK+      E  KQ+G  ++ FYD   G IF
Sbjct: 527 KIVHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGWIF 586

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/586 (54%), Positives = 390/586 (66%), Gaps = 7/586 (1%)

Query: 16  EEYFEQLPK----KEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKA 71
           EE F Q  +     E K P          L    SS   + ++  +N DGK EG RLKK 
Sbjct: 3   EEKFAQASEASTLDELKGPKLAAAGEGRGLRHTHSSTDQEAQSVDWNYDGKHEGIRLKKD 62

Query: 72  LKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYI 131
           L+ARHVSM                       P S LIAY+ +G +VF  M+CLGEMA YI
Sbjct: 63  LQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFTVMSCLGEMAAYI 122

Query: 132 PLDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVT 191
           PLDGFTSYA+RY DPALGFAVG+AYLFKY +L PNQLTA ALVIQ+W+   +V+PGVW+T
Sbjct: 123 PLDGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFWIPAARVSPGVWIT 182

Query: 192 IFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRH 251
           + L VIV IN            WLSSFKV                  P HDRLGFRYW  
Sbjct: 183 VVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGGPTHDRLGFRYWSD 242

Query: 252 PGSFKEYSET---ITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIK 308
           PG+FKEYS+    I G  G+FVAF+SVFVYA +AYLG EL GIVAAE ++PR+++P+AIK
Sbjct: 243 PGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAECKDPRRNVPRAIK 302

Query: 309 LTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIIN 368
           LT+YRIV+FYL++IFLLGMCVAY+DPLL+            P+VVAI N+ I  LP++ N
Sbjct: 303 LTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAIENAVIPVLPNLFN 362

Query: 369 ACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYM 428
           ACVL FVFSACNSDLYV SRSLY LAID KAPK+FA+TN+WG+PY AL+   LFC LAYM
Sbjct: 363 ACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNALACCTLFCCLAYM 422

Query: 429 CVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGA 488
            VS ++   F YFVNV SIFG++SW+SILITYICFDRA RAQG+ KST +YVAP QPY  
Sbjct: 423 SVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKSTLSYVAPCQPYAG 482

Query: 489 WFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKV 548
           W +L FC  +ALIKNF  F+  + D   FITGYIGLP++ FC+ GYK  +KTK I   +V
Sbjct: 483 WVALIFCIFVALIKNFDAFIGKEVDVPTFITGYIGLPIYIFCFIGYKIVHKTKWIPSKEV 542

Query: 549 DLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKFLGNIF 594
           DL+TFK AID EEE+     A   E++ + G +++  YD  LG IF
Sbjct: 543 DLFTFKEAIDLEEEECIRERALMKEQLAKGGLSWKKIYDNVLGWIF 588

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  322 bits (824), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 188/524 (35%), Positives = 272/524 (51%), Gaps = 17/524 (3%)

Query: 41  LERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXX 100
           LER    AS +DE +S  ID K     L + LK R VS+                     
Sbjct: 10  LER---PASGEDECESEEIDEKNG--NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAK 64

Query: 101 XXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLD-GFTSYASRYCDPALGFAVGYAYLFK 159
             P+S  IAY F G L+   +  L EMA++ P+D GF+ Y +RY DPA GFA G+ Y  K
Sbjct: 65  GGPISLFIAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLK 124

Query: 160 YFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFK 219
           Y I+    LTA  LVI YW  +  VN GVWVT+  V +  +N             L+ FK
Sbjct: 125 YAIVLSANLTAFGLVIGYW--RPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFK 182

Query: 220 VXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYA 279
           +                  P+H   GFRYWR  G+       + G TG+F+ + +  V +
Sbjct: 183 LLVLVIVYITCLIITCGGAPNHTTTGFRYWRESGALPY---LVGGGTGKFLGWWACVVQS 239

Query: 280 TYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXX 339
            + ++G E+ GIV  E  NP+K+IPK+     +RI   Y+  +F+LG+ ++  +  L+  
Sbjct: 240 IFGFMGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHA 299

Query: 340 XXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKA 399
                     PFV+AI +SGI  LP+ +NA +LVF+ S+ N+D+Y+ SR LY LA D  A
Sbjct: 300 HSTDANAS--PFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAA 357

Query: 400 PKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILIT 459
           PKIF   NR+ +P        L   LAYM    ++A +F+Y  + VS+FGIL+W  ILI 
Sbjct: 358 PKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIA 417

Query: 460 YICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFIT 519
           YI +DRA++A+G+      +   FQPY A+ +LFF  +I     +  F+  +F YK FIT
Sbjct: 418 YINYDRAIKAKGISIDDIPFRMWFQPYAAYVTLFFVTIITFFNGYNAFI-IKFHYKTFIT 476

Query: 520 GYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQEEED 563
            YIG+        GYK  +KTK + P ++   +F+   + E E+
Sbjct: 477 SYIGVFANILMVIGYKLYFKTKFVKPSEI---SFRTRNEHEGEE 517

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  314 bits (805), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 188/595 (31%), Positives = 295/595 (49%), Gaps = 35/595 (5%)

Query: 8   SNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTR 67
           +N  SD  ++   ++ K            I +DL  ++      D   S ++DG +E  +
Sbjct: 52  NNHRSDNEKDDAIRMEKISKNQSASSNGTIREDLIMDV------DLEKSPSVDGDSEPHK 105

Query: 68  LKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEM 127
           LK+ L++RHV +                       P    I+Y  +  +++  M  LGEM
Sbjct: 106 LKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEM 165

Query: 128 ATYIPLDGFTSYAS------RYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDK 181
             ++P DG  S  S      RY DP+LGFA G+ Y + Y IL   + TAA+ V++YW   
Sbjct: 166 VCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASGVVEYWT-- 223

Query: 182 EKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDH 241
             V  GVW+TIFL V+V +N            W +S K+                  P+H
Sbjct: 224 TAVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNH 283

Query: 242 DRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAY-LGIELTGIVAAEAQNPR 300
           DRLGFRYW+HPG+F  +     G  G F    +  +   +A+ LG EL  + +AE  + R
Sbjct: 284 DRLGFRYWQHPGAFAHH--LTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQR 341

Query: 301 KSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXX-XXXXXPFVVAIINSG 359
           ++I KA +  ++R++ FY++    + + V Y+DP L+             PFV+ I N+G
Sbjct: 342 RNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSPFVIGIQNAG 401

Query: 360 INALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVS 419
           I  LPHIIN C+L   +SA N+ ++ S+RSL ++A   +APK   + N+WG+PY A+ VS
Sbjct: 402 IKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVPYVAVGVS 461

Query: 420 VLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGV-DKSTFA 478
            L   LAY+ VSS++A +FN+F N+ +I G L W+   I Y+ F +A+   G+ D+  F 
Sbjct: 462 FLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGLYDRLPFK 521

Query: 479 YVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKF-- 536
                QPY  WFSL    +I +   + +F+   +   +FI  YI LP+F   +FG+K   
Sbjct: 522 TWG--QPYTVWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYITLPIFLVLWFGHKLYT 579

Query: 537 -TYKTKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKFL 590
            T++   +   ++D+ T    I+           EK+  I++       F DKFL
Sbjct: 580 RTWRQWWLPVSEIDVTTGLVEIE-----------EKSREIEEMRLPPTGFKDKFL 623

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  311 bits (796), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 184/555 (33%), Positives = 285/555 (51%), Gaps = 19/555 (3%)

Query: 42  ERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXX 101
           E +I S S        + D       LKK LK+RH+ +                      
Sbjct: 25  EIDIESYSQISGPKVSSSDAPQGDHTLKKGLKSRHIQLIALGGCIGTGLFVGTSSTLHAC 84

Query: 102 XPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFT------SYASRYCDPALGFAVGYA 155
            P     +Y  + ++++  M  LGEM  Y+P DG +         +RY DP+LGFA G+ 
Sbjct: 85  GPAGLFTSYCIISVIIYPVMNALGEMVCYLPGDGSSSGGSISKLVTRYVDPSLGFATGWN 144

Query: 156 YLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWL 215
           Y + Y IL   + TAA+ V+QYW     V  G W+TIFL V+V +N            W 
Sbjct: 145 YYYCYVILVAAECTAASGVVQYWTTA--VPKGAWITIFLGVVVLLNFCAVKFYGESEFWF 202

Query: 216 SSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSV 275
           +S K+                  P HDRLGFRYW+ PG+F  +    +G+TGRF+   + 
Sbjct: 203 ASMKILCILGLLFVSFILFWGGGPHHDRLGFRYWQKPGAFAYH--ITSGNTGRFLDIWTG 260

Query: 276 FVYATYAY-LGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDP 334
            +   +A+ LG EL  + +AEAQ+ R++I KA +  +YR++ FY+ S   +G  VAY+D 
Sbjct: 261 VIKGGFAFILGPELVALTSAEAQDARRNIQKASRRFVYRLIFFYVSSSLAIGCIVAYNDK 320

Query: 335 LL-IXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSL 393
            L              PFV+ I N+GI  LPHIIN C+L   +S+ NS ++ +SRSL S+
Sbjct: 321 TLSTALDQGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMFAASRSLLSM 380

Query: 394 AIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSW 453
           + +  APKI  + NR+G+PY A++++ L   +AY+ VSS++A +F +F N+ +I G + W
Sbjct: 381 SQEGFAPKILGRVNRFGVPYAAVALTSLLSCIAYLNVSSSTADVFTWFSNISTISGFIGW 440

Query: 454 ISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFD 513
           I I I Y+ F +A+  Q + +    +  PFQPYG WF +    +I L   + +F+   ++
Sbjct: 441 ICIGIAYLRFRKAIFFQNLYERV-PFKTPFQPYGTWFFIIAVSVICLTNGYAIFIPANWN 499

Query: 514 YKNFITGYIGLPVFFFCYFGYKF---TYKTKVIDPLKVDLYTFKAAIDQEEEDGKMADAE 570
             +FI  Y+ LP+F   + G+K    T+KT  I   ++D+ T    + + EE+ K  D +
Sbjct: 500 VSDFIAAYVTLPIFLVLWIGHKLWTRTWKTWAIPVPEIDVTT---GLKEIEEESKECDEK 556

Query: 571 KAERIKQNGKNFEWF 585
           +       GK  EW 
Sbjct: 557 RIVPTTAGGKFMEWL 571

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  309 bits (792), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 183/535 (34%), Positives = 282/535 (52%), Gaps = 12/535 (2%)

Query: 24  KKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTE-GTRLKKALKARHVSMXXX 82
           KKE  +  QE   + +      +  +S    +S N D  ++    LKK L  RH+ +   
Sbjct: 6   KKEASVSKQEFNGMKEVKSNEETYRTSHSNLESQNSDVVSDYEHNLKKGLSNRHIQLIAL 65

Query: 83  XXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYAS 141
                               P    +++  +  +V+  M  L EM  Y+P  G      +
Sbjct: 66  GGCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCTLAEMVCYLPQQGSVPELVT 125

Query: 142 RYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSIN 201
           RY DP+LGFA G+ Y + Y +L   +LTAAA +++YW D+  V  GVW+TIFL+V+V +N
Sbjct: 126 RYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYWTDQ--VPQGVWITIFLIVVVVLN 183

Query: 202 XXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSET 261
                       W +S K+                  P+HDR+GFRYWR+PG+F  +   
Sbjct: 184 FSAVRFYGESEFWFASLKIICILALLVVSIVIFFGGAPNHDRVGFRYWRNPGAFGYH--I 241

Query: 262 ITGDTGRFVAFVSVFVYATYAY-LGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLI 320
             G+ GRF+   +  + + +A+ L  EL G+   EA++ R++I KA +  +YRI+ FYL 
Sbjct: 242 TGGNLGRFLDLWTAIIKSAFAFILSPELVGLACVEAKDTRRNIEKASRRFIYRIIFFYLS 301

Query: 321 SIFLLGMCVAYDDP-LLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSAC 379
           S  ++G+ VA +D  LL+            PFV  I NSGI  L H+IN  +L   +SA 
Sbjct: 302 SSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQGIANSGIPVLNHVINVAILTSAWSAG 361

Query: 380 NSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFN 439
           NS  Y SSRS+ +L+    APKIF+K NR+G+PY A+ +  L   LAY+ VSS S+K+F 
Sbjct: 362 NSFFYASSRSILALSKQGDAPKIFSKINRFGVPYNAVFLCSLVACLAYLNVSSTSSKVFQ 421

Query: 440 YFVNVVSIFGILSWISILITYICFDRAVR-AQGVDKSTFAYVAPFQPYGAWFSLFFCCLI 498
           +  N+ +I G + W  I + YI F +A+   + +D+    Y +P QP+ A+F      +I
Sbjct: 422 WLSNICTISGFIGWFLIGVAYIRFRKAILFNRLLDR--IPYRSPLQPFSAYFFTIVVAII 479

Query: 499 ALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPL-KVDLYT 552
            L   + VF+  ++DYK+F+T YI LP+F   Y G+K  YKT+   P+ ++D+ T
Sbjct: 480 TLTNGYVVFIKGRWDYKDFLTSYISLPIFLAFYLGHKTIYKTRFCIPVDQIDVIT 534

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  310 bits (794), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 175/523 (33%), Positives = 288/523 (55%), Gaps = 14/523 (2%)

Query: 50  SQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIA 109
           S DE D  + + + + T++K+ALK RH+ M                       PV +LIA
Sbjct: 86  SSDEYD--HQEAEFKDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIA 143

Query: 110 YAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQL 168
           Y F+G +V+F    LGEMAT+IP+    T ++SR+  PA G + GY Y F + I    ++
Sbjct: 144 YIFMGTVVYFVTQALGEMATFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEI 203

Query: 169 TAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXX 228
           +    VI++W    KV    W++IF V++ ++N            W++S KV        
Sbjct: 204 SVVGQVIEFWT--TKVPLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLI 261

Query: 229 XXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIEL 288
                          +GFRYWRH  +      +   +  RF+ +V+  + A + Y G EL
Sbjct: 262 YALVIVCGGS-KQGPIGFRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTEL 320

Query: 289 TGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXX 348
            GI A EA NPRKS+P+AI   ++RIVIFY++S+F +G+ V Y+DP L            
Sbjct: 321 VGITAGEAANPRKSVPRAINKVVFRIVIFYILSLFFIGLLVPYNDPKL---NSATSYIAS 377

Query: 349 XPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNR 408
            PFV++I N+G  ALPHI NA +++ + SA NS++YVSSR LYSLA+   APKIFA+   
Sbjct: 378 SPFVISIENAGTRALPHIFNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTP 437

Query: 409 WGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVR 468
            G+P+  + V+ L  LLA++ V++ + + FN+ +N+ ++ G+ +W+ I ++++ F  A++
Sbjct: 438 QGVPFLGVIVTALMGLLAFLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALK 497

Query: 469 AQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFF 528
            +G+ +    + A F PYG++++ FF  +I  I+ FT F + +FD  +F T YI L +  
Sbjct: 498 YRGISRDDLPFKARFMPYGSYYACFFITVIIFIQGFTAF-SPKFDVASFFTAYISLILLA 556

Query: 529 FCYFGYKFTYKTKVIDPLK-VDLYTFKAAIDQ---EEEDGKMA 567
             + G +  Y+ +    ++ +D+ T +  ID+   E+++ K A
Sbjct: 557 VLFIGCQLYYRCRFFWKVEDIDIDTDRREIDEIVWEDDEPKTA 599

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  309 bits (791), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 177/545 (32%), Positives = 284/545 (52%), Gaps = 11/545 (2%)

Query: 3   IRQIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGK 62
           +  + SN +  Q       +   +   P++  +  N  LE     A   D +  ++ +G 
Sbjct: 13  LEALHSNLSQSQSARSGMHVSNSKIDDPLRFSKDNNLTLE-----AIDDDSSRMFDPEGS 67

Query: 63  TEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMA 122
                +K+ALK RHVSM                       PV +LIA+  +G L +    
Sbjct: 68  IGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQ 127

Query: 123 CLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDK 181
            LGEMAT+IP+   FT ++ R+  PA+G A GY Y F + I    +L+    +IQYW D 
Sbjct: 128 SLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDA 187

Query: 182 EKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDH 241
             +    W+ IF V++VS N            W++S KV                  P+ 
Sbjct: 188 VPLE--AWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEG 245

Query: 242 DRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRK 301
             +GFRYWR PG +         +  RF+ +VS  + A + Y G EL GI A E +NPRK
Sbjct: 246 P-IGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRK 304

Query: 302 SIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGIN 361
           ++P+AI    +RI+IFY+ S+F +G+ V Y+DP L             PF++AI+N    
Sbjct: 305 AVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKL-EGSDNGSYIAQSPFLIAILNCRTP 363

Query: 362 ALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVL 421
            LPHI NA +L  + SA NS++YV SR L+ L+ +N APK F+KT + G+P+ A+ ++ +
Sbjct: 364 VLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAV 423

Query: 422 FCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVA 481
           F  LAY+ VS+ + ++F++ +N+ +I G ++W+ I I++I F + ++ +G+ +    Y A
Sbjct: 424 FGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKA 483

Query: 482 PFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTK 541
            F PY A+++ FF  +I +I+ FT F  H F+  +F   YI + +FF  +  ++  Y+TK
Sbjct: 484 KFMPYAAYYAAFFITVIIIIQGFTAFAPH-FNVSDFFAAYISVFLFFIVWAIFQTIYRTK 542

Query: 542 VIDPL 546
           +   L
Sbjct: 543 LFRTL 547

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  305 bits (781), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 180/503 (35%), Positives = 261/503 (51%), Gaps = 15/503 (2%)

Query: 47  SASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVST 106
           SASS+DE  S N     E T L + L    VS+                       P+S 
Sbjct: 18  SASSRDEGGSTN-----EAT-LSRELSPGVVSLLTLGSAVGTGLIIGSGTALARGGPISI 71

Query: 107 LIAYAFVGLLVFFTMACLGEMATYIPLD-GFTSYASRYCDPALGFAVGYAYLFKYFILPP 165
            +AY F G ++   +  L EMA + P+D GF+ Y ++Y DPA GFA G+ Y  KY I+  
Sbjct: 72  FLAYLFTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFLKYAIVLS 131

Query: 166 NQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXX 225
             LTA  LVI YW  +  +N  VWVT+       +N            +++  K+     
Sbjct: 132 ANLTAFGLVIGYW--RPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVAKLTILLL 189

Query: 226 XXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLG 285
                        PDH  +GFRYWR  G F  Y   + G+TG+F+ + +  + + + ++G
Sbjct: 190 IFIVCLVITCGGGPDHTTIGFRYWRESG-FLPY--LVKGNTGKFLGWWACVIQSIFGFMG 246

Query: 286 IELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXX 345
            E+ GI+  E  NPRK+IPKA +  + RI +FY+  +F+LG+ V+  +  L+        
Sbjct: 247 SEMIGIIYGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVHAHSTDAN 306

Query: 346 XXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAK 405
               PFV+AI  SGI  LP  +NA +LVF+ S+  +D+Y+ SR LY LA D  APKIF +
Sbjct: 307 AS--PFVIAISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAAPKIFLR 364

Query: 406 TNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDR 465
            N+  IP     V  L   LAYM    ++A +F Y  + VS+FGIL+W  IL+ YI +DR
Sbjct: 365 LNKHKIPMVGCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVAYIHYDR 424

Query: 466 AVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLP 525
            V++ GV      +  PFQPY A+ +LFF  +I     ++ F+  +F+YK FIT YIG+ 
Sbjct: 425 VVKSHGVRLDEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFI-LKFNYKLFITSYIGIF 483

Query: 526 VFFFCYFGYKFTYKTKVIDPLKV 548
                  GYK  YKTK + P ++
Sbjct: 484 ANVLLVLGYKLYYKTKWVKPEEI 506

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  305 bits (780), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 176/526 (33%), Positives = 273/526 (51%), Gaps = 11/526 (2%)

Query: 42  ERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXX 101
           E  +S  S   +  S    G  + T++K+ALK RH+SM                      
Sbjct: 16  EELVSEFSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNA 75

Query: 102 XPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKY 160
            PV  LIAY F+G L +     LGEMAT+IP+   F  +  R+  PALG A GY Y   +
Sbjct: 76  GPVGALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSW 135

Query: 161 FILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKV 220
            I    +L+    VIQ+W D   +    W+ I  VV+VS N            W++  KV
Sbjct: 136 SITFALELSVVGQVIQFWTDAVPLT--AWIIILWVVLVSANLAPVKFYGEVEFWIACIKV 193

Query: 221 XXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYAT 280
                                  +GFRYWR+PG +     +   + GRF+ +VS  + A 
Sbjct: 194 LAIVGFIIYAFIMVCGAG-KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAA 252

Query: 281 YAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXX 340
           + Y G EL GI A EA NPRK++P+AI    +RI+ FY++S+  +G+ V ++DP L    
Sbjct: 253 FTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKL---K 309

Query: 341 XXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAP 400
                    PFV+AI NSG   LPHI NA +L  + SA NSD+Y+SSR LYS+ ++  AP
Sbjct: 310 SEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAP 369

Query: 401 KIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITY 460
           K    T + GIPY A+  + L   LAY+  S  ++ +F++ +N+ ++ G  +W+ I + +
Sbjct: 370 KYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAH 429

Query: 461 ICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITG 520
           I F +A++ QG+ +    + A F P+GA+++ FF  +I +I+ FT F   +F+  +F T 
Sbjct: 430 IRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAF-APKFNVSDFFTA 488

Query: 521 YIGLPVFFFCYFGYKFTYKTKVIDPLK-VDLYTFKAAIDQE--EED 563
           Y+ + +FF  + G++  ++  +    + +DL T +  ID +  EED
Sbjct: 489 YVSVILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRREIDNDVWEED 534

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  303 bits (777), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 176/515 (34%), Positives = 273/515 (53%), Gaps = 12/515 (2%)

Query: 61  GKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFT 120
           GK   T++K+ALK RH+ M                       PV +LIAY F+G +V+F 
Sbjct: 95  GKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYFV 154

Query: 121 MACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWV 179
              LGEMAT+IP+    T +  R+  PALG + GY Y F + I    +L+    +IQYW 
Sbjct: 155 TQSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYWT 214

Query: 180 DKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXP 239
              KV    W+ IF V++  +N            W+SS KV                   
Sbjct: 215 --YKVPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGS- 271

Query: 240 DHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNP 299
               +GFRYWRH  +F +   +   D  RF+ +VS  + A + Y G EL GI A EA NP
Sbjct: 272 RQGPIGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANP 331

Query: 300 RKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSG 359
           RK++P+AI   ++RI +FY++S+F +G+ V Y+D  L             PFV++++N+G
Sbjct: 332 RKTVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRL---SDGSAIIASSPFVISMLNAG 388

Query: 360 INALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVS 419
            +ALP I NA +L+ V SA NSD+Y++SR LY+LA    APK F   NR+G+PY  + V+
Sbjct: 389 TSALPDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVT 448

Query: 420 VLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAY 479
            L   LA++ VS+ +   FN+ +N+ ++ G+ +W  I   +I F +A++ +G+ +    +
Sbjct: 449 CLVGWLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPF 508

Query: 480 VAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYK 539
            A F P+GA+++ FF  LI  I+ +  F    +D K+F T YI L +F   Y G    Y+
Sbjct: 509 KARFMPWGAYYAAFFVGLIIFIQGYDAFT--PWDTKSFFTSYISLILFGVLYLGCLIYYR 566

Query: 540 TKVIDPLK-VDLYTFKAAIDQ--EEEDGKMADAEK 571
            +++  ++ +D+ T +  ++    EED      EK
Sbjct: 567 GRLLIKIEDIDIDTDRKEVEAYVWEEDAPRNWWEK 601

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  303 bits (777), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 172/519 (33%), Positives = 267/519 (51%), Gaps = 27/519 (5%)

Query: 31  IQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXX 90
           I+E+ +++ D+E+            S +++G  E  +LK+ L++RHV +           
Sbjct: 85  IREDLIMDVDVEK------------SPSVEGDNEPHKLKQGLQSRHVQLIALGGAIGTGL 132

Query: 91  XXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSYAS------RYC 144
                       P    I+Y  +  +++  M  LGEM  ++P DG  S  S      RY 
Sbjct: 133 LVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYV 192

Query: 145 DPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXX 204
           D +LGFA G+ Y + Y IL   + TAA+ V++YW     V  GVW+TIFL V+V +N   
Sbjct: 193 DASLGFATGWNYFYCYVILVAAECTAASGVVEYWT--TAVPKGVWITIFLCVVVLLNLSA 250

Query: 205 XXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITG 264
                    W +S K+                  P+HDRLGFRYW+HPG+F  +     G
Sbjct: 251 VKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAFAHH--LTGG 308

Query: 265 DTGRFVAFVSVFVYATYAY-LGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIF 323
             G F    +  +   +A+ LG EL  + +AE  + R++I KA +  ++R++ FY++   
Sbjct: 309 SLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNISKASRRFVWRLIFFYVLGTL 368

Query: 324 LLGMCVAYDDPLLIXXXXXXX-XXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSD 382
            + + V Y+DP L+             PFV+ I N+GI  LPHIIN C+L   +SA N+ 
Sbjct: 369 AISVIVPYNDPSLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILSSAWSAANAF 428

Query: 383 LYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFV 442
           ++ S+RSL ++A   +APK   + NRWG+PY A+ VS L   LAY+ VSS++A +FN+F 
Sbjct: 429 MFASTRSLLTMAQTGQAPKCLGRINRWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFS 488

Query: 443 NVVSIFGILSWISILITYICFDRAVRAQGV-DKSTFAYVAPFQPYGAWFSLFFCCLIALI 501
           N+ +I G L W+   I Y+ F +A+   G+ D+  F      QPY  W SL    +I L 
Sbjct: 489 NISTISGFLGWMCGCIAYLRFRKAIFYNGLFDRLPFKTWG--QPYTVWASLIVVGIITLT 546

Query: 502 KNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKT 540
             + +F+   +   +FI  YI LP+F   +FG+K   +T
Sbjct: 547 NGYAIFIPKYWKIADFIAAYITLPIFLVLWFGHKLYTRT 585

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  302 bits (773), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 177/536 (33%), Positives = 278/536 (51%), Gaps = 22/536 (4%)

Query: 40  DLERNISSASSQDENDSYNID-------------GKTEGTRLKKALKARHVSMXXXXXXX 86
           + +R+ISS   +++   Y +D             G+   T +K+ALK RH+ M       
Sbjct: 33  EYDRSISSPPKENDGYGYRVDNEYDVDDSVDGEKGEVRSTEVKRALKPRHIGMIALGGTI 92

Query: 87  XXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCD 145
                           PV  LIAY F+  + F  M  LGEMATYIP+   F+ ++ R+  
Sbjct: 93  GTGLFVGISEPLQNAGPVGMLIAYLFMATIAFSVMQSLGEMATYIPVTSAFSVFSQRFLS 152

Query: 146 PALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXX 205
           PA G A GY Y F + I    +L+    ++QYW  K  V    W++IF V+I  +N    
Sbjct: 153 PAFGAANGYMYWFSWSITFALELSVIGQIVQYWTFKVPV--AAWISIFWVLIAGLNFCPV 210

Query: 206 XXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGD 265
                   W++  KV                       +GFRYWRH  +F +   +   +
Sbjct: 211 KFYGEFEFWIAFIKVVAIVGFIIYCFIMVCGAG-KTGPVGFRYWRHGYAFGDGIISKNKN 269

Query: 266 TGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLL 325
             RF+ +VS  + A + Y G EL GI A EA NPRK++PK+IK T++RI+IFY+ S+  +
Sbjct: 270 EARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPKSIKRTLWRILIFYIFSLLFV 329

Query: 326 GMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYV 385
           G+ V ++D  L             PF++AI NSG  ALP I NA +L  V SA NSD+YV
Sbjct: 330 GLLVPFNDHGL---QDSRSYAASSPFILAIKNSGTKALPDIFNAVILTTVISAANSDVYV 386

Query: 386 SSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVV 445
            SR +YS+A +  AP I AK ++ G+PY A+  +     LAY+  SS+ A +FN+ +N+ 
Sbjct: 387 GSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTSAIGALAYLETSSSGANVFNWLMNIT 446

Query: 446 SIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFT 505
            + G  SW  I  +++ F +A++ +G+ ++   + A F P+ A +S FF  LI L++ FT
Sbjct: 447 GVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFKASFMPWIAIYSFFFMTLIILVQGFT 506

Query: 506 VFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPL-KVDLYTFKAAIDQE 560
            F  H F   +F+  YI + +FF  +  ++  ++  ++ P+ ++D+ T +  +D E
Sbjct: 507 CFTPH-FQASDFVASYISVGLFFVIWAVFQIWFRCPLLVPIAEIDIDTDRRDVDAE 561

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  301 bits (772), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 181/514 (35%), Positives = 269/514 (52%), Gaps = 18/514 (3%)

Query: 62  KTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTM 121
           K E   LK+ L++RH+ +                       P   L +Y  + L+++  M
Sbjct: 43  KREPHTLKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVM 102

Query: 122 ACLGEMATYIPLDG------FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVI 175
             LGEM  Y+P  G       +   SRY DP+LGFA G+ Y + Y IL   + TAA+ V+
Sbjct: 103 NALGEMVCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVV 162

Query: 176 QYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXX 235
            YW     V    W+TIFL V+  +N            W +  K+               
Sbjct: 163 TYWT--TVVPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFW 220

Query: 236 XXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAY-LGIELTGIVAA 294
              P HDRLGFRYW+ PG+F  +    TG+TGRF+   +  +   +A+ LG EL  + ++
Sbjct: 221 GGGPSHDRLGFRYWQKPGAFAYH--ITTGNTGRFLDVWTGVIKGGFAFILGPELVAVTSS 278

Query: 295 EAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLI-XXXXXXXXXXXXPFVV 353
           EA + R++I KA +   YR++ FY+ S   +G+ VA +DP+L              PFV+
Sbjct: 279 EAMDQRRNIEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVI 338

Query: 354 AIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPY 413
           AI N+ I  LPHIINAC+L   +S+ NS ++ +SRSL S+A D  APK+F K NR G+PY
Sbjct: 339 AIQNAHIKILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPY 398

Query: 414 YALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGV- 472
            A++VS  F  LAY+ VSS SAK F +F N+ +I G + WI I + Y+ F +A+  +G+ 
Sbjct: 399 NAVAVSAAFSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGLY 458

Query: 473 DKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYF 532
           D+  F   +PFQPYG +F +    +I L   +  F+   +   +F+  YI LPVF   + 
Sbjct: 459 DRVPFK--SPFQPYGTYFFIIVVSIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLWV 516

Query: 533 GYKF---TYKTKVIDPLKVDLYTFKAAIDQEEED 563
           G+K    T  T VI   +VD+ T  A I++  ++
Sbjct: 517 GHKIYTRTLSTWVIPVAEVDVTTGLAEIEELTKE 550

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  301 bits (771), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 177/553 (32%), Positives = 285/553 (51%), Gaps = 20/553 (3%)

Query: 32  QEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXX 91
           +  +++  DLE      SS +   + N D K EG +L++ L ARH+ +            
Sbjct: 21  KTGQVLEIDLESLTPEGSSTNRGINGNKDAKLEG-KLQQGLSARHIQLIALGGAIGTGLF 79

Query: 92  XXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSYAS------RYCD 145
                      P    I+Y  +  +++  M   GEM  Y+P +G  S  S      RY D
Sbjct: 80  VGTSSTLHTCGPAGLFISYVIISTVLYPIMNAFGEMVCYLPGNGDDSAGSVSHLVDRYVD 139

Query: 146 PALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXX 205
           P+L FA G+ Y + Y IL   + TAA+ V++YW D   V    W+TIFL ++V +N    
Sbjct: 140 PSLSFATGWNYFYCYVILVAAECTAASGVVKYWTDA--VPTAAWITIFLSIVVLLNLCAV 197

Query: 206 XXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGD 265
                   W +S KV                  P+HDRLGFRYW++PG F  +     G+
Sbjct: 198 KYYGETEFWFASIKVLCIVGLIILSFILFWGGGPNHDRLGFRYWKNPGGFAHH--ITGGN 255

Query: 266 TGRFVAFVSVFVYATYAY-LGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFL 324
            G F+   S  +   +A+ LG EL  + ++E ++ R++I KA K  ++R++ FY++    
Sbjct: 256 LGNFLDVYSGIIKGAFAFILGPELIALASSECKDQRRNIMKASKRFVWRLMFFYILGALS 315

Query: 325 LGMCVAYDDPLLIXXXXXXX-XXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDL 383
           + + VA +DP L              PFV+ I N+GI  LPHIINAC+L   +SA N+ +
Sbjct: 316 ISVIVASNDPALTSALASGKPGAGSSPFVIGIQNAGIKILPHIINACILTSAWSAGNAFM 375

Query: 384 YVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVN 443
           + SSRSL ++A + +APKIF K NR+G+P+ A++ S L   LAY+ VSS++A +F +F N
Sbjct: 376 FASSRSLLTMASNGQAPKIFGKINRFGVPWVAVTFSALISCLAYLNVSSSTADVFAWFTN 435

Query: 444 VVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKN 503
           + +I G + W   L+ Y+ F +A++  G++ +   Y   FQ Y  W+S+    L+     
Sbjct: 436 ISTISGFIGWDCGLVAYLRFRKAIKYNGLE-NRLPYAPRFQQYMVWWSILVVTLVIFTNG 494

Query: 504 FTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYK--TKVIDPL-KVDLYTFKAAIDQE 560
           + VF+   ++  +FI  YI LP+F   + G+K   +   K   P+ ++D+ T    + + 
Sbjct: 495 YQVFIPRFWNVSDFIAAYITLPLFVVLWIGHKIYTRDFKKWWYPVEEIDVVT---GLTEI 551

Query: 561 EEDGKMADAEKAE 573
           EE  ++ D E+ E
Sbjct: 552 EERTRILDEERVE 564

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  300 bits (767), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 176/546 (32%), Positives = 274/546 (50%), Gaps = 12/546 (2%)

Query: 34  EELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXX 93
           E     D    I   S  ++  S    G  + T++K+ALK RH+SM              
Sbjct: 8   EATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFIS 67

Query: 94  XXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAV 152
                    PV  LIAY F+G L +     LGEMAT+IP+   FT +  R+  PALG A 
Sbjct: 68  ISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSAN 127

Query: 153 GYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXX 212
           GY Y   + I    +L+    +IQ+W D   +    W+ IF V++   N           
Sbjct: 128 GYLYWLSWAITFALELSVVGQIIQFWTDAVPLT--AWIAIFWVILTISNLFPVKYYGEVE 185

Query: 213 XWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAF 272
            W++  KV                       +GFRYWR+PG +     +   + GRF+ +
Sbjct: 186 FWIACIKVLAIVGFIIYAFIMVCGAG-KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGW 244

Query: 273 VSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYD 332
           VS  + A + Y G EL GI A EA NPRK++P+AI    +RI+ FY++S+  +G+ V ++
Sbjct: 245 VSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLVPFN 304

Query: 333 DPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYS 392
           DP L             PFV+AI NSG   LPHI NA +L  + SA NS++YV SR  YS
Sbjct: 305 DPKL---KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYS 361

Query: 393 LAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILS 452
           +A++  APK    T + GIPY A+  + +   LAY+  SS ++ +FN+ +N+ ++ G  +
Sbjct: 362 MAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFT 421

Query: 453 WISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQF 512
           WI I I++I F +A++ QG+ +    + A F P+GA+++ FF  +I +I+ FT F   +F
Sbjct: 422 WILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAF-APKF 480

Query: 513 DYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKA 572
              +F T YI + +FF  + G++  ++     PL +         D+ E D  + + +K 
Sbjct: 481 KVSDFFTAYISVMLFFVFWIGFQIWFR----GPLFIKTEDIDLDTDRREIDDVVWEEQKP 536

Query: 573 ERIKQN 578
             + + 
Sbjct: 537 RNLWEK 542

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  301 bits (770), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 188/571 (32%), Positives = 290/571 (50%), Gaps = 32/571 (5%)

Query: 34  EELINDDLERNI--SSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXX 91
           E+L  D  +  I  S  SS DE      +   E  +LK+ LK+RHV +            
Sbjct: 37  EQLTKDKHKETIDYSETSSLDEEKQQQPE---ENGKLKQGLKSRHVQLIALGGTIGTGLL 93

Query: 92  XXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSYAS------RYCD 145
                      P     +Y  +   ++  M   GEM  Y+P +G  S  S      +Y D
Sbjct: 94  VGSSQTLATCGPAGLFTSYLIICTFIYPIMNAFGEMVCYLPGNGSDSAGSSAYLVEKYVD 153

Query: 146 PALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXX 205
            +LGFA  + Y + + IL   + TAAA V++YW    KV  G W+TIFL  +V++N    
Sbjct: 154 RSLGFASSWNYYYCFVILVATECTAAAGVVEYWAWALKVPKGAWITIFLFCVVALNMLPV 213

Query: 206 XXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGD 265
                   W +S K+                  P HDRLGFRYW+ PG+F ++    TG 
Sbjct: 214 NFYGESEFWFASIKILCILGLIILSFILFWGGGPSHDRLGFRYWQRPGAFADHITDGTG- 272

Query: 266 TGRFVAFVSVFVYATYAY-LGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFL 324
            G F+   +  +   +A+ LG EL  + ++E  + R++I KA +  ++R++IFY++    
Sbjct: 273 -GNFLDVYTGVIKGGFAFVLGPELVSLTSSECHDQRRNIAKASRRFVWRLMIFYVLGSLS 331

Query: 325 LGMCVAYDDP-LLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDL 383
           + + VAY+DP L              PFV+ I N+GI  LPHIIN C++   +SA N+ +
Sbjct: 332 ISVIVAYNDPNLQNALAQSKPGAGSSPFVIGIQNAGIKVLPHIINVCIMTSAWSAGNAYM 391

Query: 384 YVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVN 443
           + SSRSL ++A    APK F+K NR+G+PY A+  S LFC LAY+ VSS++A +FN+F N
Sbjct: 392 FASSRSLLTMASHGHAPKFFSKINRFGVPYVAVGFSFLFCCLAYLNVSSSTANVFNWFSN 451

Query: 444 VVSIFGILSWISILITYICFDRAVRAQGV-DKSTFAYVAPFQPYGAWFSLFFCCLIALIK 502
           + +I G + WI   + YI F +A+    + D+  +   A  Q Y  W+SLF   LI L  
Sbjct: 452 ISTISGFIGWICACVAYIRFRKAIIFNDLYDRLPYKGFA--QKYLIWYSLFMVSLITLTN 509

Query: 503 NFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKF---TYKTKVIDPLKVDLYTFKAAIDQ 559
            + +F+   +DYK+FI  YI LPVF   + G+K    +++   I   K+D++T    +++
Sbjct: 510 GYQIFIPRFWDYKDFIAAYITLPVFIVLWIGHKLVTRSWRQWYIPVDKIDVFT---GLEE 566

Query: 560 EEEDGKMADAEKAERIKQNGKNFEWFYDKFL 590
            EE   + +    +R+  N       +DKFL
Sbjct: 567 IEE---LTNELDEKRVPPNNA-----WDKFL 589

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  301 bits (770), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 180/515 (34%), Positives = 272/515 (52%), Gaps = 21/515 (4%)

Query: 68  LKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEM 127
           LKK L++RH+ +                       P   L +Y  + L+++  M  LGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 128 ATYIPLDGFTSYAS------RYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDK 181
             ++P     S  S      RY DP+LGFA G+ Y + Y IL   + TAA+ V+ YW   
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTA 224

Query: 182 EKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDH 241
             V  G W+ IFL V+  +N            W +  K+                  P H
Sbjct: 225 --VPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTH 282

Query: 242 DRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAY-LGIELTGIVAAEAQNPR 300
           DRLGFRYW+HPG+F  +    TG+TGRF+   +  +   +A+ LG EL  I ++EA + R
Sbjct: 283 DRLGFRYWQHPGAFAYH--ITTGNTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDAR 340

Query: 301 KSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLI-XXXXXXXXXXXXPFVVAIINSG 359
           ++I KA +   YR+V FY+ S   +G+ V+  DP+L              PFV+AI N+ 
Sbjct: 341 RNIEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAH 400

Query: 360 INALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVS 419
           I  LPHIINAC+L   +S+ NS ++ +SRSL S+A D  AP+I  + NR G+PYYA+++S
Sbjct: 401 IKVLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALS 460

Query: 420 VLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAY 479
             F  LA++ VSS SAK F +F N+ +I G + WI I + Y+ F +AV  +G+ +    +
Sbjct: 461 AAFSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGLYERV-PF 519

Query: 480 VAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKF--- 536
            +P QPYG +F +    LI L   +  F+N  ++  +F+  YI LP+F   + G+K    
Sbjct: 520 KSPLQPYGTYFFIVVVSLICLTNGYASFVN--WNASDFVAAYITLPIFVVLWVGHKIYTR 577

Query: 537 TYKTKVIDPLKVDLYTFKAAIDQEEEDGKMADAEK 571
           T+ T ++   +VD+ T  A I   EE+ K+ DA++
Sbjct: 578 TWSTWLLPVAEVDVTTGLAEI---EEETKILDAQR 609

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  302 bits (774), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 180/573 (31%), Positives = 281/573 (49%), Gaps = 21/573 (3%)

Query: 3   IRQIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGK 62
           + Q+  + +S     ++E       ++   E+   N     N +     D   S + DG 
Sbjct: 100 VVQVTESPSSGSRTHHYEAEKDDAIRM---EKISKNQSASSNGTVREELDLEKSPSADGD 156

Query: 63  TEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMA 122
               RLK+ L++RHV +                       P    I+Y  +  +++  M 
Sbjct: 157 AGPHRLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMC 216

Query: 123 CLGEMATYIPLDGFTSYAS------RYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQ 176
            LGEM  ++P DG  S  S      RY D +LGFA G+ Y + Y IL   + TAA+ V++
Sbjct: 217 ALGEMVCFLPGDGSDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASGVVE 276

Query: 177 YWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXX 236
           YW     V  GVW+TIFL V+V +N            W +S K+                
Sbjct: 277 YWT--TAVPKGVWITIFLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWG 334

Query: 237 XXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAY-LGIELTGIVAAE 295
             P HDRLGFRYW+HPGSF  +     G  G F    +  +   +A+ LG EL  + +AE
Sbjct: 335 GGPKHDRLGFRYWQHPGSFAHH--LAGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAE 392

Query: 296 AQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXX-XXXXXPFVVA 354
             + R++I KA +  ++R++ FY++    + + V Y+DP L+             P+V+ 
Sbjct: 393 CADQRRNIAKASRRFVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIG 452

Query: 355 IINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYY 414
           I N+GI  LPHIIN C+L   +SA N+ ++ S+RSL ++A   +APK   K NR+G+PY 
Sbjct: 453 IQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYV 512

Query: 415 ALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGV-D 473
           A+ VS L   LAY+ VSS++A +FN+F N+ +I G L WI   I Y+ F +A+   G+ D
Sbjct: 513 AVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGLYD 572

Query: 474 KSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFG 533
           +  F      QPY  WFSL    +I +   + +F+   ++  +FI  YI LP+F   + G
Sbjct: 573 RLPFKTWG--QPYTVWFSLTVVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLG 630

Query: 534 YKF---TYKTKVIDPLKVDLYTFKAAIDQEEED 563
           +K    T+        ++D+ T    I+++  D
Sbjct: 631 HKLYTRTWNHWWHSVSEIDVTTGLVEIEEKSRD 663

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  300 bits (767), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 186/581 (32%), Positives = 300/581 (51%), Gaps = 34/581 (5%)

Query: 5   QIPSNSTSDQYEEYFEQLPKKEFK-------LPIQEEELI-------NDDLERNISSASS 50
            I +NST  +  E  E +    FK       + +++ +L          +L ++  + S 
Sbjct: 28  SIGNNSTMKENNEVIELINTNSFKDSSDKPPITLRKSKLSEIGSLHSGSNLHQH-GTTSL 86

Query: 51  QDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAY 110
            D+ +S   + + + TR+K+ALK RH+ M                       PV +LIAY
Sbjct: 87  HDDEESDTEEAQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAY 146

Query: 111 AFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLT 169
            F+G +V+F    LGEMAT+IP+    T ++ R+  PA G A GY Y F + I    +++
Sbjct: 147 IFMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIS 206

Query: 170 AAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXX 229
               VIQYW   + V    W+ IF V++  +N            W++S KV         
Sbjct: 207 VIGQVIQYWT--KAVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIY 264

Query: 230 XXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTG--RFVAFVSVFVYATYAYLGIE 287
                         +GFRYWR+PG +      I+  TG  RF+ +VS  + A + Y G E
Sbjct: 265 ALIIVCGGS-HQGPIGFRYWRNPGPWGP--GIISDKTGEARFLGWVSSLINAAFTYQGTE 321

Query: 288 LTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXX 347
           L GI A EA NPRKS+P+AI   ++RI +FY++S+F +G+ V ++D  L           
Sbjct: 322 LVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPFNDDRL---ANDSAVIA 378

Query: 348 XXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTN 407
             PFV++I N+G  ALP I NA VL+ + SA NS++YV SR LY+LA+   APKIF+   
Sbjct: 379 SSPFVISIQNAGTRALPDIFNAVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVT 438

Query: 408 RWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAV 467
           ++G+PY  +  +    LLA++ V++ +   FN+ +N+ ++ G+ +W+ I +++I F +A+
Sbjct: 439 KYGVPYMGVICTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQAL 498

Query: 468 RAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGL--- 524
           + +G+ +    + A   P+GA+++ FF  +I  I+ F  F   +FD   F T YI L   
Sbjct: 499 KYRGISRDDLPFKAKLMPWGAYYASFFVTVIIFIQGFQAF-TPKFDVSTFFTSYISLILL 557

Query: 525 -PVFFFC--YFGYKFTYKTKVIDPLKVDLYTFKAAIDQEEE 562
             +F  C  Y+  +F +K + ID +  D    +A I +E+E
Sbjct: 558 AVLFSGCQLYYRCRFIWKVEDID-IDSDRREIEAIIWEEDE 597

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  298 bits (763), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 180/557 (32%), Positives = 285/557 (51%), Gaps = 29/557 (5%)

Query: 4   RQIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKT 63
           R   S+ +SD          +KE K    E   IN   + N+S   S   ND  ++    
Sbjct: 19  RSAESSESSDVLHH------RKETK---NEGIFIN---QENMSEVESLYGNDDPDV---- 62

Query: 64  EGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMAC 123
                K+ LK RH+SM                       PV +L+AY F+G + F     
Sbjct: 63  -----KRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117

Query: 124 LGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKE 182
           LGEMAT+IP+   FT Y  R+  PALG A GY Y F + +    +L+    +IQYW    
Sbjct: 118 LGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWT--F 175

Query: 183 KVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHD 242
            V   VW+ +F +++ + N            W+++ KV                   +  
Sbjct: 176 AVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSE-G 234

Query: 243 RLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKS 302
            LGFRYW++PG +     +      RF+ +VS  + A + Y G EL GI A E++NPRK+
Sbjct: 235 ALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKT 294

Query: 303 IPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINA 362
           +PKAI    +RI+ FY++S+F +G+ V Y DP L             PFV+AI NSG   
Sbjct: 295 VPKAINKVFFRILFFYILSLFFVGLLVPYTDPRL--STTSDSDINTSPFVMAIQNSGTKV 352

Query: 363 LPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLF 422
           LP + N  +LV + SA NS++Y+ SR LY L+    AP +F KTN+ G+P+YA+  S +F
Sbjct: 353 LPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIF 412

Query: 423 CLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAP 482
             LAY+ +S  + K+F++ + + ++ G  +W+ I +++I F + ++ +G+ ++   + A 
Sbjct: 413 GCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAK 472

Query: 483 FQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKV 542
           F P+GA+++ FF  +I LI+ F  F   +F +  FI  YI + +F  C+ G++  +KT++
Sbjct: 473 FMPWGAYYAAFFITVIILIQGFDSF-APEFVFSEFIADYISVFLFIVCWLGFQVLFKTRL 531

Query: 543 I-DPLKVDLYTFKAAID 558
           I     VD+ T +  ID
Sbjct: 532 ILRKEDVDIDTDRREID 548

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  296 bits (759), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 169/514 (32%), Positives = 264/514 (51%), Gaps = 14/514 (2%)

Query: 37  INDDLERNISSAS------SQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXX 90
           ++  LE  +SS +      S D       +G    T +K+ALK RH+SM           
Sbjct: 19  VSKKLEDYVSSETLPIYSHSGDNAPCEKGEGDCRETEVKRALKPRHISMIALGGTIGTGL 78

Query: 91  XXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALG 149
                       PV  LIAY F+G +V+F    LGEMAT+IP+    T ++ R+  PA G
Sbjct: 79  FVGIASPLSESGPVGALIAYIFIGSIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFG 138

Query: 150 FAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXX 209
            A GY Y F + I    ++     VIQYW D   V    W+ IF V++   N        
Sbjct: 139 VANGYMYWFNWAITYAVEIAVVGQVIQYWTDA--VPLAAWIAIFWVLVTLANFFPVKFYG 196

Query: 210 XXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRF 269
               W++S KV                       +GFRYWR+PG +     +   + GRF
Sbjct: 197 EVEFWVASVKVIAIVGYLIYALVIVCGGS-HQGPIGFRYWRNPGPWGPGIISKDVNEGRF 255

Query: 270 VAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCV 329
           + +VS  + A + Y G EL GI A EA NPRK++P+AI    +RI+ FY++S+F +G+ V
Sbjct: 256 LGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLFFIGLLV 315

Query: 330 AYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRS 389
            YDD   +            PFV++I N+G   LPHI NA V++ + SA NS++YV SR 
Sbjct: 316 PYDD---LRLSNTTAVIASSPFVISIQNAGTKVLPHIFNAIVMITIISAANSNVYVGSRV 372

Query: 390 LYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFG 449
           LYSLA+   APK F    + G+PY  + V+ L  LLA++ V++ + + FN+ VN+ ++ G
Sbjct: 373 LYSLALSGNAPKQFGYVTKQGVPYLGVIVTALLGLLAFLVVNNNANEAFNWLVNISTLAG 432

Query: 450 ILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLN 509
           + +W+ I ++++ F + ++ +G+ +    + A   P+GA+++ FF  +I +I+ F  F  
Sbjct: 433 LCAWLFISLSHVRFMQCLKHRGISREDLPFKAKLMPWGAYYAAFFIGVIIIIQGFKAF-T 491

Query: 510 HQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVI 543
            +F   +F T YI L +    + G +  Y+ + I
Sbjct: 492 PKFRVSDFFTSYISLILLAVLFLGCQLFYRCRFI 525

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  297 bits (760), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 175/497 (35%), Positives = 264/497 (53%), Gaps = 13/497 (2%)

Query: 66  TRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLG 125
           TR+K+ALK RH+ M                       PV  LIAY F+G +++F    LG
Sbjct: 89  TRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQSLG 148

Query: 126 EMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKV 184
           EMAT+IP+    T ++ R+  PA G A GY Y F + I    +++    VIQYW    KV
Sbjct: 149 EMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWT--FKV 206

Query: 185 NPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRL 244
               W+ IF V+I  +N            W++S KV                       +
Sbjct: 207 PLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGS-HQGPI 265

Query: 245 GFRYWRHPGSFKEYSETITGDTG--RFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKS 302
           GFRYWR+PG+    +  I+ D G  RF+ +VS  + A + Y G EL GI A EA NPRKS
Sbjct: 266 GFRYWRNPGAMG--AGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 323

Query: 303 IPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINA 362
           +P+AI   ++RIV+FY++S+F +G+ V Y+DP L             PFV++I N+G   
Sbjct: 324 VPRAINKVVFRIVLFYIMSLFFVGLLVPYNDPRL---SASSAVIASSPFVISIQNAGTKV 380

Query: 363 LPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLF 422
           LP I NA VLV V SA NS++YV SR LY+LA    APK FA   R G+PY  +  + L 
Sbjct: 381 LPDIFNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALL 440

Query: 423 CLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAP 482
            LLA++ V+  +   FN+ +N+ ++ G+ +W+ I + +I F +A++ +G+ +    + A 
Sbjct: 441 GLLAFLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAK 500

Query: 483 FQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKV 542
           F P+GA+++ FF  +I  I+ F  F   +FD   F T YI L +    + G +  Y+ + 
Sbjct: 501 FMPWGAYYASFFVTVIIFIQGFQAF-APKFDVSEFFTAYISLILLVVLFAGCQLYYRCRF 559

Query: 543 IDPLK-VDLYTFKAAID 558
           +  L+ +D+ + +  ID
Sbjct: 560 LWKLEDIDIDSDRREID 576

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  294 bits (752), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 192/558 (34%), Positives = 289/558 (51%), Gaps = 28/558 (5%)

Query: 14  QYEEYFEQLPKKEFKLPIQEEE--LINDDLERN--ISSASSQDENDSYNIDGKTEGTRLK 69
           Q  E   QL K E K+  + E   L +  LE+   I +ASSQ+               ++
Sbjct: 4   QSFEKQPQLHKNEIKVMEEGESSSLADGVLEQQSQIDTASSQERG-------------IQ 50

Query: 70  KALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMAT 129
           +ALK RHVSM                       PV +LI+Y F+G L FF    LGEMAT
Sbjct: 51  RALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQSLGEMAT 110

Query: 130 YIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGV 188
           +IP+   FT +  R+  PALG A GY Y F + I    +L+    +IQYW     V    
Sbjct: 111 FIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWT--LGVPNAA 168

Query: 189 WVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRY 248
           W+ IF V I   N            W++  KV                       +GFRY
Sbjct: 169 WIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAG-KTGPVGFRY 227

Query: 249 WRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIK 308
           WR+PG + +   + +   GRF+ +VS  V A + Y G EL G+ A E+ NPRK++PKAI+
Sbjct: 228 WRNPGPWGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTVPKAIR 287

Query: 309 LTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIIN 368
               RI++FY+ S+F +G+ V ++DP L             PF++AI NSG  ALP I N
Sbjct: 288 KVFLRILLFYVGSLFFIGLLVPFNDPKL---DSTANYSASSPFIIAIQNSGTRALPDIFN 344

Query: 369 ACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYM 428
           A +L  + SA NS++YV SR LY LA +  APKI  + NR G+PY  + +  LF  L Y+
Sbjct: 345 AVILTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLGYL 404

Query: 429 CVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGA 488
            VSS SAK F++ +N+ +I G  +W+ I + +I F +A++ QG+ +    + A   P+GA
Sbjct: 405 SVSSGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGA 464

Query: 489 WFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLK- 547
           +++ FF  LI +I+ FT F   +F+  NF   Y+ + +F   +  ++  +K+++I  ++ 
Sbjct: 465 YYAAFFILLIIIIQGFTAF-APKFNVSNFFAAYVSVFLFIAVWVIFQVIFKSRLIHKVED 523

Query: 548 VDLYTFKAAIDQE--EED 563
           VD+ + +  I+ E  E+D
Sbjct: 524 VDIDSDRREIEAEVWEDD 541

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  295 bits (756), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 170/510 (33%), Positives = 269/510 (52%), Gaps = 15/510 (2%)

Query: 66  TRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLG 125
           T++K+ALK RH+ M                       PV +LIAY F+G +++F    LG
Sbjct: 91  TQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQSLG 150

Query: 126 EMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKV 184
           EMAT+IP+    T ++ R+  PA G A GY Y F + I    +++    VI+YW DK  V
Sbjct: 151 EMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDK--V 208

Query: 185 NPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRL 244
               W+ IF V+I  +N            W++  KV                       +
Sbjct: 209 PLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGG-SSQGPI 267

Query: 245 GFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIP 304
           GFRYWR+PG +     +   +TGRF+ +VS  + A + Y G EL GI A EA NPRK++P
Sbjct: 268 GFRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 327

Query: 305 KAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALP 364
           +AI   ++RI +FY++S+F +GM V Y+D  L             PFV++I N+G   LP
Sbjct: 328 RAINKVVFRIALFYIMSLFFIGMLVPYNDERL---ASTSAVIASSPFVISIQNAGTKVLP 384

Query: 365 HIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCL 424
            I NA V++ + SA NS++YV SR LY+LA+   APK FA   R+G+PY  + V+    L
Sbjct: 385 DIFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGL 444

Query: 425 LAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQ 484
           LA++ V++ +   FN+ +N+ ++ G+ +W+ I I++I F +A++ +G+ +    + A   
Sbjct: 445 LAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLM 504

Query: 485 PYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFG------YKFTY 538
           P+GA+++ FF  +I  I+ F  F  H +D   F T YI L +    + G       +F +
Sbjct: 505 PFGAYYATFFVTVIIFIQGFQAFSPH-WDTTAFFTSYISLIILAVLFIGCQIFYRCRFFW 563

Query: 539 KTKVIDPLKVDLYTFKAAIDQEEEDGKMAD 568
           + + ID +  D    +A I +++E   + D
Sbjct: 564 RVEDID-IDSDRREIEAVIWEDDEPKTLWD 592

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  294 bits (752), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 177/553 (32%), Positives = 285/553 (51%), Gaps = 22/553 (3%)

Query: 37  INDDLERNISSASSQDENDSYN-----IDGKTEGTR-----LKKALKARHVSMXXXXXXX 86
           +  +LE++ S    + + ++Y+     ++ + EGT+     L+K L +RH+ +       
Sbjct: 5   LKANLEKDTSFYDVKSQGETYSGTLNQLESQLEGTKCDENNLEKGLSSRHIQLIALGGCI 64

Query: 87  XXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRYCD 145
                           P+   +++  +  +V+  M  L EM  Y+P  G      SRY D
Sbjct: 65  GTGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMNTLAEMICYLPQQGTVPELTSRYVD 124

Query: 146 PALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXX 205
           P+LGFA G+ Y + Y IL   +L+AAA V+QYW DK  V+  VW+TIFLV++V +N    
Sbjct: 125 PSLGFAAGWNYAYSYSILVATELSAAAGVVQYWTDK--VHVAVWITIFLVIVVGLNFAPV 182

Query: 206 XXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGD 265
                   W +S K+                  P HDRLGFRYW +PG F  +     G+
Sbjct: 183 KFYGESEFWFASLKIICILGLLIVSIVIFFGGAPSHDRLGFRYWNNPGPFAYH--ITGGN 240

Query: 266 TGRFVAFVSVFVYATYAY-LGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFL 324
           TGRF+   +  + + +A+ L  EL G+   EA++ R++I KA +  ++RI+ FY+ S   
Sbjct: 241 TGRFLDIWTAIIKSGFAFILSPELIGLACVEAKDTRRNIEKASRRFIWRIIFFYITSTLC 300

Query: 325 LGMCVAYDDPLLIXXXXXXX-XXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDL 383
           +G  ++ DDP LI             PFV  I N+GI  L HIINA +L   +S+ NS +
Sbjct: 301 IGFILSRDDPKLIQALTSDAPGAASSPFVQGISNAGIPVLNHIINAVILSSAWSSANSFM 360

Query: 384 YVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVN 443
           Y SSRS+ +LA    APK+F + NR G+PY A+++S     L Y+  SS+SA++F +  N
Sbjct: 361 YASSRSILALAKQGDAPKVFTRINRLGVPYNAVALSTAVSCLTYLNASSSSAQVFTWLSN 420

Query: 444 VVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKN 503
           + +I G + W  I ITY+ F +A+    + +    + +  QPY  +F + F  L+ L   
Sbjct: 421 ICTISGFIGWALIGITYLRFRKAIFYNNLYERV-PFKSALQPYFTYFFVVFVVLLCLTNG 479

Query: 504 FTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLK-VDLYTFKAAIDQEEE 562
           +  F+   ++  +F+  YI LP+FF  Y G+K  +KT+   P + +D+ T    +   EE
Sbjct: 480 YATFIPKYWNASDFVAAYITLPIFFLLYLGHKIWFKTRWYIPFREIDVIT---GLADAEE 536

Query: 563 DGKMADAEKAERI 575
           + KM      + +
Sbjct: 537 EAKMTQPRTPKNM 549

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  295 bits (755), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 174/540 (32%), Positives = 276/540 (51%), Gaps = 17/540 (3%)

Query: 38  NDDLERNISSAS-----SQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXX 92
            D+  R +S  S     S + +  Y  +G  +   +K+ALK RH+SM             
Sbjct: 47  TDEKTRVVSQVSPMRTGSPNVSIDYMDEGNVQDAEVKRALKPRHISMIALGGTIGTGLFI 106

Query: 93  XXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFA 151
                     PV  LIAY F+G + +F    LGEMAT+IP+   FT +  R+  PA G A
Sbjct: 107 GISSPLADAGPVGALIAYMFMGTIAYFVTQSLGEMATFIPVTSSFTVFTQRFLSPAFGVA 166

Query: 152 VGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXX 211
            GY Y F + I    +L+    +IQ+W     V  G W+ IF V++ + N          
Sbjct: 167 NGYLYWFSWCITFALELSVVGQIIQFWT--FAVPLGAWIAIFWVILTTSNLFPVKYYGEV 224

Query: 212 XXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVA 271
             W++  KV                       +GFRYWR+PG +     +   + GRF+ 
Sbjct: 225 EFWIACIKVLAIVGFIIYAFIMVCGAG-KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLG 283

Query: 272 FVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAY 331
           +VS  + A + Y G EL GI A E++NPR+++P+AI    +RI+ FY++S+  +G+ V +
Sbjct: 284 WVSSLINAAFTYQGTELVGITAGESKNPRRTVPRAINKVFFRILFFYILSLLFIGLLVPF 343

Query: 332 DDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLY 391
           +DP L             PFV+AI NSG   LPHI NA +L  + SA NS++YV SR LY
Sbjct: 344 NDPKL---KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVLY 400

Query: 392 SLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGIL 451
            LA +  APK+FA+  + G+PY ++  +  F  LAY+ +S+++ K+F++ +N+ +I G  
Sbjct: 401 GLAKNKLAPKVFARATKDGVPYISVLGTAAFGFLAYLNLSNSAQKVFDWLLNITAIAGFF 460

Query: 452 SWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQ 511
           +W+ I + +I F + ++ + + ++   + A F P+GA++S FF  LI +I+ FT F   +
Sbjct: 461 AWLFISLAHIRFMQVLKDRNMSRNDLPFKAKFMPWGAYYSAFFISLIIIIQGFTAFA-PK 519

Query: 512 FDYKNFITGYIGLPVFFFCYFGYKFTYKTKVI----DPLKVDLYTFKAAIDQEEEDGKMA 567
           F+  NF   YI + +F   +  ++  ++T+ I    D            I  EEE  K A
Sbjct: 520 FNVSNFFAAYISVFLFLAIWVVFQIRFRTRFILTKNDVDIDTDRRDIDCIVWEEETPKNA 579

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  295 bits (755), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 176/542 (32%), Positives = 279/542 (51%), Gaps = 24/542 (4%)

Query: 44  NISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXP 103
           ++ S SS  E  S +    T G  LK+ LK+RHV +                       P
Sbjct: 52  DVFSLSSSTEKHSPHYTDMT-GHELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGP 110

Query: 104 VSTLIAYAFVGLLVFFTMACLGEMATYIPL-----DGFTSY-ASRYCDPALGFAVGYAYL 157
               I+Y  +  +++  M  +GEM  Y+P      +GF +Y   +Y D +LGFA  + Y 
Sbjct: 111 AGLFISYCIISSVIYPIMQGIGEMVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYY 170

Query: 158 FKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSS 217
           + Y IL   + TAA+ V++YW     V    W+TIFL  +V +N            W +S
Sbjct: 171 YCYVILVAAECTAASGVVEYWTTS--VPKAAWITIFLAAVVILNFTAVKFYGESEFWFAS 228

Query: 218 FKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFV 277
            K+                  P+HDRLGFRYW++PG F  +     G  G F+   +  +
Sbjct: 229 IKILCIVGLIILSFILFWGGGPNHDRLGFRYWQNPGGFAHHIRG--GSFGSFLDIYTGII 286

Query: 278 YATYAY-LGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLL 336
              +A+ LG E+  + ++E ++ R++I KA +  ++R++ FY++    + + VAY+DP L
Sbjct: 287 KGGFAFILGPEMIAMTSSEVEDQRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPAL 346

Query: 337 IXXXXXXX-XXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAI 395
                         PFV+ I N+GI  LPHIINAC+L   +SA N+ ++ SSRSL ++A 
Sbjct: 347 ENALAQNKPGAGSSPFVIGIQNAGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQ 406

Query: 396 DNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWIS 455
           + +AP+IFAK NRWG+PYYA+ +S     LAY+  SS++A +FN+F N+  I G + WI 
Sbjct: 407 NGQAPRIFAKVNRWGVPYYAVGLSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWIC 466

Query: 456 ILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYK 515
           + I YI F +A+   G+ +S   Y A   PY  ++ L    +I L   + VF+   +D K
Sbjct: 467 VCIAYIRFHKAILFHGM-QSRLPYTARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAK 525

Query: 516 NFITGYIGLPVFFFCYFGYKFTYKTKVI------DPLKVDLYTFKAAIDQEEEDGKMADA 569
           NF+  YI LPVF+  + G++  Y+ K+          ++D+ T    +++ EE  +  DA
Sbjct: 526 NFVAAYITLPVFWVLWIGHR-VYRRKIFTLKWWKSIEEIDVVT---GVEEIEEKTRECDA 581

Query: 570 EK 571
            +
Sbjct: 582 SR 583

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  296 bits (757), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 173/519 (33%), Positives = 267/519 (51%), Gaps = 27/519 (5%)

Query: 31  IQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXX 90
           I EE +++ DLE++ S+            DG  E  +LK+ L++RHV +           
Sbjct: 80  IHEELVMDVDLEKSPSA------------DGDNEPRKLKQGLQSRHVQLIALGGAIGTGL 127

Query: 91  XXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSYAS------RYC 144
                       P    I+Y  +  +++  M  LGEM  ++P DG  S  S      RY 
Sbjct: 128 LVGTSSTLHTCGPGGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYV 187

Query: 145 DPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXX 204
           D +LGFA G+ Y + Y IL   + TAA+ V++YW     V  GVW+T+FL+V+V +N   
Sbjct: 188 DASLGFATGWNYFYCYVILVAAECTAASGVVEYWT--TAVPKGVWITVFLLVVVLLNFSA 245

Query: 205 XXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITG 264
                    W +S K+                  P HDRLGFRYW+HPG+F  +     G
Sbjct: 246 VKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQHPGAFAHH--LTGG 303

Query: 265 DTGRFVAFVSVFVYATYAY-LGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIF 323
             G F    +  +   +A+ LG EL  + +AE  + R++I KA +  ++R++ FY++   
Sbjct: 304 SLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTL 363

Query: 324 LLGMCVAYDDPLLIXXXXXXX-XXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSD 382
            + + V Y+DP+L+             PFV+ I N+GI  LPHIIN C+L   +SA N+ 
Sbjct: 364 SISVIVPYNDPVLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAF 423

Query: 383 LYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFV 442
           ++ S+RSL ++A   +APK   K NRWG+PY A++ S L   LAY+ VSS++A +FN+F 
Sbjct: 424 MFASTRSLLTMAQTGQAPKCLGKINRWGVPYVAVAASFLCSCLAYLNVSSSTADVFNWFS 483

Query: 443 NVVSIFGILSWISILITYICFDRAVRAQGV-DKSTFAYVAPFQPYGAWFSLFFCCLIALI 501
           N+ +I G L WI   I Y+ F +A+   G+ D+  F      QPY  WFSL    +I + 
Sbjct: 484 NISTISGFLGWICGCIAYLRFRKAIFYNGLYDRLPFKTWG--QPYTVWFSLIVVSIITIT 541

Query: 502 KNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKT 540
             + +F+   +   +FI  Y+ LP+F   + G+K   +T
Sbjct: 542 NGYAIFIPKYWKVADFIAAYVTLPIFLVLWLGHKLYTRT 580

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  295 bits (756), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 188/567 (33%), Positives = 284/567 (50%), Gaps = 21/567 (3%)

Query: 7   PSNSTSD-QYEEYFEQLPKKEFKL---PIQEEELINDDLERNISSASSQDENDSYNIDGK 62
           PSN T+    +E      KK   L    I +   I + L R    +   D N+    +  
Sbjct: 42  PSNKTTPYSIDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEE-EAH 100

Query: 63  TEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMA 122
            E   +K+ALK RH+ M                       PV +LIAY F+G +V+F   
Sbjct: 101 YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTIVYFVTQ 160

Query: 123 CLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDK 181
            LGEMAT+IP+    T ++ R+  PA G + GY Y F + I    +++    VI+YW DK
Sbjct: 161 SLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTDK 220

Query: 182 EKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDH 241
             V    W+ IF V+I  +N            W++S KV                     
Sbjct: 221 --VPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALIIVCGGS-HQ 277

Query: 242 DRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRK 301
             +GFRYWR+PG++     +     GRF+ +VS  + A + Y G EL GI A EA NPRK
Sbjct: 278 GPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 337

Query: 302 SIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGIN 361
           ++P+AI   ++RIV+FY++S+F +G+ V Y+D  L             PFV++I N+G  
Sbjct: 338 TVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRL---SASSAVIASSPFVISIQNAGTY 394

Query: 362 ALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVL 421
           ALP I NA VL+ V SA NS++YV SR LYSLA    APK F    R G+PY  +  +  
Sbjct: 395 ALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAA 454

Query: 422 FCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVA 481
             LLA++ V++ +   FN+ +N+ ++ G+ +W+ I + +I F +A++ +G+ +    + A
Sbjct: 455 LGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGISRDDLPFKA 514

Query: 482 PFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGL----PVFFFC--YFGYK 535
              PYGA+++ FF  +I  I+ F  F    F    F T YI L     VF  C  Y+  +
Sbjct: 515 KLMPYGAYYAAFFVTVIIFIQGFQAFC--PFKVSEFFTSYISLILLAVVFIGCQIYYKCR 572

Query: 536 FTYKTKVIDPLKVDLYTFKAAIDQEEE 562
           F +K + ID +  D    +A I +++E
Sbjct: 573 FIWKLEDID-IDSDRREIEAIIWEDDE 598

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  295 bits (756), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 180/531 (33%), Positives = 276/531 (51%), Gaps = 11/531 (2%)

Query: 31  IQEEELINDDLERN-ISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXX 89
           I    LI + L R+ I+S    DE +    +   E   +K+ALK RH+ M          
Sbjct: 69  IASVNLITNSLPRSQIASHEVGDEEEDDEEEAHYEDKHVKRALKQRHIGMIALGGTIGTG 128

Query: 90  XXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPAL 148
                        PV +LI+Y F+G +V+F    LGEMAT+IP+    T ++ R+  PA 
Sbjct: 129 LFVGISTPLSKAGPVGSLISYIFMGTVVYFITQSLGEMATFIPVTSSITVFSKRFLSPAF 188

Query: 149 GFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXX 208
           G A GY Y F + I    +++    VIQYW DK  V   VW+ IF V+I  +N       
Sbjct: 189 GVANGYMYWFNWAITYAVEVSVIGQVIQYWTDK--VPLAVWIAIFWVLITLMNFFPVKVY 246

Query: 209 XXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGR 268
                W++S KV                       +GFRYWR+PG++     +   + GR
Sbjct: 247 GEFEFWVASVKVLAIMGYLIYALVIVCGGS-HQGPIGFRYWRNPGAWGPGIISSDKNEGR 305

Query: 269 FVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMC 328
           F+ +VS  + A + Y G EL GI A EA NPRK++P+AI   ++RIV+FY++S+F +G+ 
Sbjct: 306 FLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLL 365

Query: 329 VAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSR 388
           V Y++P L             PFV++I N+G  ALP I NA VL+ V SA NS++YV SR
Sbjct: 366 VPYNEPRL---SASSAVIASSPFVISIQNAGTYALPDIFNAVVLITVISAANSNVYVGSR 422

Query: 389 SLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIF 448
            LYSLA    APK F    + G+PY  +  +    LLA++ V++ +   FN+ +N+ ++ 
Sbjct: 423 VLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFLVVNNNANTAFNWLINISTLA 482

Query: 449 GILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL 508
           G+ +W+ I + +I F +A+  +G+ +    + A   PYGA+++ FF  +I  I+ F  F 
Sbjct: 483 GLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFC 542

Query: 509 NHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLK-VDLYTFKAAID 558
              F   +F T YI L +    + G +  YK + I  L+ +D+ T +  I+
Sbjct: 543 --PFKVSDFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDIDIDTDRREIE 591

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  295 bits (755), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 184/571 (32%), Positives = 290/571 (50%), Gaps = 29/571 (5%)

Query: 8   SNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNID------- 60
           +++T+ +Y+   +  P +  K  +   +L +D L  N+S A   D + + N D       
Sbjct: 29  ASNTNKKYDSDTDMEPSQRKKAAM-AGKLFSDQLSYNVSVA---DNSSAANGDLDLSDTE 84

Query: 61  --GKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVF 118
             G  + TR+K+ALK RH+ M                       PV  LIAY F+G +++
Sbjct: 85  EAGHVQDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSIIY 144

Query: 119 FTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQY 177
           F    LGEMAT+IP+    T ++ R+  PA G   GY Y F + I    +++    VIQY
Sbjct: 145 FITQSLGEMATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVIQY 204

Query: 178 WVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXX 237
           W D   V    W+ IF V +  +N            W++S KV                 
Sbjct: 205 WTDA--VPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGG 262

Query: 238 XPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQ 297
                 +GFRYWR+PG +     +   + GRF+ +VS  + A + Y G EL GI A EA 
Sbjct: 263 S-SQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAA 321

Query: 298 NPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIIN 357
           NPRKS+P+AI   ++RI +FY++S+F +G+ V Y+D  L             PFV++I N
Sbjct: 322 NPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYNDHTL---SSGDSYIASSPFVISIQN 378

Query: 358 SGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALS 417
           +G  ALP I NA V++ + SA NS++YV SR LY+LA    APK FA   + G+P+  + 
Sbjct: 379 AGTYALPDIFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVI 438

Query: 418 VSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTF 477
           V+    LLA++ V++ +   FN+ +N+ ++ G+ +W  I +++I F +A++ +G+ +   
Sbjct: 439 VTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDL 498

Query: 478 AYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGL----PVFFFC--Y 531
            + A   P+GA++S FF  +I  I+ F  F    +D   F T YI L     VF  C  Y
Sbjct: 499 PFKAKLMPWGAYYSAFFVFVIIFIQGFEAF--TPWDTTTFFTSYISLILLVVVFIGCQLY 556

Query: 532 FGYKFTYKTKVIDPLKVDLYTFKAAIDQEEE 562
           +  +F  K + ID +  D    +A I +++E
Sbjct: 557 YRCRFLLKVEDID-IDTDRREIEAIIWEDDE 586

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  294 bits (753), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 166/489 (33%), Positives = 259/489 (52%), Gaps = 9/489 (1%)

Query: 66  TRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLG 125
           TR+K+ALK RH+ M                       PV +LIAY F+G +V+F    LG
Sbjct: 65  TRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIVYFITQSLG 124

Query: 126 EMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKV 184
           EMAT+IP+    T ++ R+  PA G A GY Y F + I    +++    VIQ+W     V
Sbjct: 125 EMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQFW--TSAV 182

Query: 185 NPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRL 244
               W+ IF V +  +N            W++S KV                       +
Sbjct: 183 PLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIVCGGS-SQGPI 241

Query: 245 GFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIP 304
           GFRYWR+PG +     +   + GRF+ +VS  + A + Y G EL GI A EA NPRKS+P
Sbjct: 242 GFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 301

Query: 305 KAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALP 364
           +AI   ++RIVIFY++S+F +GM V ++DP L             PFV++I N+G   LP
Sbjct: 302 RAINKVVFRIVIFYIMSLFFVGMLVPFNDPRL---ASNVAVIASSPFVISIQNAGTRVLP 358

Query: 365 HIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCL 424
           HI NA V++ + SA NS++YV SR LY+L+    APK F    R G+PY  +  + L  L
Sbjct: 359 HIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIATSLLGL 418

Query: 425 LAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQ 484
           LA++ V++ +   FN+ +N+ ++ G+ +W+ I +++I F +A++ +G+ +    + A   
Sbjct: 419 LAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPFKAKLM 478

Query: 485 PYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVID 544
           P+GA+++ FF  +I  I+ F  F + +FD   F T YI L +      G +  Y+ + + 
Sbjct: 479 PWGAYYAAFFVTVIIFIQGFEAF-SPKFDVSGFFTAYISLIILVVLLIGCQLYYRCRFLW 537

Query: 545 PLK-VDLYT 552
            L+ +D+ T
Sbjct: 538 KLEDIDIDT 546

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  293 bits (749), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 172/522 (32%), Positives = 277/522 (53%), Gaps = 13/522 (2%)

Query: 42  ERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXX 101
           +R  S +S+Q E+ +   D   E   +K++LK RH+ M                      
Sbjct: 40  KRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANA 99

Query: 102 XPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKY 160
            PV  L+AY F+G +VF     LGEMAT+IP+   F+ +A R+  PALG A GY Y   +
Sbjct: 100 GPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSW 159

Query: 161 FILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKV 220
                 +L+    +IQ+W    KV    W++IF V++ + N            W++S KV
Sbjct: 160 CFTFALELSVVGQIIQFWT--FKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKV 217

Query: 221 XXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTG--RFVAFVSVFVY 278
                                  +GFRYWR+PG+       I+ +TG  RF+ +VS  + 
Sbjct: 218 LALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGP--GIISSNTGEARFLGWVSSLIN 274

Query: 279 ATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIX 338
           A + Y G EL GI A EA NPRK++P+AI+  + RI++FY+ S+F +G+ V Y+DP L  
Sbjct: 275 AAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKL-- 332

Query: 339 XXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNK 398
                      PF++ I N+G   LPHI NA +L  + SA NS++YV SR L+S+A +  
Sbjct: 333 -TSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGL 391

Query: 399 APKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILI 458
           APK  AKT   G+PY ++     F  L+YM +S+  AK FN+ +N+  + G  +W+ I  
Sbjct: 392 APKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISC 451

Query: 459 TYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFI 518
           +++ F +A++ +G+ +    Y A + P+ A++++FF  +I LI+ FT F  H F  ++F+
Sbjct: 452 SHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPH-FSGRDFV 510

Query: 519 TGYIGLPVFFFCYFGYKFTYKTKVIDPLK-VDLYTFKAAIDQ 559
             YI + +F   +  ++  ++ ++I  L+ VD+ T +  I+ 
Sbjct: 511 AAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIES 552

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  294 bits (752), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 175/506 (34%), Positives = 267/506 (52%), Gaps = 16/506 (3%)

Query: 64  EGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMAC 123
           E   +++ALK RH+ M                       PV +LIAY F+G +V+F    
Sbjct: 102 EDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQS 161

Query: 124 LGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKE 182
           LGEMAT+IP+    T ++ R+  PA G + GY Y F + I    +++    VI+YW    
Sbjct: 162 LGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWT--T 219

Query: 183 KVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHD 242
           KV  GVW+ IF V+I  +N            W++S KV                      
Sbjct: 220 KVPLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-KQG 278

Query: 243 RLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKS 302
            +GFRYWR+PG++     +   + GRF+ +VS  + A + Y G EL GI A EA NPRK+
Sbjct: 279 PIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 338

Query: 303 IPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINA 362
           +P+AI   ++RIV+FY++S+F +G+ V Y DP L             PFV++I N+G  A
Sbjct: 339 VPRAINKVVFRIVLFYIMSLFFIGLLVPYTDPRL---SASSAVIASSPFVISIQNAGTYA 395

Query: 363 LPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLF 422
           LP I NA VL+ V SA NS++YV SR LYSLA    APK F    + G+PY  +  +   
Sbjct: 396 LPDIFNAIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAAL 455

Query: 423 CLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAP 482
            LLA++ V++ +   FN+ +N+ ++ G+ +W+ I +++I F +A+  +G+ +    + A 
Sbjct: 456 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAK 515

Query: 483 FQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGL----PVFFFC--YFGYKF 536
           F PYGA+++ FF  +I  I+ F  F    F   +F T YI L     VF  C  Y+  +F
Sbjct: 516 FMPYGAYYASFFVTVIIFIQGFQSFC--PFRVADFFTSYISLILLAVVFTGCQLYYKCRF 573

Query: 537 TYKTKVIDPLKVDLYTFKAAIDQEEE 562
            +K + ID +  D    +A I +++E
Sbjct: 574 IWKLEDID-IDSDRREIEAIIWEDDE 598

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  292 bits (748), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 170/532 (31%), Positives = 274/532 (51%), Gaps = 12/532 (2%)

Query: 43  RNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXX 102
            +I+  S  +  + +  +G    T +K+ALKARH+SM                       
Sbjct: 35  ESITPDSGDEFPEEHEQEGDYHETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAG 94

Query: 103 PVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYF 161
           PV +LIAY F+G +V+     LGEMAT+IP+    T ++ R+  PA G A GY Y F + 
Sbjct: 95  PVGSLIAYIFMGTVVYSITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWA 154

Query: 162 ILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVX 221
           I    +L+    +I YW     V  G W+TIF +++  +N            W++S KV 
Sbjct: 155 ITFAVELSVVGQIINYWTSV--VPLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVI 212

Query: 222 XXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATY 281
                                 +GFR WR+PG +     +      RF+ +VS  + A +
Sbjct: 213 TIVGYLIYAFIVVCGGS-SQGPIGFRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAF 271

Query: 282 AYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXX 341
            Y G EL GI A E++NPRK++PKAI    +RI+ FY++S+F +G+ V Y+DP +     
Sbjct: 272 TYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRM--DNT 329

Query: 342 XXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPK 401
                   PFV++I N+G   LP I NA VLV V SA NS++Y+ SR +YSLA    APK
Sbjct: 330 SDTDVNASPFVISIRNAGTKILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPK 389

Query: 402 IFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYI 461
            F   NR G+P   + V+ L  L+A++ V++ +   FN+ VN+ ++ G+ +W+ I + +I
Sbjct: 390 QFGYVNRHGVPVLGVMVTALMGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHI 449

Query: 462 CFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGY 521
            F + ++ +G+ +    + A F P+ A+++  F  +I  I+ +T F + +FD   F T Y
Sbjct: 450 RFMQCLKQRGISRDALPFKAKFMPWAAYYAASFVFVIIFIQGYTAF-SPKFDVTQFFTAY 508

Query: 522 IGLPVFFFCYFGYKFTYKTKVIDPLK-VDLYTFKAAID----QEEEDGKMAD 568
           I L +    + G +  YK + +  L+ +D+ T +  ID    +++E   + D
Sbjct: 509 ISLMLMLVVFIGCQIYYKCRFLWKLEDIDIDTNRREIDAIVWEDDEPKNLWD 560

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  292 bits (748), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 171/538 (31%), Positives = 281/538 (52%), Gaps = 14/538 (2%)

Query: 31  IQEEELINDDLERNISSAS----SQDENDSYNIDGKTEGTR--LKKALKARHVSMXXXXX 84
           I+E+EL++   E   +SA+    S  END       +  +R  +++ LK RH+ M     
Sbjct: 23  IKEKELVDAQYEEQDTSAAIAANSSIENDGAKGTETSPRSRGEVQRKLKERHIGMIALGG 82

Query: 85  XXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRY 143
                             PV  LI+Y F+G +++     LGEMAT+IP+   F+ +A R+
Sbjct: 83  TIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRF 142

Query: 144 CDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXX 203
             PALG   GY Y   +      +L+    +IQYW     V    W+ IF  ++  +N  
Sbjct: 143 LSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWT--HAVPLAAWIVIFWCLLTLMNMF 200

Query: 204 XXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETIT 263
                      ++S KV                       +GFRYWR+PG++     +  
Sbjct: 201 PVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIGFRYWRNPGAWGPGIISSN 260

Query: 264 GDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIF 323
            + GRF+ +VS  + A + Y G EL GI A EA NPRK++P+AIK  + RI++FY++S+F
Sbjct: 261 KNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVIRILVFYILSLF 320

Query: 324 LLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDL 383
            +G+ V Y+DP L             PF+++I NSG   LP I NA VL+ +FSA NS++
Sbjct: 321 FIGLLVPYNDPKL---DSDGTFVSASPFMISIENSGTKVLPDIFNAVVLITIFSAGNSNV 377

Query: 384 YVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVN 443
           Y+ SR LYSL+ ++ APK  +   R G+PY A+ ++ LF  LA++  S+ S K FN+ +N
Sbjct: 378 YIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFLETSAGSGKAFNWLLN 437

Query: 444 VVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKN 503
           +  + G  +W+ I  ++I F +A++ +G+ +    Y A   P+ A+++ FF  LI LI+ 
Sbjct: 438 ITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFLAYYASFFIALIVLIQG 497

Query: 504 FTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLK-VDLYTFKAAIDQE 560
           FT F    F   +F+  YI + +F   +  ++  +K ++I  L+ +D+ + +  I+++
Sbjct: 498 FTAF-APTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQDIDIDSDRREIEEQ 554

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  292 bits (748), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 167/536 (31%), Positives = 276/536 (51%), Gaps = 15/536 (2%)

Query: 35  ELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXX 94
            L    L   +   +  D +D   ++ +   T++K+ALK RH+ M               
Sbjct: 61  SLTRSRLNSRVDDGAESDGSD--ELEAEVHETKVKRALKQRHIGMIALGGTIGTGLFVGI 118

Query: 95  XXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVG 153
                   PV +LIAY F+G +++F    LGEMAT+IP+    T ++ R+  PA G A G
Sbjct: 119 STPLSVAGPVGSLIAYIFMGTIIYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANG 178

Query: 154 YAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXX 213
           Y Y F + I    +++    VIQYW   + V    W+ IF V++  +N            
Sbjct: 179 YMYWFNWAITYAVEISVIGQVIQYWT--KAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEF 236

Query: 214 WLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFV 273
           W++  KV                       +GFRYWRHPG+F     +   +TG+F+ +V
Sbjct: 237 WIAFVKVLAIVGYLIYALVIVCGGS-HQGPIGFRYWRHPGAFGPGIISKNKNTGKFLGWV 295

Query: 274 SVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDD 333
           +  + A + Y G EL GI A EA NPRK++P+AI   ++RIV+FY++S+F +GM + Y+D
Sbjct: 296 ASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGMLLPYND 355

Query: 334 PLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSL 393
             L             PFV++I N+    LP I NA V+V V SA NS++YV SR LY+L
Sbjct: 356 KRL---SAQDAVIASSPFVISIKNAHTKVLPDIFNAVVMVTVMSAANSNVYVGSRVLYAL 412

Query: 394 AIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSW 453
           A+   APK F+   R+G+PY  +  +    LLA++ V++ +   FN+ +N+ ++ G+ +W
Sbjct: 413 ALTGNAPKQFSYVTRYGVPYLGVVCTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAW 472

Query: 454 ISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFD 513
           + I + +I F +A++ +G+ +    + A   P+GA+++ FF  +I  I+ +  F    +D
Sbjct: 473 LFISLAHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGYQAFC--PWD 530

Query: 514 YKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLK-VDLYTFKAAIDQ---EEEDGK 565
              F T YI L +      G +  Y+ + +  L+ +D+ T +  I+    E+++ K
Sbjct: 531 VSTFFTSYISLILLAVLVVGCQLYYRGRFLLKLEDIDIDTDRREIESIVWEDDEPK 586

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  293 bits (749), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 173/535 (32%), Positives = 277/535 (51%), Gaps = 24/535 (4%)

Query: 38  NDDLERNISSASSQDE-------NDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXX 90
           +DD E  + S   QDE       +D+ + +G  +  ++K+ALK RHVSM           
Sbjct: 81  SDDFEMYVYS---QDEPSTDPLGSDTESGEGDMQEGKVKRALKPRHVSMIALGGTIGTGL 137

Query: 91  XXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALG 149
                       PV  LIAY F+G +V+F    +GEMAT+IP+    T ++SR+  PA G
Sbjct: 138 FVGIASPLSYSGPVGALIAYIFMGTVVYFVTQSMGEMATFIPVTSSITVFSSRFLSPAFG 197

Query: 150 FAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXX 209
            A GY Y F + I    +L+    VI+YW   E V    W+ IF V++   N        
Sbjct: 198 VANGYMYWFNWAITFAVELSVTGQVIEYWT--EAVPRAAWIAIFWVLVTLANFFPVQFYG 255

Query: 210 XXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRF 269
               W++S KV                       +GFRYWR+PG +     +   D GRF
Sbjct: 256 EVEFWVASIKVLAIVGYLIYALVIVCGGS-KQGPIGFRYWRNPGPWGAGIISKDKDEGRF 314

Query: 270 VAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCV 329
           + +V+  + A++ Y G EL GI A EA NPR+++P+AI    +RI+ FY++S+F +G+ V
Sbjct: 315 LGWVASLINASFTYQGTELVGITAGEAANPRRTVPRAINKVFFRILFFYILSLFFVGLLV 374

Query: 330 AYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRS 389
            Y+   L             PFV++I N+G  ALP I NA VLV + SA NS++YV SR 
Sbjct: 375 PYNHSSL---DKTTTVIASSPFVISIQNAGTRALPDIFNAVVLVTIISAANSNVYVGSRV 431

Query: 390 LYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFG 449
           L+SLA    APK+F+     G+P+  + V+ L  LLA++ V+  + + FN+ +N+ ++ G
Sbjct: 432 LFSLAHTGIAPKVFSSVTPQGVPFMGVIVTSLLGLLAFLVVNHNANEAFNWLINISTLAG 491

Query: 450 ILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLN 509
           + +W+ I I++I F + ++ +G+ +    + +   PYGA+++ F+  +I  ++ F  F  
Sbjct: 492 LCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYGAYYAAFWVTVIIFVQGFQAFSP 551

Query: 510 HQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLK-VDLYTFKAAIDQEEED 563
           H F    F T YI L +    + G +  Y+ +  + L+ +D+ +     D+ E D
Sbjct: 552 H-FKVTEFFTSYISLMLLVVVFCGAQLFYRCRFFNRLEDIDIDS-----DRREAD 600

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  292 bits (747), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 175/490 (35%), Positives = 253/490 (51%), Gaps = 9/490 (1%)

Query: 54  NDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFV 113
            +  +  G  E  ++K+ LK RH+ M                       PV +LIAY F+
Sbjct: 88  EEDIDATGVVEEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFM 147

Query: 114 GLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAA 172
           G LVF     LGEMAT+IP+   FT +ASR+     G A GY Y F + I    +L+   
Sbjct: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207

Query: 173 LVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXX 232
            VI++W    KV    W++IF V+IV +N            W++S KV            
Sbjct: 208 QVIEFWT--FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLC 265

Query: 233 XXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIV 292
                      +GFRYWRHPG +     +   +  RF+ +VS  + A + Y G EL GI 
Sbjct: 266 MVCGAGITGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGIT 324

Query: 293 AAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFV 352
           A EA NPRKS+P+AIK    RI++FY++S+F +G+ V Y+DP L             PF+
Sbjct: 325 AGEAANPRKSVPRAIKKVSVRILLFYILSLFFIGLLVPYNDPKL---SSTDSYVSASPFI 381

Query: 353 VAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIP 412
           +AI NSG   LPHI NA +L  + SA NS++YV SR LY L+    APK F KT R G+P
Sbjct: 382 IAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVP 440

Query: 413 YYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGV 472
           + A+  +  F  LAYM  S+     FN+ +N+  + G  +W+SI I++I F + ++ +G+
Sbjct: 441 FIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGM 500

Query: 473 DKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYF 532
            +    Y A   P  A++  FF  LI LI+ FT F   +FD   F+T YI   +F F Y 
Sbjct: 501 SRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYI 559

Query: 533 GYKFTYKTKV 542
             +  ++T++
Sbjct: 560 VAQCYFRTRL 569

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  291 bits (746), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 176/554 (31%), Positives = 278/554 (50%), Gaps = 26/554 (4%)

Query: 28  KLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXX 87
           K  I   EL +  L    S +  + E+D    +   E  ++K+ LK RH+ M        
Sbjct: 46  KKKIPNSELAS--LTHAYSRSRVEPEHDEDAEEADYEDKQVKRELKQRHIGMIALGGTIG 103

Query: 88  XXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDP 146
                          PV  LIAY F+G +V+F    LGEMAT+IP+    T ++ R+  P
Sbjct: 104 TGLFVGIATPLADAGPVGALIAYIFMGSIVYFVTQALGEMATFIPVTSSITVFSQRFLSP 163

Query: 147 ALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXX 206
           A G A GY Y F + I    +++    VIQYW D   V    W+ IF V++  +N     
Sbjct: 164 AFGVANGYMYWFNWAITFAVEISVVGQVIQYWTDA--VPLAAWIAIFWVLVTLMNFFPVK 221

Query: 207 XXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGD- 265
                  W++  KV                       +GFRYWR+PG+   +   +T D 
Sbjct: 222 VYGEVEFWVAFMKVIAIVGYLLYALIIVCGGSKKQGPIGFRYWRNPGA---WGNGLTSDG 278

Query: 266 --------TGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIF 317
                    GRF+ +V+  + A + Y G EL GI A EA NPRK++P+AI   ++RIV+F
Sbjct: 279 EPIYSSKYEGRFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLF 338

Query: 318 YLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFS 377
           Y++S+F +G+ V + D  L             PFV++I N+G   LP I NA V+V V S
Sbjct: 339 YIMSLFFIGLLVPFTDSRL---SDDTTVIASSPFVISIENAGTKILPDIFNAIVMVTVLS 395

Query: 378 ACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKI 437
           A NS++YV SR LYSLA    APKIFA+  R G+P+  +  + L  LLA++ V + +   
Sbjct: 396 AANSNVYVGSRVLYSLAHTKVAPKIFARVTRQGVPFMGVICTSLLGLLAFLVVDNNANTA 455

Query: 438 FNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCL 497
           FN+ V++ ++ G+ +W+ I + ++ F + ++ +G+ +    + A F P+G++++ F+  +
Sbjct: 456 FNWLVDISTLAGLCAWLFISLAHVRFMQVLKQRGISRDDLPFKAKFMPWGSYYAAFWVFV 515

Query: 498 IALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLK-VDLYTFKAA 556
           I  ++ F  F  H FD   F T YI L +    + G +  Y+ + +  L+ VD+ + +  
Sbjct: 516 IIFVQGFQAFSPH-FDVTTFFTDYISLILLAVVFIGAQLYYRCRFLWKLEDVDIDSDR-- 572

Query: 557 IDQEEEDGKMADAE 570
             +E ED    D E
Sbjct: 573 --REIEDAIWEDDE 584

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  291 bits (745), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 184/574 (32%), Positives = 292/574 (50%), Gaps = 29/574 (5%)

Query: 2   TIRQIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDG 61
           T R+  S S  D+  +  E  P + F   +  ++  +  +E N+     QDE++     G
Sbjct: 32  THRRRGSLSLKDEKSK--ELYPLRSFPTGVNGQDTFS--MEENL-----QDEDE-----G 77

Query: 62  KTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTM 121
           + +   +K+ LK RH+ M                       PV  LIAY F+G L F   
Sbjct: 78  EVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYLFMGSLAFSVT 137

Query: 122 ACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVD 180
             LGEMAT+IP+   FT ++ R+  PA G A GY Y F + I    +L+    VIQ+W  
Sbjct: 138 QSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWT- 196

Query: 181 KEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPD 240
             KV    W++IF V+I  +N            W++S KV                    
Sbjct: 197 -HKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255

Query: 241 HDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPR 300
              +GFRYWR+PG++     +   + GRF+ +VS  + A + + G EL GI A EA NPR
Sbjct: 256 GP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPR 314

Query: 301 KSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGI 360
           K++P+AIK  ++RI+ FY+ S+  +G+ V Y+DP L             PF+VAI NSG 
Sbjct: 315 KTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TEATSYVSTSPFIVAIQNSGT 371

Query: 361 NALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSV 420
             LPHI NA +L  + SA NS++YV SR L+ L+ +  APK  ++T++ G+PY A+  + 
Sbjct: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATA 431

Query: 421 LFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYV 480
           +F  LAYM  S+   K+F + +N+  + G  +W+ I I++I F +A++ +G+ +    + 
Sbjct: 432 VFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491

Query: 481 APFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVF------FFCYFGY 534
           A   P  A++S FF  +I +I+ FT F   +F+  +F+  YI + +F      F C F  
Sbjct: 492 AKLMPGLAYYSSFFMIIIIIIQGFTAF-APKFNGSSFLAAYISIFLFIAVWILFECIFRC 550

Query: 535 KFTYKTKVIDPLKVDLYTFKAAIDQEEEDGKMAD 568
           +F +K + +D +  D    +A + ++ E     D
Sbjct: 551 RFIWKIEDVD-IDSDRRDIEAIVWEDHEPKTFWD 583

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  291 bits (746), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 185/587 (31%), Positives = 289/587 (49%), Gaps = 38/587 (6%)

Query: 2   TIRQIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDG 61
           +IR++P N    + E     +  K     I E++  N   +  +   +  D N + N   
Sbjct: 24  SIRELPENQIEHEMEVI--DINNKSTLYSIDEKQY-NLKKKHGLQDDAIADVNSTTNSLT 80

Query: 62  KTE-------------------GTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXX 102
           +T+                      +K+ALK RH+ M                       
Sbjct: 81  RTQIVSHEAGADEEDEEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAG 140

Query: 103 PVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYF 161
           PV +LIAY F+G +++F    LGEMAT+IP+    T ++ R+  PA G + GY Y F + 
Sbjct: 141 PVGSLIAYIFMGTVIYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA 200

Query: 162 ILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVX 221
           I    +++    VIQYW DK  V    W+ IF V+I  +N            W++S KV 
Sbjct: 201 ITYAVEVSVIGQVIQYWTDK--VPLAAWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVL 258

Query: 222 XXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATY 281
                                 +GFRYWR+PG++     +     GRF+ +VS  + A +
Sbjct: 259 AIVGYLIYALVIVCGGS-HQGPIGFRYWRNPGAWGPGIISKNKSEGRFLGWVSSLINAAF 317

Query: 282 AYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXX 341
            Y G EL GI A EA NPRK++P+AI   ++RIVIFY++S+F +G+ V Y++P L     
Sbjct: 318 TYQGTELVGITAGEAANPRKTVPRAINKVVFRIVIFYIMSLFFIGLLVPYNEPRL---SP 374

Query: 342 XXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPK 401
                   PFV++I N+G  ALP I NA VL+ V SA NS++YV SR LYSLA    APK
Sbjct: 375 SSAVIASSPFVISIQNAGTYALPDIFNAVVLITVISAANSNVYVGSRVLYSLAQSGNAPK 434

Query: 402 IFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYI 461
            F    + G+PY  +  +    LLA++ V++ +   FN+ +++ ++ G+ +W+ I + +I
Sbjct: 435 QFGYVTKQGVPYMGVLSTAALGLLAFLVVNNNANTAFNWLISISTLAGLCAWLFISLAHI 494

Query: 462 CFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGY 521
            F +A++ +G+ +    + A   PYGA+++ FF  +I  I+ F  F    F    F T Y
Sbjct: 495 RFMQALKQRGISRDDLPFKAKLMPYGAYYASFFVTIIIFIQGFQAFC--PFSVSEFFTSY 552

Query: 522 IGL----PVFFFC--YFGYKFTYKTKVIDPLKVDLYTFKAAIDQEEE 562
           I L     VF  C  Y+  +F +K + ID +  D    +A I +++E
Sbjct: 553 ISLILLAVVFISCQLYYKCRFIWKLEDID-IDSDRREIEAIIWEDDE 598

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  290 bits (742), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 178/555 (32%), Positives = 282/555 (50%), Gaps = 22/555 (3%)

Query: 22  LPKK--EFKLPIQEEELINDDLERNISSASSQDENDSYNI-----DGKTEGTRLKKALKA 74
           +P K  E   P+ + +  +D+ +  + S  +Q+    +N      +G  +  ++K+ALK 
Sbjct: 1   MPDKSSELSSPLTQGKTRSDEFQMYVYSNETQNGGSGHNSSFEDDEGDLQEGQVKRALKP 60

Query: 75  RHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL- 133
           RHVSM                       PV  LIAY F+G +V+F    +GEMAT+IP+ 
Sbjct: 61  RHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYFVTQSMGEMATFIPVT 120

Query: 134 DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIF 193
              T +++R+  PA G A GY Y F + I    +++    VIQYW   + V    W+ IF
Sbjct: 121 SSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWT--KAVPLAAWIGIF 178

Query: 194 LVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPG 253
            V I   N            W++S KV                       +GFRYWR+PG
Sbjct: 179 WVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGS-KQGPIGFRYWRNPG 237

Query: 254 SFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYR 313
            + +   +   D GRF+ +V+  + A++ Y G EL GI A EA NPRK++PKAI    +R
Sbjct: 238 PWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAANPRKTVPKAINKVFFR 297

Query: 314 IVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLV 373
           I+ FY++S+F +G+ V Y+ P L             PFV++I ++G   LP I NA VLV
Sbjct: 298 ILFFYILSLFFVGLLVPYNHPGL---DKHTSVIASSPFVISIQSAGTRILPDIFNAVVLV 354

Query: 374 FVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSA 433
            + SA NS++YV SR L+SLA    APK F+     G+PY  +  + L  LLA++ V   
Sbjct: 355 TIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTALLGLLAFLVVDDN 414

Query: 434 SAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLF 493
           + + FN+ +N+ ++ G+ +W+ I I++I F + ++ +G+ +    + +   PYGA+++ F
Sbjct: 415 ANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYGAYYAAF 474

Query: 494 FCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVF--FFC----YFGYKFTYKTKVIDPLK 547
           +  +I  ++ F  F   +F    F TGYI L +    FC    Y+  +F  + + ID + 
Sbjct: 475 WVAVIIFVQGFQAFC-PKFKVAEFFTGYISLILLAVVFCLAQLYYRCRFFNRLEDID-ID 532

Query: 548 VDLYTFKAAIDQEEE 562
            D     A I +EEE
Sbjct: 533 SDRREIDALIWEEEE 547

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  289 bits (740), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 178/525 (33%), Positives = 277/525 (52%), Gaps = 15/525 (2%)

Query: 44  NISSASSQDENDSYNID-----GKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXX 98
           +  ++ +Q   + Y +D     G++  T L++  K RHV M                   
Sbjct: 18  DTGNSDTQQNGEVYELDFQEAIGESSQT-LQRGFKQRHVDMLAIAGAIGTGLVIGTGTAL 76

Query: 99  XXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLD-GFTSYASRYCDPALGFAVGYAYL 157
               P S LIA+ F G L+   +  L EMA++ P+D  F+ YA+RY DPALGFA G+ Y 
Sbjct: 77  KRGGPGSLLIAFIFTGSLLIGVLMSLAEMASFAPMDKSFSGYATRYVDPALGFATGWNYF 136

Query: 158 FKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSS 217
            KY I   ++L+A  L++QYW  +E ++  +++ +FLVV++S+N            W + 
Sbjct: 137 LKYAIALASELSAIGLLVQYW--REDLSIAIFIVVFLVVLLSLNFMNIKFYGEVEFWSAL 194

Query: 218 FKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFV 277
            K                   P  + +GFRYWR   +F  Y   + G TGRF+ + +  +
Sbjct: 195 LKFLVLIICFVTGLVLTCGGGPSKETIGFRYWREY-AFVPY--LVKGTTGRFLGWWACVI 251

Query: 278 YATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLI 337
            + YAY+G E  G+V  EA NP+K+IP A +  ++RI  FY++ + +LG+ ++  D  L 
Sbjct: 252 QSCYAYIGSETIGVVFGEAPNPKKTIPAATRNVIFRITGFYIVGVLILGLIISPHDKTL- 310

Query: 338 XXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDN 397
                       PFV+A  N+GI  LP  INA +++F+ SA N+ LYV SR+ Y LA D 
Sbjct: 311 -ANAKTSDASGSPFVIAFTNAGIKGLPSFINAMLIMFIASAANTALYVCSRTAYGLAKDG 369

Query: 398 KAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISIL 457
            APKIF   NR+G+P+    ++ L  LL++M +S++S+ IF Y  + V++FG L+W+S+L
Sbjct: 370 MAPKIFLAQNRYGVPFNGCLLAGLISLLSFMNISNSSSVIFGYLTSSVTVFGTLNWLSVL 429

Query: 458 ITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNF 517
           I+YI ++RA     V +    +   FQPY A+  LFF  LI     ++ F+   F YK+F
Sbjct: 430 ISYIGYERARVFHDVPRDRIPFRMWFQPYSAYVCLFFVSLIIFFNGYSAFI-AGFKYKSF 488

Query: 518 ITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQEEE 562
           I  YIG+ VF      +KF  K+    P  +     + AI +  E
Sbjct: 489 IVSYIGIAVFIGNTLFWKFWKKSAATRPEDLRSIMVEEAIVEVRE 533

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  290 bits (743), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 174/555 (31%), Positives = 282/555 (50%), Gaps = 23/555 (4%)

Query: 9   NSTSDQYEEYF--EQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGT 66
           NS+S   EE F  EQ   +     I  E  + DD  +   S S Q+  +           
Sbjct: 18  NSSSIIKEEEFVDEQYSGENVTKAITTERKVEDDAAKETES-SPQERRE----------- 65

Query: 67  RLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGE 126
            +K+ LK RH+ M                       PV  LI+Y F+G +++     LGE
Sbjct: 66  -VKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGE 124

Query: 127 MATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVN 185
           M T+IP+   F+ +A R+  PALG   GY Y   +      +L+    VIQYW   E V 
Sbjct: 125 MVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWT--EAVP 182

Query: 186 PGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLG 245
              W+ IF  ++ S+N             ++S KV                       +G
Sbjct: 183 LAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIG 242

Query: 246 FRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPK 305
           FRYWR+PG++     +   + GRF+ +VS  + A + Y G EL GI A EA NPRK++P+
Sbjct: 243 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPR 302

Query: 306 AIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPH 365
           AIK  + RI++FY++S+F +G+ V Y+DP L             PF+++I NSG   LP 
Sbjct: 303 AIKKVVVRILVFYILSLFFIGLLVPYNDPKL---DSDGIFVSSSPFMISIENSGTKVLPD 359

Query: 366 IINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLL 425
           I NA VL+ + SA NS++Y+ SR LYSL+ ++ AP+  +   R G+PY+++  + +F  L
Sbjct: 360 IFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFL 419

Query: 426 AYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQP 485
           A++ VS+ S K FN+ +N+  + G  +W+ I  ++I F +A+R +G+ +    Y A   P
Sbjct: 420 AFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMP 479

Query: 486 YGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDP 545
           + A+++ FF  LI LI+ FT F    F   +F+  YI + +F   +  ++  +K +++  
Sbjct: 480 FLAYYASFFIALIVLIQGFTAF-APTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWK 538

Query: 546 LK-VDLYTFKAAIDQ 559
           L+ +D+ + +  I++
Sbjct: 539 LQDIDIDSDRRQIEE 553

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  291 bits (744), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 168/533 (31%), Positives = 276/533 (51%), Gaps = 18/533 (3%)

Query: 20  EQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNI--------DGKTEGTRLKKA 71
            Q  ++   LP+++E+  N +L    S ++  D  D++++         G+     +K+ 
Sbjct: 30  SQTHRRRGSLPLKDEK--NKELYPLHSFSTRVDGEDTFSMGDVIRDEDQGEVRNAEVKRE 87

Query: 72  LKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYI 131
           LK RH+ M                       PV  LI+Y F+G L +     LGEMAT+I
Sbjct: 88  LKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYSVTQSLGEMATFI 147

Query: 132 PL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWV 190
           P+   FT ++ R+  PA G A GY Y F + I    +L+    VI++W +K  V    W+
Sbjct: 148 PVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFWTNK--VPLAAWI 205

Query: 191 TIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWR 250
           +IF V+I  +N            W++S KV                       +GFRYWR
Sbjct: 206 SIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-VGFRYWR 264

Query: 251 HPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLT 310
           +PG++     +   + GRF+ +VS  + A + + G EL GI A EA NPRK++P+AIK  
Sbjct: 265 NPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKV 324

Query: 311 MYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINAC 370
           ++RI+ FY+ S+  +G+ V Y+DP L             PF++AI NSG   LPHI NA 
Sbjct: 325 VFRILTFYIGSLLFIGLLVPYNDPKL---TTATSYVSVSPFIIAIENSGTKVLPHIFNAV 381

Query: 371 VLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCV 430
           +L  + SA NS++YV SR L+ L+ +  APK  ++T + G+PY A+ ++ +F  LAYM  
Sbjct: 382 ILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFITAVFGALAYMET 441

Query: 431 SSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWF 490
           S+   K+F + +N+  + G  +W+ I I++I F +A++ +G+ +    + A   P  A+F
Sbjct: 442 STGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELPFKAKLMPGLAYF 501

Query: 491 SLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVI 543
           +  F  +I LI+ FT F   +FD  +F+  YI + +F   +  ++  ++ + I
Sbjct: 502 AATFMIIIILIQGFTAF-APKFDGIDFLAAYISIFLFLAIWILFEIIFRCRFI 553

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  290 bits (743), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 178/563 (31%), Positives = 288/563 (51%), Gaps = 25/563 (4%)

Query: 29  LPIQEE-----ELINDDLERNISSASSQDENDSYNIDGK---TEGTRLKKALKARHVSMX 80
           LP +++     E ++ + +++ SSA+  ++    + D      EG+ L++ LK+RH+ M 
Sbjct: 31  LPAKDKYNKTIEFVDVESQQSTSSATISEKLGDGDGDADPFANEGS-LQQGLKSRHIQMI 89

Query: 81  XXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSYA 140
                                 P    I+Y  +  +V+  M   GEM  Y+P +G  +  
Sbjct: 90  ALGGAIGTGLFVGTSSTLALCGPAGLFISYIIISSVVYPIMCGFGEMVCYLPGNGNDASG 149

Query: 141 S------RYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFL 194
           S      RY D +LGFA  + Y + Y IL   + TAA+ V++YW     V  GVW+ IFL
Sbjct: 150 SAAHLVARYVDKSLGFATAWNYYYCYIILVAAECTAASGVVEYWT--VAVPKGVWILIFL 207

Query: 195 VVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGS 254
            ++V +N            W +S K+                  P+HDRLGFRYW+ PG+
Sbjct: 208 GIVVILNFGPVKYYGEAEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQRPGA 267

Query: 255 FKEYSETITGDTGRFVAFVSVFVYATYAY-LGIELTGIVAAEAQNPRKSIPKAIKLTMYR 313
           F E+   + G  GRF+   S  +   +A+ LG EL  + +AE ++ R++I KA +  ++R
Sbjct: 268 FTEH--IMKGGFGRFLDIYSGVIKGGFAFILGPELVCLTSAECEDQRRNIAKAARRFIWR 325

Query: 314 IVIFYLISIFLLGMCVAYDDPLLIXXXXXXX-XXXXXPFVVAIINSGINALPHIINACVL 372
           ++ FY++    + + VAY+DP L+             PFV+ I N+GI  LPHIINAC+L
Sbjct: 326 LMFFYVLGTLAISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQNAGIRVLPHIINACIL 385

Query: 373 VFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSS 432
              +SA N+ ++ S+RSL ++A +  AP++F K NR+G+PY A+S+S     LA++ VSS
Sbjct: 386 SSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAISLSGGLSCLAFLNVSS 445

Query: 433 ASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGV-DKSTFAYVAPFQPYGAWFS 491
           ++A +FN+F N+ +I G + WI   + YI F +A+   G+ D+  F      QPY  ++S
Sbjct: 446 STADVFNWFSNISTISGFIGWICGCVAYIRFRKAIFFNGMYDRLPFKTWG--QPYAVYYS 503

Query: 492 LFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPL-KVDL 550
           LF   LI L   +  F+   +   +F+  YI LP+F   + G+K   +T       +VD 
Sbjct: 504 LFVISLITLTNGYATFIPKNWKGSDFVAAYITLPIFVVLWVGHKLWTRTFTKRWWRRVDQ 563

Query: 551 YTFKAAIDQEEEDGKMADAEKAE 573
                 +   EE  K+ D  + E
Sbjct: 564 IDVTTGLVDIEERTKILDETRVE 586

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  289 bits (739), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 168/538 (31%), Positives = 280/538 (52%), Gaps = 14/538 (2%)

Query: 31  IQEEELI-----NDDLERNISSASSQDENDSYNID-GKTEGTRLKKALKARHVSMXXXXX 84
           I+EEELI       D E  ++  SS + + +   +    +G  +K+ LK RH+ M     
Sbjct: 23  IKEEELICARYDGQDTEEAVAGKSSINNDSAKETETSPRKGGEVKRKLKQRHIGMIALGG 82

Query: 85  XXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRY 143
                             PV  LI+Y F+G +++     LGEMAT+IP+   F+ +A R+
Sbjct: 83  TIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRF 142

Query: 144 CDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXX 203
             PALG   GY Y   +      +L+    +IQYW D   V    W+ IF  ++  +N  
Sbjct: 143 LSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTDA--VPLVAWIVIFWCLLTLMNMF 200

Query: 204 XXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETIT 263
                      ++S KV                       +GFRYWR+PG++     +  
Sbjct: 201 PVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSGGPIGFRYWRNPGAWGPGIISKN 260

Query: 264 GDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIF 323
            + GRF+ +VS  + A + Y G EL GI A EA NPR+++P+AIK  + RI++FY++S+F
Sbjct: 261 KNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRRAVPRAIKKVVVRILVFYILSLF 320

Query: 324 LLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDL 383
            +G+ V Y+DP L             PF+++I NSG   LP I NA VL+ + SA NS++
Sbjct: 321 FIGLLVPYNDPKL---DSEGTFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNV 377

Query: 384 YVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVN 443
           Y+ SR LYSL+ ++ AP+  +   + G+PY+A+  +  F  LA++  S+ S K+FN+ +N
Sbjct: 378 YIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAFGFLAFLETSAGSGKVFNWLLN 437

Query: 444 VVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKN 503
           +  + G  +W+ I +++I F +A++ +G+ +    Y A   P+ A+++ FF  LI LI+ 
Sbjct: 438 ITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRARMMPFLAYYASFFIALIVLIQG 497

Query: 504 FTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLK-VDLYTFKAAIDQE 560
           FT F    F   +FI  YI + +F   +  ++  +K + +  L+ VD+ + +  I+++
Sbjct: 498 FTAF-APTFQPIDFIAAYISVFLFIAIWLLFQVWFKCRFVWKLQDVDIDSDRRDIEEQ 554

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  290 bits (742), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 172/545 (31%), Positives = 279/545 (51%), Gaps = 19/545 (3%)

Query: 24  KKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGT---RLKKALKARHVSMX 80
           KK  ++   E+    D+L+    +     ++++    GK   +    LK+ LK+RH+ + 
Sbjct: 49  KKNPQIIYNEKSYSQDELQTTSPTIIDSIDDEAEKEQGKERSSSNGELKQGLKSRHIQLI 108

Query: 81  XXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSYA 140
                                 P    I+Y  +   V+  M  LGEM  ++P +G  S  
Sbjct: 109 ALGGTIGTSLLVGTSSALANCGPAGLFISYLIISTFVYPIMNALGEMVCFLPGNGSDSAG 168

Query: 141 S------RYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFL 194
           S      +Y DP+LGFA  + Y + + IL   +++AA+ VI+YW   E V  G W+TIFL
Sbjct: 169 SAAHLVHKYVDPSLGFAASWNYYYCFVILVAAEVSAASGVIEYWAWAEHVPKGAWITIFL 228

Query: 195 VVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDR-LGFRYWRHPG 253
            +IV +N            W +S K+                  P  D  LGFRYW++PG
Sbjct: 229 SLIVILNFLPVNVYGESEFWFASIKILCITGLIILSFILFWGGGPKSDGILGFRYWKNPG 288

Query: 254 SFKEYSETITGDTGRFVAFVSVFVYATYAY-LGIELTGIVAAEAQNPRKSIPKAIKLTMY 312
           SF  +     G  G F+   +  +   ++  LG EL  + ++E  + R++I KA K  ++
Sbjct: 289 SFAHH--ITGGGGGNFLDIYTGIIKGGFSVILGPELVCLTSSECADQRRNIAKASKRFVW 346

Query: 313 RIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXX-XXPFVVAIINSGINALPHIINACV 371
           R++ FY++    +G+ VAY+DP+L              PFV+ I N+GI A+PHI+N C+
Sbjct: 347 RLMFFYILGSLSIGVIVAYNDPVLQNALAQSKAGAGSSPFVIGIQNAGIRAVPHIVNFCI 406

Query: 372 LVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVS 431
           L   +SA N+ ++ SSRSL ++A +  APKIF + N+ G+PY A+  S+L   LAY+ VS
Sbjct: 407 LTSAWSAGNAYMFASSRSLLTMARNGNAPKIFCRINQLGVPYTAVGASLLLSCLAYLNVS 466

Query: 432 SASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFS 491
           S++A +FN+F N+ +I G + WI   + YI F +A+    +      + A  Q Y  W+S
Sbjct: 467 SSTADVFNWFSNISTISGFIGWICACVAYIRFRKAITYNKLTHR-IPFRAKGQQYTIWYS 525

Query: 492 LFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKV---IDPL-K 547
           LF+  LI L   + +F+   ++ K+FI  YI LP+F   + G+K   +T +   + P+ K
Sbjct: 526 LFWVSLITLTNGYAIFIPRNWNVKDFIAAYITLPIFIVLWIGHKVFTRTLLKAWLRPIDK 585

Query: 548 VDLYT 552
           +D+YT
Sbjct: 586 IDVYT 590

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  289 bits (739), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 168/505 (33%), Positives = 264/505 (52%), Gaps = 12/505 (2%)

Query: 66  TRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLG 125
           T +K+ALK RH+ M                       PV +LIAY F+G +++     LG
Sbjct: 99  TEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQSLG 158

Query: 126 EMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKV 184
           EMAT+IP+    T ++ R+  PA G A GY Y F + I    +++    VI+YW   +KV
Sbjct: 159 EMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWT--KKV 216

Query: 185 NPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRL 244
               W+ IF V +  +N            W++  KV                       +
Sbjct: 217 PLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGS-SQGPI 275

Query: 245 GFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIP 304
           GFRYWR+PG +     +   +T RF+ +VS  + A + Y G EL GI A EA NPRKS+P
Sbjct: 276 GFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 335

Query: 305 KAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALP 364
           +AI   ++RI +FY++S+F +G+ V YDDP L             PFV++I N+G   LP
Sbjct: 336 RAINKVVFRIALFYIMSLFFIGLLVPYDDPRL---SSDSAVVASSPFVISIQNAGTKILP 392

Query: 365 HIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCL 424
            I NA V++ V SA NS++YV SR LY+LA    APK FA   R G+PY  +  +    L
Sbjct: 393 DIFNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGL 452

Query: 425 LAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQ 484
           LA++ V++ +   FN+ +N+ ++ G+ +W+ I I++I F +A++ +G+ +    + A F 
Sbjct: 453 LAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFM 512

Query: 485 PYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVID 544
           P+ A+++ FF  +I  I+ F  F  H FD   F T YI L +    + G +  Y+ +   
Sbjct: 513 PWAAYYATFFVTVIIFIQGFQAFSPH-FDVTAFFTAYISLIILAVLFIGCQIYYRCRFFW 571

Query: 545 PLK-VDLYTFKAAIDQ---EEEDGK 565
            L+ +D+ T +  I++   E+++ K
Sbjct: 572 KLEDIDIDTDRREIEEVIWEDDEPK 596

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  288 bits (737), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 178/567 (31%), Positives = 286/567 (50%), Gaps = 27/567 (4%)

Query: 9   NSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRL 68
            S S + E+  E  P + F   +  ++  +  +E +I     QDE++     G+ +   +
Sbjct: 37  GSLSLKDEKSKELYPLRSFPNGVNGQDTFS--MEEDI-----QDEDE-----GEVQNAEV 84

Query: 69  KKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMA 128
           K+ LK RH+ M                       PV  LI+Y F+G L +     LGEMA
Sbjct: 85  KRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEMA 144

Query: 129 TYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPG 187
           T+IP+   FT ++ R+  PA G A GY Y F + +    +L+    VIQ+W     V   
Sbjct: 145 TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWT--YAVPLA 202

Query: 188 VWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFR 247
            W++IF V+I ++N            W++S KV                       +GFR
Sbjct: 203 AWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFR 261

Query: 248 YWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAI 307
           YWR+PG++     +   +  RF+ +VS  + A + + G EL GI A EA NPRK++P+AI
Sbjct: 262 YWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAI 321

Query: 308 KLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHII 367
           K  ++RI+ FY+ S+  +G+ V Y+DP L             PF++AI NSG   LPHI 
Sbjct: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKL---TSATSYVSTSPFIIAIENSGTKVLPHIF 378

Query: 368 NACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAY 427
           NA +L  + SA NS++YV SR L+ L+    APK F+KT + G+PY A+  + +F  LAY
Sbjct: 379 NAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAY 438

Query: 428 MCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYG 487
           M  S+   K+F + +N+  + G  +W+ I +++I F +A++ +G+ +    + A   P  
Sbjct: 439 METSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGL 498

Query: 488 AWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVF------FFCYFGYKFTYKTK 541
           A+++ FF  +I LI+ FT F    F+  NF+  YI + +F      F   F  +F +K +
Sbjct: 499 AYYATFFMVVIILIQGFTSF-TPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIE 557

Query: 542 VIDPLKVDLYTFKAAIDQEEEDGKMAD 568
            +D +  D    +A + +E E   + D
Sbjct: 558 DVD-IDSDRRDIEAIVWEEPEPKTLWD 583

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  287 bits (735), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 179/568 (31%), Positives = 289/568 (50%), Gaps = 32/568 (5%)

Query: 34  EELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXX 93
           E L  + + R+ SS+  + E +           +LK+ L +RHV                
Sbjct: 34  ESLTREKITRSDSSSEVEAEGNG----------KLKQGLSSRHVQFIALGGTIGTGLFVG 83

Query: 94  XXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSYAS------RYCDPA 147
                    P   +I+Y  +  +++  M  LGEM  Y+P +G  S  S      RY D +
Sbjct: 84  TSVTLKTVGPGGLVISYIIISTVIYPIMNALGEMVCYLPGNGEDSAGSVAHLVGRYVDKS 143

Query: 148 LGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXX 207
           L FA G+ Y + + IL   + TAA+ V+ YW     V   VW+TIFL ++  +N      
Sbjct: 144 LAFATGWNYYYCFVILVAAECTAASGVVTYWTTS--VPTAVWITIFLGIVTLLNFSAVKY 201

Query: 208 XXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDT- 266
                 W +S K+                  P H RLGF YW+ PG+F  +   ITG + 
Sbjct: 202 FGETEFWFASIKILCILGLILVSFILFWGGGPSHVRLGFHYWKDPGTFAHH---ITGGSW 258

Query: 267 GRFVAFVSVFVYATYAY-LGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLL 325
           G F+   +  +   +A+ LG EL  + ++E  + R++I KA K  ++R++ FY++    +
Sbjct: 259 GSFLDIYTGIIKGAFAFILGPELVALTSSECNDQRRNIAKASKRFIWRLMFFYILGTLSI 318

Query: 326 GMCVAYDDPLLI-XXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLY 384
            + VAY+DP+L+             PFV+ I N+GI  LPHIINAC+L   +SA NS ++
Sbjct: 319 SVIVAYNDPVLLNALEEGKEGAASSPFVIGIQNAGIKVLPHIINACILSSAWSAGNSFMF 378

Query: 385 VSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNV 444
            SSRSL ++A +  APKIF K NR+G+PYY++ +S +   LA++ VSS++A++F++F N+
Sbjct: 379 ASSRSLMTMAHNGSAPKIFCKVNRFGVPYYSVGLSAMLSCLAFLNVSSSTAQVFDWFSNI 438

Query: 445 VSIFGILSWISILITYICFDRAVRAQGV-DKSTFAYVAPFQPYGAWFSLFFCCLIALIKN 503
            +I G L WI  +I Y+ F +A+    + D+  F      QPY  W+SL    +I L   
Sbjct: 439 STISGFLGWICAIIAYLRFRKAIFYNNMYDRLPFKTFG--QPYLIWYSLLVISVITLTNG 496

Query: 504 FTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQEEED 563
           +  F+   +   +F+  YI LP+F   + G+KF  + K   PL + LY     +D+ +  
Sbjct: 497 YQTFIPRFWSGSDFVAAYITLPLFLILWVGHKFWARYKHAVPL-LKLYY---PVDEIDVI 552

Query: 564 GKMADAEK-AERIKQNGKNFEWFYDKFL 590
             +A+AE+ AE++  N      ++ KF+
Sbjct: 553 TGLAEAEEVAEKLDMNRIPPSTYWGKFI 580

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  285 bits (728), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 182/591 (30%), Positives = 298/591 (50%), Gaps = 37/591 (6%)

Query: 13  DQYEEYFEQLPKKEFKLPIQEEELI--NDDLER-NI---SSASSQDENDSYNIDGKTEGT 66
           D  E   + +P++  K  +Q    +  +DD+++ NI   + ASS  E++     G     
Sbjct: 2   DTLESSSQSVPRQR-KSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDA 60

Query: 67  RLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGE 126
            +K+ LK RH+ M                       PV +LIAY FVG L +     LGE
Sbjct: 61  EVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGE 120

Query: 127 MATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVN 185
           MAT+IP+   FT +ASR+  P++G AVGY Y F + +    +L+    ++ YW     + 
Sbjct: 121 MATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPI- 179

Query: 186 PGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLG 245
              W++IF V++ ++N            W+++ KV                       +G
Sbjct: 180 -AAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VG 237

Query: 246 FRYWRHPGSFKEYSETITG-------DTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQN 298
           FRYWR+PG + +   T  G       +TGRF+ + +  + A + Y G EL GI A EA N
Sbjct: 238 FRYWRNPGPWGD-GLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAAN 296

Query: 299 PRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINS 358
           PRK++P+AIK  ++RI++FY+ S+F +G+ V +DDP L             PF++AI NS
Sbjct: 297 PRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKL---SSDDSYVSSSPFIIAIENS 353

Query: 359 GINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSV 418
           G   LP I NA +L+ + SA NS++YV SR L+SLA    APKI ++T + G+P+ ++  
Sbjct: 354 GTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLA 413

Query: 419 SVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFA 478
           + +F +LAYM  +     +F++ VN+ +I G  +W+ ILI++I F + ++ +G+ +    
Sbjct: 414 TAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLP 473

Query: 479 YVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTY 538
           + A   P  A++++F   +I + + FT F    FD  +F   YI + +FF  +  ++  +
Sbjct: 474 FKANLMPGLAYYAVFCMVIIIIFQGFTAF-TPTFDVSDFFAAYISVILFFLIWGAFQLWF 532

Query: 539 KTKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKF 589
           K + I  L+         ID    D         E+I       + F+DKF
Sbjct: 533 KCRWIWKLE------DVDIDSNRRD--------VEKIIWEDPEPKTFWDKF 569

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  284 bits (726), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 173/551 (31%), Positives = 281/551 (50%), Gaps = 21/551 (3%)

Query: 20  EQLPKKEFKLPIQEEELINDDLERNISSA---------SSQDENDSYNIDGKTEGTRLKK 70
           ++ P K  K+     EL +  L R  +S           SQ+E  +   +G+     +K+
Sbjct: 5   QEEPLKNGKIKSSSYELDDYPLHRRTNSVHSIPSQITIESQEEEIA---NGQIREAEVKR 61

Query: 71  ALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATY 130
            LK RH+ M                       PV  LIAY F+G LV+     LGEMAT+
Sbjct: 62  ELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATF 121

Query: 131 IPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVW 189
           IP+   FT ++ R+  P+ G A GY Y F + I    +L+    +IQ+W     +    W
Sbjct: 122 IPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIV--AW 179

Query: 190 VTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYW 249
           ++IF V++V++N            W++S KV                       +GFRYW
Sbjct: 180 ISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP-VGFRYW 238

Query: 250 RHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKL 309
           R+PG           +  +F+ +VS  + A + Y G EL GI A EA NPRKS+P+AIK 
Sbjct: 239 RNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKK 298

Query: 310 TMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINA 369
            ++RI+ FY+ S+F +G+ V Y+DP L             PF+++I NSG   LPHI NA
Sbjct: 299 VVFRILFFYIGSLFFIGLLVPYNDPKL---TSDDSYVAASPFIISIQNSGTPILPHIFNA 355

Query: 370 CVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMC 429
            +L  + SA NS++YV SR ++ L+    AP+I ++TN+ G+P+ ++  + LF  LAYM 
Sbjct: 356 VILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYME 415

Query: 430 VSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAW 489
            S+     FN+ +N+  + G  SW+ I I+++ F +A+  +G+ +    + A F P  A+
Sbjct: 416 TSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAY 475

Query: 490 FSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLK-V 548
           +++FF  LI +I+ FT F    FD  +F+  YI   +F   +  ++  ++ ++I  ++ V
Sbjct: 476 YAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDV 534

Query: 549 DLYTFKAAIDQ 559
           D+ T +  I++
Sbjct: 535 DIDTDRRDIEE 545

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  283 bits (724), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 176/554 (31%), Positives = 279/554 (50%), Gaps = 27/554 (4%)

Query: 16  EEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKAR 75
           E+  E  P + F   +  E+  +  +E  I      DE++     G+ +   +K+ LK R
Sbjct: 44  EKSKELYPLRSFPTRVNGEDTFS--MEDGIG-----DEDE-----GEVQNAEVKRELKQR 91

Query: 76  HVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-D 134
           H+ M                       PV  LI+Y F+G L +     LGEMAT+IP+  
Sbjct: 92  HIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTS 151

Query: 135 GFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFL 194
            FT ++ R+  PA G A GY Y F + I    +L+    VIQ+W    KV    W++IF 
Sbjct: 152 SFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWT--YKVPLAAWISIFW 209

Query: 195 VVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGS 254
           V+I  +N            W++S KV                       +GFRYWR+PG+
Sbjct: 210 VIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGA 268

Query: 255 FKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRI 314
           +     +   + GRF+ +VS  + A + + G EL GI A EA NPRKS+P+AIK  ++RI
Sbjct: 269 WGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRI 328

Query: 315 VIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVF 374
           + FY+ S+  +G+ V Y+DP L             PF++AI NSG   LPHI NA +L  
Sbjct: 329 LTFYIGSLLFIGLLVPYNDPKL---TQSTSYVSTSPFIIAIENSGTKVLPHIFNAVILTT 385

Query: 375 VFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSAS 434
           + SA NS++YV SR L+ L+ +  APK  ++T + G+PY A+ V+  F  LAYM  S+  
Sbjct: 386 IISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGG 445

Query: 435 AKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFF 494
            K+F + +N+  + G  +W+ I I++I F +A++ +G+ +    + A   P  A+++  F
Sbjct: 446 DKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATF 505

Query: 495 CCLIALIKNFTVFLNHQFDYKNFITGYIGLPVF------FFCYFGYKFTYKTKVIDPLKV 548
             +I +I+ FT F   +F+  +F   YI + +F      F C F  +F +K   +D +  
Sbjct: 506 MTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDVD-IDS 563

Query: 549 DLYTFKAAIDQEEE 562
           D    +A + ++ E
Sbjct: 564 DRRDIEAIVWEDHE 577

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  282 bits (722), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 167/516 (32%), Positives = 269/516 (52%), Gaps = 13/516 (2%)

Query: 33  EEELINDDLERNI-----SSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXX 87
              ++ D   R++     S + S DE++ Y   G  +   +K+ LK RH+ M        
Sbjct: 49  SSSIVVDGSSRHLHGSHGSHSVSGDEDEPYVDQGVVQDAEVKRELKQRHIGMIALGGTIG 108

Query: 88  XXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDP 146
                          PV +LIAY F+  +VF     LGEMAT+IP+   FT ++SR+  P
Sbjct: 109 TGLFIGISTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEMATFIPVTSSFTVFSSRFISP 168

Query: 147 ALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXX 206
           ++G A GY Y F + I    +L+    +IQ+W D   ++   W+ I+  ++  +N     
Sbjct: 169 SIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLS--AWIVIWWFILTIMNMFPVK 226

Query: 207 XXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDT 266
                  W++S KV                       +GFRYWR+PG +     +     
Sbjct: 227 FYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVT-GPVGFRYWRNPGPWGPGIISSQVAE 285

Query: 267 GRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLG 326
           GRF+ +VS  + A + Y G EL GI A EA NPRK++P+AIK   +RI+IFY++S+F +G
Sbjct: 286 GRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVSFRILIFYILSLFFIG 345

Query: 327 MCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVS 386
           + V +DDP L             PF++AI NSG   LPHI NA +L  + SA NS++YV 
Sbjct: 346 LLVPFDDPKLSSDDSYVSSS---PFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVG 402

Query: 387 SRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVS 446
           SR ++ LA    AP+ F  T + G+PY A+  +  F  LA++ VSS  AK FN+ +N+V 
Sbjct: 403 SRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVG 462

Query: 447 IFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTV 506
           + G  +W+ I I ++ F + +  +G+ +    + A   P+ A++++FF  +I +I+ FT 
Sbjct: 463 VAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYYAIFFMIIIIIIQGFTA 522

Query: 507 FLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKV 542
           F    F+  +F+  YI + +FFF +  ++  ++ K+
Sbjct: 523 F-APTFNGSDFVAAYISVFLFFFLWVSFQLYFRCKL 557

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  280 bits (716), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 171/542 (31%), Positives = 277/542 (51%), Gaps = 25/542 (4%)

Query: 50  SQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIA 109
           S+ + +   I  + E   +++ LK RH+ M                       PV  LIA
Sbjct: 9   SKMKEEIREISVEVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIA 68

Query: 110 YAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQL 168
           Y F+  L +     LGEMAT+IP+   FT ++ R+  PA G A GY Y F + I    +L
Sbjct: 69  YLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALEL 128

Query: 169 TAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXX 228
           +    VIQ+W     V    W++IF V++  +N            W++  KV        
Sbjct: 129 SVVGQVIQFW--TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLI 186

Query: 229 XXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIEL 288
                          +GFRYWRHPG+F         +  RF+ +VS  + A + + G EL
Sbjct: 187 YCFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTEL 245

Query: 289 TGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXX 348
            GI A EA NPRK++P+AIK  ++RI+ FY++S+F +G+ V YDD  L            
Sbjct: 246 VGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKL---TSTDSYVSA 302

Query: 349 XPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNR 408
            PF++AI NSG + LPHI NA ++  + SA NS++YV SR +Y L+    AP I ++T +
Sbjct: 303 SPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQ 362

Query: 409 WGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVR 468
            G+P+ A+ V+ LF  LAYM  S+   K FN+ +N+  + G  +W+ I +++I F +A+ 
Sbjct: 363 HGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALE 422

Query: 469 AQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFF 528
            +G+ +    + A + P  A++ +FF  LI +I+ FT F    ++  +F+T YI + +F 
Sbjct: 423 MRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFC--PWNGIDFLTAYISVFMFI 480

Query: 529 FCYFGYKFTYKTKVIDPLK-VDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYD 587
             +  ++  ++ ++I  ++ VD+ T + A+            E+A  I+Q  +    F+D
Sbjct: 481 AIWIAFQAWFRCRLIWRVEDVDIDTDRRAV------------EEAVWIEQEPRG---FWD 525

Query: 588 KF 589
           KF
Sbjct: 526 KF 527

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  282 bits (721), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 171/501 (34%), Positives = 271/501 (54%), Gaps = 9/501 (1%)

Query: 60  DGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFF 119
           +G  +   +K+ LK RH+ M                       PV  LIAY F+  +VF 
Sbjct: 89  EGVVKEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFS 148

Query: 120 TMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYW 178
               LGEMAT+IP+   FT ++SR+  PA+G A GY Y F + +    +L+    +IQ+W
Sbjct: 149 VTQSLGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFW 208

Query: 179 VDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXX 238
                V    W+ I+ V++  +N            W++S KV                  
Sbjct: 209 T--HAVPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAG 266

Query: 239 PDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQN 298
                +GFRYWR+PG +     +   + GRF+ +VS  + A + Y G EL GI A EA N
Sbjct: 267 VTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 325

Query: 299 PRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINS 358
           PRK++P+AIK   +RI+IFY++S+F +G+ V YDD  L             PF++AI NS
Sbjct: 326 PRKTVPRAIKKVTFRILIFYILSLFFIGLLVPYDDEKL---TSTDSYISASPFIIAIENS 382

Query: 359 GINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSV 418
           G   LPHI NA +L  + SA NS++YV SR L+ LA    APK F  T+R G+PYY++  
Sbjct: 383 GTKILPHIFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFF 442

Query: 419 SVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFA 478
           +  F  LA++ VSS  AK FN+ +N++S+ G  +W+ I I ++ F +A++ +G+ +    
Sbjct: 443 TSSFGALAFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLP 502

Query: 479 YVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTY 538
           + A F P+ A++S+FF  +I +I+ FT F    F+  +F+  YI + +FFF +  ++  +
Sbjct: 503 FKARFMPHLAYYSIFFMTIIIIIQGFTAFA-PTFNGSDFVAAYISIFLFFFLWLCFQLYF 561

Query: 539 KTKVIDPL-KVDLYTFKAAID 558
           ++K++  + +VD+ T +  +D
Sbjct: 562 RSKLLWTVEEVDIDTDRRDVD 582

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  280 bits (716), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 173/548 (31%), Positives = 272/548 (49%), Gaps = 24/548 (4%)

Query: 47  SASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVST 106
           S +S +E ++ +    +E   L K L++RH+ +                           
Sbjct: 27  SRTSLEELETQS--AGSEYNTLHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCGAAPL 84

Query: 107 LIAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPP 165
           L+++  +  +V+  M  L EM  Y+P  G      SRY DP+LGFA G+ Y + Y IL  
Sbjct: 85  LLSFILISTIVYPIMCSLAEMICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAYAILVA 144

Query: 166 NQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXX 225
            +L+AAA V+ YW     V    W+TIFLVV+V +N            W +S K+     
Sbjct: 145 AELSAAASVVSYW--DNPVPMAAWITIFLVVVVGLNFTAVKYYGEAEFWFASIKLICILG 202

Query: 226 XXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAY-L 284
                        P+HDR GFRYW++PG F        G TGRF+      + + +A+ L
Sbjct: 203 LLVVSVVIFFGGAPNHDRTGFRYWKNPGPFAM--SLAPGSTGRFLDVWRAVIKSAFAFIL 260

Query: 285 GIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXX 344
             EL GI   EAQ+ R++  KA +  +YRI+ FY+    ++G+ ++  DP LI       
Sbjct: 261 SPELIGIACVEAQDTRRNTEKASRRFIYRIIFFYVSCALMIGVILSRTDPKLIEALETGA 320

Query: 345 -XXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIF 403
                 PFV  I N+GI  L H+IN  +L   +SA NS +Y S+R + +LA +  APK  
Sbjct: 321 PGAASSPFVQGIANAGIPVLDHVINVAILSSAWSAGNSFMYASTRMVLALAREGNAPKFL 380

Query: 404 AKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICF 463
            K NR+G+PY A+ V  L   LAY+ V + SA +F +  N+ +I G + W ++ I +I F
Sbjct: 381 TKINRYGVPYNAVIVCTLVACLAYLNVKTTSANVFQWLSNICTISGFIGWFAMGIAFIRF 440

Query: 464 DRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIG 523
            R +    + +S   Y  P QPY A++  F   ++ L   F VFL  +++  +F+  Y+ 
Sbjct: 441 RRGIVFNNL-QSRIPYQGPLQPYIAYYFTFMTVVVCLTNGFHVFLKGRWNVVDFVAAYVT 499

Query: 524 LPVFFFCYFGYKFTYKTKVIDPL-KVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNF 582
           LP++   Y G+K  ++T+   P+ ++D+ T    + + EE+ KM       RI +N    
Sbjct: 500 LPIYLVLYLGHKLWFRTRWYIPVEQIDVIT---GLVEAEEESKMTP----PRIPKN---- 548

Query: 583 EWFYDKFL 590
              ++KFL
Sbjct: 549 --LWEKFL 554

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  281 bits (718), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 169/506 (33%), Positives = 259/506 (51%), Gaps = 9/506 (1%)

Query: 60  DGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFF 119
           +G+     +K+ALK RH+ M                       PV  LIAY F+  LV+ 
Sbjct: 69  EGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYS 128

Query: 120 TMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYW 178
            +  LGEMAT+IP+   FT ++SR+  PA G A GY Y F + I    +L+    +I++W
Sbjct: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188

Query: 179 VDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXX 238
                V    W+TIF V++   N            W++  KV                  
Sbjct: 189 TTA--VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246

Query: 239 PDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQN 298
                +GFRYWR+PG++     +   + GRF+ +VS  + A + Y G EL GI A EA N
Sbjct: 247 ITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305

Query: 299 PRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINS 358
           PRKS+P+AIK  ++RI++FY      +G+ V Y+DP L             PF++AI NS
Sbjct: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL---NSSDSYVSSSPFIIAIENS 362

Query: 359 GINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSV 418
           G   LPHI NA VL  + SA NS++YV SR +Y LA    AP  F +TN  G+PY+A+  
Sbjct: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422

Query: 419 SVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFA 478
           +  F  LAYM +S+  A  FN+ +N+  + G  +W+ I   +I F +A++ +G+ +    
Sbjct: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482

Query: 479 YVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTY 538
           + A F P+ A+++LFF  +I LI+ FT F    F   +F   Y+ + +F   + G +  +
Sbjct: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQIWF 541

Query: 539 KTKVIDPL-KVDLYTFKAAIDQEEED 563
           + ++   L +VD+ T +  I+    D
Sbjct: 542 RCRIFHRLDEVDIDTDRRDIEAVVWD 567

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  280 bits (716), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 172/541 (31%), Positives = 275/541 (50%), Gaps = 18/541 (3%)

Query: 25  KEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXX 84
           +++++    EE ++ + +      SSQD     +  G+     +++ LK RHVSM     
Sbjct: 19  EDYEMGSFAEEALDQEAQ------SSQDSQLGSSGHGRNA---VQRQLKPRHVSMIALGG 69

Query: 85  XXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRY 143
                             PV  LI+Y F+G + +     LGEMAT+IP+   FT +  R+
Sbjct: 70  TIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMATFIPVTSSFTVFTRRF 129

Query: 144 CDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXX 203
               LG A GY Y F + +    +L+    +I+YW     V    W+ IF V I   N  
Sbjct: 130 LSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSA--VPNAAWIAIFWVPITLSNLV 187

Query: 204 XXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETIT 263
                     W++  KV                       +GFRYWR+PG + +   +  
Sbjct: 188 PVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKTGP-VGFRYWRNPGPWGDGIISHD 246

Query: 264 GDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIF 323
              GRF+ +VS  V A + Y G EL GI A E+ NPRK++PKAI    +RI++FY+ S+F
Sbjct: 247 IHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINKVFFRILLFYVGSLF 306

Query: 324 LLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDL 383
            +G+ V ++D  L             PF++AI NSG   LP I NA +L  + SA NS++
Sbjct: 307 FIGLLVPFNDEKL---TSSDSYSAGSPFIIAIQNSGTKILPDIFNAVILATIISAANSNV 363

Query: 384 YVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVN 443
           YV SR LY LA +  AP+ FA+TNR G+P  A+     F  L Y+ VS+ ++K F++ +N
Sbjct: 364 YVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFDWLLN 423

Query: 444 VVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKN 503
           + +I G  SW+ I + ++ F +A++ QG+ +    + A   P+GA++S FF  LI +I+ 
Sbjct: 424 ITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLIIIIQG 483

Query: 504 FTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLK-VDLYTFKAAIDQEEE 562
           FT  L   F+  NF   YI + +F   +  ++  Y+T++I  ++ VD+ + +  +D ++ 
Sbjct: 484 FTS-LAPTFNVSNFFAAYISVFMFLVIWAVFQCWYRTRIIHRIEHVDIDSDRREVDAQQW 542

Query: 563 D 563
           D
Sbjct: 543 D 543

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  279 bits (714), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 165/527 (31%), Positives = 268/527 (50%), Gaps = 14/527 (2%)

Query: 52  DENDSYNI-----DGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVST 106
           D ND+        D + +   +K+ LK RH+SM                       P+  
Sbjct: 14  DSNDTPTTISTLDDDQEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGA 73

Query: 107 LIAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPP 165
           LIAY F+G +VF     LGEM T+IP+   FT +A R+  PA G A GY Y F + +   
Sbjct: 74  LIAYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFA 133

Query: 166 NQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXX 225
            +L+    +IQ+W     V    W++I  V++   N            W++S KV     
Sbjct: 134 LELSVVGQIIQFWT--MAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILG 191

Query: 226 XXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLG 285
                             +GFRYW++PG +     +   +  RF  +VS  + A + + G
Sbjct: 192 FIIYGICIICGAGVTGP-VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQG 250

Query: 286 IELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXX 345
            EL GI A E Q PRK++PKAIK  ++RI++FY+ S+ ++G+ V Y+DP L         
Sbjct: 251 TELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL---QSNDSY 307

Query: 346 XXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAK 405
               PF++ I N+G   LPHI NA +L+ + SA NS++Y+ SR LY LA +  APK F  
Sbjct: 308 VSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTN 367

Query: 406 TNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDR 465
           T++ G+PY  +  + +F  LAYM  ++   K F + +N+V + G  +W+ I  ++I F +
Sbjct: 368 TSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMK 427

Query: 466 AVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLP 525
           A++ +G+ ++   Y A   P+ A++++FF  +I +I+ FT F   +F   NF   YI + 
Sbjct: 428 ALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAAYISVF 486

Query: 526 VFFFCYFGYKFTYKTKVIDPLK-VDLYTFKAAIDQEEEDGKMADAEK 571
           +F   +  ++  +K +++  L+ VDL T +  I++E     + D  K
Sbjct: 487 LFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNK 533

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  280 bits (715), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 182/579 (31%), Positives = 278/579 (48%), Gaps = 33/579 (5%)

Query: 6   IPSNSTSDQYEEYFEQLP--KKEFK-LPIQEEELIN--DDLERNISSASSQ-------DE 53
           + +N     Y    E +P  K E K L   E + +N  D L+   +   S          
Sbjct: 1   MANNRGQVTYNYELEDIPSSKNELKELGDMEAQQMNLDDSLDDRFNKKDSGLNKVLTVSS 60

Query: 54  NDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFV 113
           + S N   +     LK+ LK+RHV +                       P    IAY  +
Sbjct: 61  DTSTNSLEEDYTNTLKQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCII 120

Query: 114 GLLVFFTMACLGEMATYIPLDGFTSYAS------RYCDPALGFAVGYAYLFKYFILPPNQ 167
             +++  M  +GEM  Y+P DG  S  S      RY D +L FA G+ Y + Y IL   +
Sbjct: 121 SSVIYPIMNAVGEMVCYLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYVILVAAE 180

Query: 168 LTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXX 227
            TAAA V++YW     V    W+TIFL +I  +N            W +S K+       
Sbjct: 181 CTAAAGVVEYWT--LAVPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGLI 238

Query: 228 XXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAY-LGI 286
                      P HDRLGFRYW++PG+F  +     G  G F+   S  +   +A+ LG 
Sbjct: 239 ILSFILFWGGGPSHDRLGFRYWKNPGAFAHH--VTDGSLGNFLDIYSGIIKGAFAFILGP 296

Query: 287 ELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXX-X 345
           EL  + ++E  + R++I KA K  +YR++ FY++    +G+ VA++DP+L          
Sbjct: 297 ELVALTSSECSDQRRNIAKASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPG 356

Query: 346 XXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAK 405
               PFV+ I N+GI  LPHIINAC+L   +S+ N+ ++ SSRSL+++A +  APKIF +
Sbjct: 357 AGSSPFVIGIQNAGIEVLPHIINACILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGR 416

Query: 406 TNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDR 465
            N++G+PY A+ +S L   LAY+  SS++A++F +  N+ +I G L WI   I Y+ F +
Sbjct: 417 INKYGVPYMAVILSTLISCLAYLNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRK 476

Query: 466 AVRAQGV-DKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGL 524
           A+    + D+  F      QPY   +SL    +I +   +  F+   ++  +FI  YI L
Sbjct: 477 AIFYNNLYDRMPFKTWG--QPYLILWSLTVVSIITITNGYQTFIPKFWNVSDFIAAYITL 534

Query: 525 PVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQEEED 563
           P+F   Y G+      KV +  K D    K A   E+ D
Sbjct: 535 PIFLALYVGH------KVYNHFKNDYPLMKLAYSVEDID 567

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  278 bits (710), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 171/533 (32%), Positives = 266/533 (49%), Gaps = 13/533 (2%)

Query: 31  IQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXX 90
           + +E++  D+ E  +    + DE     +    + T+LK+ LKARH+ M           
Sbjct: 10  LTKEKVAIDEAEVQLEEGVTLDETIKQGVL-HNDRTKLKQGLKARHIKMLTLVGVFGTGL 68

Query: 91  XXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFT-SYASRYCDPALG 149
                       PV  LIAY  VG++V      + E+A+++P  G T  ++ ++ D A+G
Sbjct: 69  FLSSGGTLKKTGPVGMLIAYVLVGIVVGCNQIAIAEVASFMPATGATIRHSEQFIDEAVG 128

Query: 150 FAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXX 209
           F  G+  +  Y  L P +L+A A+V+ YW D   ++P +++TIF V+ +  N        
Sbjct: 129 FTFGW--ISTYSSLMPGELSATAVVMTYWTD---LSPAIFITIFGVLFILTNIYTIRFYG 183

Query: 210 XXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRF 269
               +    K+                     +RLGF YWR+PG F EY   + GDTG+F
Sbjct: 184 EIEYFFGWLKLALIAILIITGLVIDLGGT-KQERLGFHYWRNPGPFAEY--LVGGDTGKF 240

Query: 270 VAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCV 329
           V F +      Y+Y GI+   I+A E +N R +I    K    RI++ YLI++F+L + V
Sbjct: 241 VGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFVRIILLYLITVFVLTLIV 300

Query: 330 AYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRS 389
            Y+D L+             PFV+A+  +GI  LPHI+NA +L   +SA N  +   SR+
Sbjct: 301 PYNDKLI---ATGSGNARSSPFVIAMERAGIKVLPHIVNALILTSAWSAGNLAIIEGSRN 357

Query: 390 LYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFG 449
           L+ LA  N+APKIF KT++ GIP+  +     F  LAYM  S +SA +F++F  +VS   
Sbjct: 358 LFCLATKNQAPKIFLKTSKRGIPWVGVLFISSFLPLAYMSCSESSATVFSWFQELVSSNT 417

Query: 450 ILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLN 509
           +L WI I   +I  DRA+RAQG  +    Y     PY AWFS     +  L   F  F++
Sbjct: 418 LLRWILISANHIHMDRALRAQGYSRKDLPYSTTIAPYAAWFSGIMSFIFLLTGGFYNFIH 477

Query: 510 HQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQEEE 562
             FD ++F + Y  +P+    +  +K   KT+ + P +VDL +    I +  E
Sbjct: 478 GNFDIESFFSRYFIIPLAIALFTFWKLFKKTRYLRPHEVDLQSIFEDIRENPE 530

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  277 bits (708), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 173/541 (31%), Positives = 266/541 (49%), Gaps = 18/541 (3%)

Query: 24  KKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXX 83
           +++ K  I EE++   D E +I S     +    + D     T+LK+ LK RH+ M    
Sbjct: 12  QEKVKPKIYEEDV---DEEHDIVSVEETVKRGVLHNDR----TKLKQGLKERHIKMLTLV 64

Query: 84  XXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFT-SYASR 142
                              PV  LIAY FVG++V      + E+A+++P  G T  +A +
Sbjct: 65  GVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQ 124

Query: 143 YCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINX 202
           + D ++GF  G+  +  Y  L P +L+A A++++YW D   V+P V++T+F ++ V  N 
Sbjct: 125 FIDESVGFTFGW--ISTYSSLMPGELSATAVIMRYWTD---VSPAVFITVFGILFVVTNI 179

Query: 203 XXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETI 262
                           K+                     +RLGF YWR PG F  Y   +
Sbjct: 180 YTIRFYGELEYIFGWLKLVLIFILIISGLVIDLGGTKGQERLGFHYWREPGPFANY--LV 237

Query: 263 TGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISI 322
            G  G+FV F +      Y+Y GI+   I+A E +N R +I    K    RI++ YL+++
Sbjct: 238 GGHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFLRIIVLYLVTV 297

Query: 323 FLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSD 382
           F+L + V Y+D L+             PFV+A+  +GI  LPHI+NA +L   +SA N  
Sbjct: 298 FILTLIVPYNDKLI---ATGTGTARSSPFVIAMNRAGIKVLPHIVNALILTSAWSAGNLA 354

Query: 383 LYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFV 442
           +   SR+L+ LA  N+APKIF +T++ GIPY  +     F  LAYM  S +SA +F +F 
Sbjct: 355 IIEGSRNLFCLATKNQAPKIFLRTSKRGIPYVGVIFISSFLPLAYMSCSKSSATVFGWFQ 414

Query: 443 NVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIK 502
            +VS   +L WI I   +I  DRA++AQG  +S   Y  P  P+ AWFS     +  L  
Sbjct: 415 ELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPYSTPMGPFAAWFSGIMSFIFLLTG 474

Query: 503 NFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQEEE 562
            F  F++  FD ++F T Y  +P+    +  +K   KTK + P +VDL +    I +  E
Sbjct: 475 GFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTKYLRPHEVDLESIFDDIKENPE 534

Query: 563 D 563
            
Sbjct: 535 H 535

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  278 bits (710), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 165/510 (32%), Positives = 262/510 (51%), Gaps = 15/510 (2%)

Query: 34  EELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXX 93
            ELI D L+   ++ +   E          +   +K+ALK RH++M              
Sbjct: 66  SELIPDCLQSATNTGTLCTEE-------HVKHRSVKRALKPRHIAMIALGGTIGTGLFMG 118

Query: 94  XXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAV 152
                    PV  LIAY FVG ++F     LGEM T+IP+   FT ++ R+  PA G A 
Sbjct: 119 IAKPLRNAGPVGALIAYIFVGTIIFSVTQSLGEMVTFIPVTSSFTVFSHRFLSPAFGAAN 178

Query: 153 GYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXX 212
           GY Y F + +    +L+    VIQ+W     V    W+ IF  ++   N           
Sbjct: 179 GYMYWFSWAMTFAVELSVLGKVIQFWTTA--VPLAAWIVIFWFLLTLSNMFPVKYYGEIE 236

Query: 213 XWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAF 272
            W++  KV                  P H   GFRYWR PG++            RF+ +
Sbjct: 237 FWIAFLKVLSLVGFLIFCLCITSGAGP-HGPFGFRYWRDPGAWGPGIIAEDQSEARFLGW 295

Query: 273 VSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYD 332
           VS  + A + Y G EL GI A EA NPRK++PKAIK  + RI+ FY+ S+F +GM V ++
Sbjct: 296 VSSLINAAFTYQGTELVGITAGEAANPRKAVPKAIKKVILRILFFYVGSLFFIGMLVPFN 355

Query: 333 DPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYS 392
           DP L             PF++AI NSG++ LP I N  +L+ + SA NS++YV SR L+ 
Sbjct: 356 DPKL---TSATSFVSSSPFIIAIQNSGVSLLPSIFNGVILITIISAGNSNVYVGSRILFG 412

Query: 393 LAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILS 452
           LA  N AP+ F +T + G+P+ A+  + LF  LA++ +++   K+FN+ +++V+I G  +
Sbjct: 413 LAHSNLAPQFFTRTTKTGVPFVAVLFTSLFGSLAFLELTTDGDKVFNWLLSIVAIAGFFA 472

Query: 453 WISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQF 512
           W+ I +++I F +A+  +G+ +++  + A F P+ A+++  F  LI LI+ FT F   +F
Sbjct: 473 WLLISLSHIRFMKALEYRGISRNSLPFKAIFMPWLAYYATAFIILIILIQGFTAF-APRF 531

Query: 513 DYKNFITGYIGLPVFFFCYFGYKFTYKTKV 542
           +  +F+  YI L +F   +  ++   K ++
Sbjct: 532 NVSDFVASYISLLLFVIIWGVFQAMKKCRI 561

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  276 bits (707), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 171/543 (31%), Positives = 274/543 (50%), Gaps = 15/543 (2%)

Query: 33  EEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXX 92
           E+  +  + ++N  + +   EN S N   K E   +K+ L  RH++M             
Sbjct: 27  EQHDLQGNEDKNTPTTTPSKENVSEN--EKDEYHEVKRDLSKRHIAMIALGGTIGTGLFL 84

Query: 93  XXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFA 151
                     PV +LIAY F+G +V+     LGEMAT+IP+   FT ++ R+  PALG A
Sbjct: 85  GIANPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAA 144

Query: 152 VGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXX 211
            GY Y F + +    +L+    +IQ+W     V    W++IF V++   N          
Sbjct: 145 NGYMYWFSWAMTFALELSVVGQIIQFWT--FAVPLPAWISIFWVILTISNLFPVRIYGEI 202

Query: 212 XXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVA 271
             W++  KV                       +GFRYWR+PG +     +      RF+ 
Sbjct: 203 EFWIAFLKVNAILGFIIYCFCIVCGAG-KTGPVGFRYWRNPGPWGTGIISSNIAEARFLG 261

Query: 272 FVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAY 331
           + S  + A + + G EL GI A EA NPR+++PKAI+  ++RI++FY++S+F +G+ V Y
Sbjct: 262 WASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPY 321

Query: 332 DDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLY 391
           DD   +            PF++AI NSG   LPHI N  +LV + SA NS++Y+ SR L+
Sbjct: 322 DD---VKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLF 378

Query: 392 SLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGIL 451
            LA +   PK+FAKT + G+P +A+  + LF  LA+M  S+   + F + +NVV + G  
Sbjct: 379 GLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFF 438

Query: 452 SWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQ 511
           SW+ I   +I F + ++++G+ ++   + A F PY A+++     +I   + FT F   +
Sbjct: 439 SWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAF-APK 497

Query: 512 FDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQEE-EDGKMADAE 570
           FD  NF   YI + +FF  +  ++  +K + +  L VD+   K   D+ E ED    D  
Sbjct: 498 FDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL-VDIDIDK---DRREIEDRVWQDTT 553

Query: 571 KAE 573
            A 
Sbjct: 554 PAN 556

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  275 bits (703), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 168/498 (33%), Positives = 250/498 (50%), Gaps = 11/498 (2%)

Query: 66  TRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLG 125
           T+LK+ LK RH+ M                       PV  LIAY FVG++V      + 
Sbjct: 42  TKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIA 101

Query: 126 EMATYIPLDGFT-SYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKV 184
           E+A+++P  G T  +A ++ D ++GF  G+  +  Y  L P +L+A A++++YW D   +
Sbjct: 102 EVASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMRYWTD---I 156

Query: 185 NPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRL 244
           +P V++TIF V+ V  N                 K+                     +RL
Sbjct: 157 SPAVFITIFGVLFVVTNIYTIRFYGEVEYVFGWLKLILIFILIISGLVIDLGGVKGQERL 216

Query: 245 GFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIP 304
           GF YWR PG F EY   + G  G+FV F S      Y+Y GI+   I+A E +N R +I 
Sbjct: 217 GFHYWRDPGPFAEY--IVGGSIGKFVGFWSALSSVVYSYSGIQNIAILAGETKNSRHAIY 274

Query: 305 KAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALP 364
              K    RI++ YL+++F+L + V Y+D L+             PFV+A+  +GI  LP
Sbjct: 275 HGAKNVFLRIIVLYLVTVFVLTLIVPYNDALI---ASGTGTAKSSPFVIAMNRAGIKVLP 331

Query: 365 HIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCL 424
           HI+NA VL   +SA N  +   SR+L+ LA  N+APKIF KT++ GIPY  +     F  
Sbjct: 332 HIVNALVLTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPYVGVIFISCFLP 391

Query: 425 LAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQ 484
           LAYM  S +S+ +F +F  +VS   +L WI I   +I  DRA++AQG  +S   Y  P  
Sbjct: 392 LAYMSCSESSSTVFGWFQELVSSNTLLRWILISANHIYMDRALKAQGYSRSDLPYSTPIA 451

Query: 485 PYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVID 544
           PY AWFS     +  L   F  F++  FD ++F T Y  +P+    +  +K   KT+ + 
Sbjct: 452 PYAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTRYLR 511

Query: 545 PLKVDLYTFKAAIDQEEE 562
           P +VDL +    I +  E
Sbjct: 512 PEEVDLASIFDDIRENPE 529

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  276 bits (705), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 177/560 (31%), Positives = 282/560 (50%), Gaps = 26/560 (4%)

Query: 42  ERNISSASSQDE-NDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXX 100
           E +++S S+  E N S     ++    LKK LK+ H+ +                     
Sbjct: 25  ELDLTSYSNDSEKNGSLPNKPQSGDHNLKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYK 84

Query: 101 XXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL--------DGFTSYASRYCDPALGFAV 152
             P    I+Y  +  +++  M  L EM  ++P            ++  +RY D +LGFAV
Sbjct: 85  CGPAGLFISYCIMSTIIYPVMNALAEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAV 144

Query: 153 GYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXX 212
           G+ Y++ Y IL   + TAA+ V+ YW     V    W+TIFL +IV +N           
Sbjct: 145 GWNYVYCYVILVAAECTAASGVVTYWT--TAVPKAAWITIFLGIIVVLNCTAVEFYGTSE 202

Query: 213 XWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAF 272
               S K+                  P+HDRLGFR+W+ PG++  +     G  GR    
Sbjct: 203 AIFCSLKIFCILGIIIVSIVLFFGGGPNHDRLGFRFWKDPGAWAYH--LADGGAGRLSDI 260

Query: 273 VSVFVYATYAY-LGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAY 331
           ++  + A +A+ LG EL  + + EAQ+ R++I KA +  ++R++ FY +S    G+ V+ 
Sbjct: 261 ITGVIRAGFAFILGPELVVLTSTEAQDSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSR 320

Query: 332 DDPLLIXXXXXXX-XXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSL 390
           +DP+L+             PFV+ I N+GI  LPHIIN C+L   +S+ NS +Y ++RSL
Sbjct: 321 NDPVLLNALSQGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMYATTRSL 380

Query: 391 YSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGI 450
            SL+ +  APKIF + NRWG+PY  ++ +  F  LAY+ VSS++A +FN+F N+ +I G 
Sbjct: 381 LSLSQEGYAPKIFNRVNRWGVPYTGVAFATAFSCLAYLNVSSSTADVFNWFSNISTISGF 440

Query: 451 LSWISILITYICFDRAVRAQGV-DKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLN 509
           L WI   + Y+ F +AV    + D+  F    PFQPY  WF +    +I LI  +  F+ 
Sbjct: 441 LGWICSGVAYLRFRKAVFFNNLYDRLPFK--TPFQPYFTWFYIILIAIICLINGYESFV- 497

Query: 510 HQFDYKNFITGYIGLPVFFFCYFGYKF---TYKTKVIDPLKVDLYTFKAAIDQEEEDGKM 566
             ++YK+FI  YI LP+F   + G+K    T+   +I   ++D+ T    + + EE+ K 
Sbjct: 498 -HWNYKDFIAAYITLPLFLILWLGHKAYTRTWSQWMISVSEIDVTT---GLREIEEETKE 553

Query: 567 ADAEKAERIKQNGKNFEWFY 586
            +A +        K  EW +
Sbjct: 554 LNARRIPPRNLWEKILEWLF 573

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  275 bits (704), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 175/528 (33%), Positives = 268/528 (50%), Gaps = 17/528 (3%)

Query: 38  NDDLERNISSASSQ--DENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXX 95
            D +E +    SS+  D  +S   +G    T +K+ALK RHVSM                
Sbjct: 41  EDSIELSDVQVSSELYDHAESEEGEGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIA 100

Query: 96  XXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGY 154
                  PV +LIAY F+G +V+F    LGEMAT+IP+    T ++ R+  PA G A GY
Sbjct: 101 KPLSLSGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGY 160

Query: 155 AYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXW 214
            Y F + I    +L+    +I YW D   V    W+ IF V++ + N             
Sbjct: 161 MYWFNWAITYAVELSVLGQIINYWTDA--VPLAAWIAIFWVLLTAANFFPVKWYGEFEFC 218

Query: 215 LSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVS 274
           ++S KV                       +GFRYWR+PG +   +     +  RF+ +V 
Sbjct: 219 VASIKVIAIVGYLLYALIIVCGGS-SQGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVG 277

Query: 275 VFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDP 334
             V A++ Y G EL GI A EA NPRK++PKAI    +RI++FY+ S+F +G+ V Y+ P
Sbjct: 278 SLVNASFTYQGTELVGITAGEASNPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSP 337

Query: 335 LLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLA 394
            L             PFV++I N+G   LP I NA VLV + SA NS++YV SR LYSLA
Sbjct: 338 QL---ESNSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLA 394

Query: 395 IDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWI 454
           +   APK F+   + G+PY  +  + L  LLA++  +  +   FN+ +N+ ++ G+ +W 
Sbjct: 395 LSGNAPKQFSYVTKQGVPYLGVICTALLGLLAFLATNENANTAFNWLINISTLAGLCAWF 454

Query: 455 SILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDY 514
            I + +I F + ++ +G+ + +  + A   P+GA+++ FF  LI  I+ FT F   +FD 
Sbjct: 455 FISVAHIRFMQCLKLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFIQGFTAFA-PRFDV 513

Query: 515 KNFITGYIG----LPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAID 558
             F T YI     + +F  C   Y+  + TK+ D   +D+ + +  ID
Sbjct: 514 SEFFTAYISLILLVVLFILCQLYYRCRFLTKIED---IDIDSDRREID 558

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  271 bits (694), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 153/460 (33%), Positives = 253/460 (55%), Gaps = 8/460 (1%)

Query: 103 PVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYF 161
           PV  LI+Y F+G +++     LGEMAT+IP+   F+ +A R+  PALG   GY Y   + 
Sbjct: 25  PVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWC 84

Query: 162 ILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVX 221
                +L+    +IQYW D   ++   W+ IF  ++  +N             ++S KV 
Sbjct: 85  FTFALELSVLGQIIQYWTDAVPLS--AWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVI 142

Query: 222 XXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATY 281
                                 +GFRYWR+PG++     +   + GRF+ +VS  + A +
Sbjct: 143 ALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAF 202

Query: 282 AYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXX 341
            Y G EL GI A EA NPRK++P+AIK  + RI++FY++S+F +G+ V Y+DP L     
Sbjct: 203 TYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKL---DS 259

Query: 342 XXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPK 401
                   PF+++I NSG   LP I NA VL+ + SA NS++Y+ SR LYSL+ ++ AP+
Sbjct: 260 DGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLAPR 319

Query: 402 IFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYI 461
             +   + G+PY+A+  + +F  LA++  S+ S K FN+ +N+  + G  +W+ I  ++I
Sbjct: 320 FLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHI 379

Query: 462 CFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGY 521
            F +A+  +G+ ++   Y A   PY A+++ FF  LI LI+ FT F    F   +F+  Y
Sbjct: 380 RFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAF-APSFQPVDFVAAY 438

Query: 522 IGLPVFFFCYFGYKFTYKTKVIDPLK-VDLYTFKAAIDQE 560
           I + +F   +F ++  +K  +I  L+ VD+ + +  I+++
Sbjct: 439 ISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEEQ 478

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  271 bits (693), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 161/541 (29%), Positives = 274/541 (50%), Gaps = 12/541 (2%)

Query: 31  IQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXX 90
           I++ + + +D+E    + ++ +  + +  +G  + T +K+ALKARH+SM           
Sbjct: 18  IKKGKTLENDIELQSVTPATGEFPEDHTEEGDYQETEVKRALKARHISMIALGGTIGTGL 77

Query: 91  XXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALG 149
                       PV +L+AY F+G +V+     LGEMAT+IP+    T ++ R+  PA G
Sbjct: 78  FIVIASPLRTAGPVGSLLAYIFIGTVVYSITQSLGEMATFIPVTSSVTVFSKRFLSPAFG 137

Query: 150 FAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXX 209
            A GY Y F + I    +L+    +IQYW D+  +    W+ IF V++  +N        
Sbjct: 138 VANGYMYWFNWAITFAVELSVVGQIIQYWTDRVPI--AAWIVIFWVLVTLVNFFPVRFYG 195

Query: 210 XXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRH-PGSFKEYSETITGDTGR 268
               W++S KV                       +G       P      S   T     
Sbjct: 196 EIEFWIASVKVLTIVGYLIYAFIIVCGGS-KQGPIGLPATGGIPARGARASSRTTRKRHG 254

Query: 269 FVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMC 328
           F+ +VS  + A + Y G EL GI A E+ NPRK++PKAI    +RI+ FY+ S+  +G+ 
Sbjct: 255 FLGWVSSLIKAAFTYQGTELVGITAGESTNPRKNVPKAINKVFFRILFFYIGSLLFVGLL 314

Query: 329 VAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSR 388
           V YDDP L             PFV++I N+G   LP I NA VL+ V SA NS++Y+ SR
Sbjct: 315 VPYDDPRL--NSESSTDVNASPFVISIKNAGTKILPDIFNAVVLITVISAANSNVYIGSR 372

Query: 389 SLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIF 448
             YSLA+   APK  A   + G+PY+ + ++ L  L++++ ++  ++  F++ VN+ ++ 
Sbjct: 373 VAYSLALAGNAPKQLAFVTKQGVPYFGVLITSLMGLMSFLVLNHNASTAFDWLVNISTLA 432

Query: 449 GILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL 508
           G+ +W+ I + +I F + ++ +G+ +    + A F P+ A+++ FF  +I  I+ +T F 
Sbjct: 433 GLCAWLFISLAHIRFMQCLKHRGISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGYTAF- 491

Query: 509 NHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLK-VDLYTFKAAIDQ---EEEDG 564
             +FD   F T YI L +    + G +  YK + +  ++ +D+ + +  ID    EE++ 
Sbjct: 492 TPKFDVTTFFTSYISLFLMLLVFIGCQIYYKCRFLWAVEDIDIDSDRREIDAIVWEEDEP 551

Query: 565 K 565
           K
Sbjct: 552 K 552

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  271 bits (692), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 154/493 (31%), Positives = 255/493 (51%), Gaps = 7/493 (1%)

Query: 50  SQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIA 109
           + + ++  ++  K   + +K+ LK RHV+M                       PV +L+A
Sbjct: 31  NHNTSEVESLCEKPNQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLA 90

Query: 110 YAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQL 168
           Y FV  + +     LGEMAT+IP+   FT +ASR+  PALG A GY Y   + I    ++
Sbjct: 91  YIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEI 150

Query: 169 TAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXX 228
           +    +I YW D   +    W+ IF V++ +IN            W++S KV        
Sbjct: 151 SVIGRLILYWSDAVPIT--AWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLF 208

Query: 229 XXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIEL 288
                         R+GFRYW+ PG +     +    T +F+ +VS  + A + + G EL
Sbjct: 209 YGLVVVCGGS-KLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTEL 267

Query: 289 TGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXX 348
            G+ A E +NPR+++PKAI    +RI++FY+ S+ ++G+ V YDDP LI           
Sbjct: 268 VGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANAS 327

Query: 349 XPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNR 408
            PFVVAI  +G   LP I+N  ++V + SA NS++YV SR LY L     AP   ++T  
Sbjct: 328 -PFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTS 386

Query: 409 WGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVR 468
            G+PY A+  + +F  L Y+ VSS S  +F++ +++ ++ G  +W+ I +++I F + ++
Sbjct: 387 RGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLK 446

Query: 469 AQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFF 528
            +G+ +    + A F PYGA+++ FF  +I L++ FT F    F   +F+  YI   +F 
Sbjct: 447 KRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAF--TPFSAVDFVAYYISAFIFV 504

Query: 529 FCYFGYKFTYKTK 541
             +  ++F +K +
Sbjct: 505 VIWLLFQFLFKGR 517

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  271 bits (694), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 170/571 (29%), Positives = 281/571 (49%), Gaps = 45/571 (7%)

Query: 31  IQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXX 90
           I  EELIN+D  +N                      +LK+ L ARH+ +           
Sbjct: 87  IISEELINEDGRKN----------------------KLKQGLNARHIQLIALGGCIGTGL 124

Query: 91  XXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSYAS------RYC 144
                       P   + +Y  +  +V+  M  LGEM  Y+P DG  S  S      RY 
Sbjct: 125 FVGAGITLNKCGPAGLVASYLIISTMVYPIMNVLGEMVCYLPGDGSDSAGSVPHLVKRYL 184

Query: 145 DPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPG-VWVTIFLVVIVSINXX 203
           D +L FA G+ Y + + +L   + TAA+ V++YW    KV P   W+ +F ++I  +N  
Sbjct: 185 DDSLSFAAGWNYYYCFVMLVAAECTAASGVVEYWT---KVVPKPAWIVMFQLIIFGLNMC 241

Query: 204 XXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETIT 263
                     W +  K+                  P+HDRLGFRYW  PGSF   + TIT
Sbjct: 242 PVRVYGESEFWFAISKILCIVGLIILSFILFWGGGPNHDRLGFRYWITPGSF---ANTIT 298

Query: 264 -GDTGRFVAFVSVFVYATYAY-LGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLIS 321
            G  G F+      +   +++ LG EL  + ++E  +PR++I KA K  ++R++ FY++ 
Sbjct: 299 NGSFGNFLDVYKGIILGAFSFILGPELVVLPSSECSDPRRNIKKASKRFIWRLMFFYILG 358

Query: 322 IFLLGMCVAYDDPLL-IXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACN 380
              + + V+Y+DP+L              PFV+ I N+GI+ LPHIIN C+L+  +S+ N
Sbjct: 359 TLSISVIVSYNDPILSTALIQDKPGAGSSPFVIGIQNAGIDVLPHIINVCILISAWSSGN 418

Query: 381 SDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNY 440
           + L+ SSRSL ++AI+++APK   K NR+G+PY A+ VS++   +AY+  S +++ +F +
Sbjct: 419 AYLFASSRSLQTMAINSQAPKCLGKINRFGVPYVAVIVSIILSCIAYLNCSKSTSDVFKW 478

Query: 441 FVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIAL 500
           F N+ +I G L WI + +TY+ F +A+   G+ K    Y    QPY   +SL    +I +
Sbjct: 479 FTNLSTISGFLGWIIVSVTYLRFRKAIEYHGM-KDRLPYTTWGQPYLIIYSLISFIIITI 537

Query: 501 IKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKF-TYKTKVIDP-----LKVDLYTFK 554
              F + +   ++  +FI  Y+ LP+F   + G+KF  Y+ K+         +V+     
Sbjct: 538 TNGFDILIPRNWNVSDFIAAYLTLPIFLMIWIGHKFYKYRFKIFTRQCRWWYQVEDIDVI 597

Query: 555 AAIDQEEEDGKMADAEKAERIKQNGKNFEWF 585
             +++ E + +  ++E  +     GK  +W 
Sbjct: 598 TGLEEIEMESEKFESEYVKPETVGGKFVDWL 628

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  271 bits (694), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 169/546 (30%), Positives = 266/546 (48%), Gaps = 19/546 (3%)

Query: 24  KKEFKLPIQ-----EEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVS 78
           K+ F+L +      E   I+D + +N  S  SQ  +    I         ++ L  R VS
Sbjct: 76  KEAFELNVTSLEEGETATIDDFVLQNRDSPKSQSLSLEERIA--------RRKLLPRQVS 127

Query: 79  MXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDG-FT 137
           M                       P S LIA+    ++      C+  M TY+P+ G F 
Sbjct: 128 MIGIGGAIGTALFVSIGTKIIQGGPGSLLIAFCLWSVVFIGLSKCMCVMVTYLPVTGSFV 187

Query: 138 SYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVI 197
            +  R+ D + GFAVG+ Y          ++TA  LV++YW DK  +     +++ +++ 
Sbjct: 188 HFTERFVDQSCGFAVGWTYFVCQAANVCFEITAVCLVVEYWTDK--IPKAALISMLIILF 245

Query: 198 VSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKE 257
            S+N            +LS  KV                  P H  LGF+ W +PG+F E
Sbjct: 246 GSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGNPQHTVLGFKNWSNPGAFAE 305

Query: 258 YSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIF 317
           Y     G  GRF  F+S  V+A Y + G++  G  A+EA NPRK IP + +    R++IF
Sbjct: 306 YISD--GSVGRFHGFMSCLVFALYVFWGVDYLGNAASEAMNPRKVIPSSFRKVFGRLIIF 363

Query: 318 YLISIFLLGMCVAYDDPLLIXXXXXXXXXX-XXPFVVAIINSGINALPHIINACVLVFVF 376
           Y+     +G+ + Y+DP +I             P+V A+   GI  LPHI+N  +L  + 
Sbjct: 364 YIGGAICVGILIPYNDPNMIRAIKEGAVGAGASPYVSAMKTLGIRVLPHIVNILILTSII 423

Query: 377 SACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAK 436
           SA NS LY +SR L+ LA+DN+AP+IF  T + G+P Y     ++ C LAY+ VS+++  
Sbjct: 424 SAGNSSLYSASRVLHRLALDNQAPRIFKVTTKKGVPVYCCIAVLVICGLAYLSVSNSTNN 483

Query: 437 IFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCC 496
           +  +F+NV +    + +I I ++Y+ F +   AQ VD  +  Y +   PY AW SLF+  
Sbjct: 484 VLTWFLNVETAAMAIVYIFICVSYLQFRKGCLAQNVDLKSLPYYSSSLPYLAWHSLFWLV 543

Query: 497 LIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAA 556
           L+ L+  +TVFL   +D ++F+  Y  +P F    FG+K    TK + PL++DL+T    
Sbjct: 544 LMLLVNGYTVFLKGSWDTQSFVFSYFMIPFFLVFLFGHKLYKGTKSVRPLEMDLFTGIEE 603

Query: 557 IDQEEE 562
           +  E+ 
Sbjct: 604 LADEDR 609

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score =  266 bits (680), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 173/542 (31%), Positives = 267/542 (49%), Gaps = 22/542 (4%)

Query: 32  QEEELINDDLER----NISSASSQDENDSYNIDGKTEG------TRLKKALKARHVSMXX 81
           ++EEL + +L++     +      D  +  N +   EG      TRLK+ LK RH+ M  
Sbjct: 4   EKEELPSGELKKTEAVQVCETYEADSVEPQNANEPEEGVLYNDRTRLKQGLKERHIKMLT 63

Query: 82  XXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFT-SYA 140
                                P    +AY  VG++V      + E+A+++P  G T  +A
Sbjct: 64  LVGVFGTGLFLSSGGTLKKAGPAGMFLAYVVVGIVVGCNQIAIAEVASFMPATGATIRHA 123

Query: 141 SRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSI 200
            ++ D ++GF  G+  +  Y  L P +L+A A+V++YW D   +NP VW+TIF ++ V  
Sbjct: 124 EQFIDESVGFTFGW--ISTYSSLMPGELSATAVVMRYWTD---INPAVWITIFGILFVLT 178

Query: 201 NXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSE 260
           N            +    K+                     +RLGF YWR PG F EY  
Sbjct: 179 NIYTIRFYGEVEYFFGWMKIILIIILIVTGLVIDLGGA-KQERLGFHYWREPGPFAEY-- 235

Query: 261 TITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLI 320
            + G+ G+FV F +      Y+Y GI+   I+A E +N R +I    +    RI++ YLI
Sbjct: 236 IVKGEIGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHGARNVFLRIIVLYLI 295

Query: 321 SIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACN 380
           ++ +L + V Y+D L+             P+V+AI  + I  LPHIINA +L   +SA N
Sbjct: 296 AVLVLTLIVPYNDKLI---ATGTGTAKSSPYVIAIQRANIKILPHIINAIILTSAWSAGN 352

Query: 381 SDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNY 440
             +   SR+L++LA  N+APKIF  TN+ GIPY  ++    F  L+YM VSS+SA +F++
Sbjct: 353 LAIVEGSRNLFALASKNQAPKIFLTTNKRGIPYVGIAFISAFLPLSYMSVSSSSANVFSW 412

Query: 441 FVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIAL 500
           F  +VS   +L WI I   +I  DRA++AQG  +S   +     P+ AWFS     +  L
Sbjct: 413 FQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPHSTCLGPFAAWFSGIMSLIFLL 472

Query: 501 IKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQE 560
              F  F++  FD ++F T Y  +P+    +  +K   KTK + P +VDL +    I Q 
Sbjct: 473 TGGFYNFIHGHFDIESFFTRYFIIPLAIILFTFWKLFKKTKYLRPAEVDLESIFEDIRQN 532

Query: 561 EE 562
            E
Sbjct: 533 PE 534

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  263 bits (673), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 162/515 (31%), Positives = 257/515 (49%), Gaps = 15/515 (2%)

Query: 61  GKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFT 120
           G      +K+ LK RH+ M                       PV  LI+Y F+G LV+  
Sbjct: 66  GYVHDAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSV 125

Query: 121 MACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWV 179
              LGEMAT+IP+   FT +A R+  P++G A GY Y F + +    +L+    VIQYW 
Sbjct: 126 TQSLGEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWT 185

Query: 180 DKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXP 239
               V    W++IF VVI + N            W++  KV                   
Sbjct: 186 --YAVPLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGV 243

Query: 240 DHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNP 299
               +GFRYWR+PG +     +   +  RF+ +VS  +   + Y G EL GI A EA NP
Sbjct: 244 TGP-VGFRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANP 302

Query: 300 RKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSG 359
           RK++P+AIK  ++RI+ FY+ S+F +G+ V Y+D  L             PF++AI NSG
Sbjct: 303 RKAVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDDAL---NNTDSYVASSPFIIAIKNSG 359

Query: 360 INALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVS 419
              LPHI NA +   + SA NS++YV SR L+ L+ +  APKI ++T + G+P+ A+ V+
Sbjct: 360 TPVLPHIFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVT 419

Query: 420 VLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAY 479
            +   LAYM  S+     FN+ +N+ ++ G  +W+ I +++I F +A++ +G+ +    +
Sbjct: 420 SVVGALAYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPF 479

Query: 480 VAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGY------IGLPVFFFCYFG 533
            A   P  A+++ F   +I +I+ FT F   +F   +F   Y      IG+   F   F 
Sbjct: 480 KAALMPGLAYYASFLMFVIIIIQGFTAF-APKFSGSDFAAAYISIFLFIGIWCLFQIIFR 538

Query: 534 YKFTYKTKVIDPLKVDLYTFKAAIDQEEEDGKMAD 568
            +F +K + +D +  D    +A + ++ E   + D
Sbjct: 539 CRFIHKVEDVD-IDTDRRDIEAVVWEDAEPKTVWD 572

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  262 bits (669), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 157/498 (31%), Positives = 253/498 (50%), Gaps = 13/498 (2%)

Query: 49  SSQDE-NDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTL 107
           S+ DE +    +D +++   + + LK+RHV +                       P   L
Sbjct: 31  STGDEVSQGSVLDIESQKPGIVRGLKSRHVQLIALGSAIGTGLFIGSGGALSICGPAPLL 90

Query: 108 IAYAFVGLLVFFTMACLGEMATYIPLDGFTSYASR---YCDPALGFAVGYAYLFKYFILP 164
           IAYA + L V+  M  + EM T IPL G ++  S    Y +  L F  G+   +   ++ 
Sbjct: 91  IAYAVMSLFVWSVMNQMTEMVTLIPLPGESTLYSLLKLYVNKPLSFMCGWNLFYAQAMIA 150

Query: 165 PNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXX 224
           P ++TA AL++QYW D    NP ++++IFLV+ V+I             W+SS K+    
Sbjct: 151 PAEVTACALLVQYWTDA---NPAIFISIFLVLSVAITMLPVKVFGESEFWVSSIKILTIV 207

Query: 225 XXXXXXXXXXXXXXPDHDR-LGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAY 283
                         P  +  LGF YW+ PG+FK Y   + G TG+F+AF +  + + +++
Sbjct: 208 GLIIVGVVIFFGGGPAQEHVLGFHYWKKPGAFKPY--LVEGGTGKFLAFWTAIIKSGFSF 265

Query: 284 LGI-ELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYD-DPLLIXXXX 341
           + + E+    AAEA  PR+++P+A K  +YR+ +FY+  I ++G+ V YD D LL     
Sbjct: 266 VLVPEIVSSCAAEAVAPRRNMPRACKRFIYRLALFYVFGILVVGVIVGYDNDRLLNAIAS 325

Query: 342 XXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPK 401
                   PFV+ I  +GI  LPHIINA +L   +S     LY +SR+L+S+A    AP+
Sbjct: 326 GQSSAAASPFVIGIKEAGIRVLPHIINAAILTSAYSCGTGLLYGASRTLHSMACKGDAPR 385

Query: 402 IFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYI 461
           I    N++G+PYY   ++ LFCLLAY+  S++S+ +FN+  N+ +I G +SW+ + I YI
Sbjct: 386 ILTTVNKYGVPYYCTGITSLFCLLAYLNCSNSSSVVFNWLSNIATISGFVSWVLVSIAYI 445

Query: 462 CFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGY 521
            F   +    ++     +  P+Q   A+ ++ F  ++ L   F VF+   +D  NF   Y
Sbjct: 446 RFRNVIDVLKLNDR-IPFRVPYQKPLAYLAMGFFSILTLTNGFAVFIKGNWDTSNFFAAY 504

Query: 522 IGLPVFFFCYFGYKFTYK 539
           I L      + G    YK
Sbjct: 505 ITLGFVLVLFVGSTIYYK 522

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  257 bits (657), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 157/511 (30%), Positives = 252/511 (49%), Gaps = 12/511 (2%)

Query: 69  KKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMA 128
           ++ L  R VSM                       P S LIA+    ++      C+  M 
Sbjct: 46  RRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVVFIGLSQCMCVMV 105

Query: 129 TYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPG 187
           TY+P+ G F  +  R+ D + GF+VG+ Y          ++TA  LV+++W DK  +   
Sbjct: 106 TYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFWTDK--IPKA 163

Query: 188 VWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFR 247
             ++I + +  S+N            +LS  KV                  P H  LGF+
Sbjct: 164 ALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQHKVLGFK 223

Query: 248 YWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAI 307
            W +PG+F EY     G  G+F  F+S  ++A Y + G++  G  A+EA NPRK IP + 
Sbjct: 224 NWSNPGAFAEYISK--GSAGKFHGFMSCLIFALYVFWGVDYLGNAASEAMNPRKVIPSSF 281

Query: 308 KLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXX-XXPFVVAIINSGINALPHI 366
           +    R++IFY+     +G+ V ++D  +I             P+V A+   GI  LPHI
Sbjct: 282 RKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMKTLGIGVLPHI 341

Query: 367 INACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLA 426
           +N  +L  + SA NS LY +SR L+ LA++ +APK+F  T R G+P Y     +L C LA
Sbjct: 342 VNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLFKITKR-GVPIYCCVAVLLVCGLA 400

Query: 427 YMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPY 486
           Y+ VS+++  +  +F+NV +    + +I I I+Y+ F +  +AQ +D  T  Y + F PY
Sbjct: 401 YLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKTLPYSSSFLPY 460

Query: 487 GAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPL 546
             W SLF+  L+  +  + VFL   +D ++FI  Y  +P F   + G+K   KT+ + P+
Sbjct: 461 LGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKLYKKTRFVKPV 520

Query: 547 KVDLYTFKAAIDQ-----EEEDGKMADAEKA 572
           ++DL++  A + +     EE   KM   +KA
Sbjct: 521 EMDLFSGIAELAEEDAYWEENPPKMNLLDKA 551

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  254 bits (649), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 158/498 (31%), Positives = 244/498 (48%), Gaps = 19/498 (3%)

Query: 22  LPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXX 81
           L +++ K  I E  +   +LE     + +  +   YN     + TRLK+ LK RH+ M  
Sbjct: 10  LSQEKVKSKICETNVDEQELE---CGSETAKQGVLYN-----DRTRLKQGLKERHIKMLT 61

Query: 82  XXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFT-SYA 140
                                PV  LIAY FVG++V      + E+A+++P  G T  +A
Sbjct: 62  LVGVFGTGLFLSSGGTLKKIGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHA 121

Query: 141 SRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSI 200
            ++ D ++GF  G+  +  Y  L P +L+A A++++YW D   V+P V++T+F V+ V+ 
Sbjct: 122 EQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMKYWTD---VSPAVFITVFGVLFVAT 176

Query: 201 NXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSE 260
           N                 K+                     +RLGF YWR PG F  Y  
Sbjct: 177 NIYTIRFYGEIEYVFGWLKLVLIFILIISGLVIDLGGVKGQERLGFHYWRDPGPFANY-- 234

Query: 261 TITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLI 320
            + G  G+FV F +      Y+Y GI+   I+A E +N R +I    K    RI++ YL+
Sbjct: 235 LVAGHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRYAIFHGAKNVFLRIIVLYLV 294

Query: 321 SIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACN 380
           ++F+L + V Y+D L+             PFV+A+  +GI  LPHI+NA +L   +SA N
Sbjct: 295 TVFVLTLIVPYNDKLI---ATGTGTAKSSPFVIAMNRAGIKVLPHIVNALILTSAWSAGN 351

Query: 381 SDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNY 440
             +   SR+L+ LA  N+AP+IF KT++ GIPY  +     F  LAYM  S +SA +F +
Sbjct: 352 LAIIEGSRNLFCLATKNQAPQIFLKTSKRGIPYVGVIFISSFLPLAYMSCSESSATVFGW 411

Query: 441 FVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIAL 500
           F  +VS   +L WI I   +I  DRA++AQG  +S         P+ AWFS     +   
Sbjct: 412 FQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPCSTRIAPFAAWFSGIMSVIFLF 471

Query: 501 IKNFTVFLNHQFDYKNFI 518
              F  F++  FD ++F+
Sbjct: 472 TGGFYNFMHGHFDIESFL 489

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  254 bits (649), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 157/539 (29%), Positives = 268/539 (49%), Gaps = 25/539 (4%)

Query: 34  EELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXX 93
           E +  DDLER  S     DE  S+         ++++ LK+RH+ +              
Sbjct: 35  ESIQEDDLERG-SIDVLIDEKPSH---------QMQRGLKSRHMQLIALGCAIGTGLFIG 84

Query: 94  XXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSY---ASRYCDPALGF 150
                    P   LI+Y  +   V+  M  L EM    P+ G  S    A  Y +  L F
Sbjct: 85  TGGALSTCGPAPLLISYIIMSFFVWTIMHQLTEMVVLTPIPGEASMYALARAYLNRPLSF 144

Query: 151 AVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXX 210
             G+   +   ++ P+++TA+ L+IQYW D    N  ++V+IF+V+ +++          
Sbjct: 145 MCGWNLFYAQAMIAPSEITASTLLIQYWTD---ANSAIFVSIFIVITIAVTALPVKVFGE 201

Query: 211 XXXWLSSFKVXXXXXXXXXXXXXXXXXXPD-HDRLGFRYWRHPGSFKEYSETITGDTGRF 269
              W+S  K+                  P+ H  LGF YW+HPG+FK +  T  G+TG+F
Sbjct: 202 SEFWVSMIKLITITGLIILGVVIFFGGGPNQHHVLGFHYWKHPGAFKPHIST--GNTGKF 259

Query: 270 VAFVSVFVYATYAY-LGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMC 328
           +A  +  + + +A+ L  E     +AEA  PR+++P+A    ++R+++FY+    ++G+ 
Sbjct: 260 LAVWTAIIKSGFAFILSPETLTSCSAEADRPRRNMPRAANRFVWRLMLFYIGGALVVGVT 319

Query: 329 VAYDDP-LLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSS 387
           V YD+  LL             PFV+ I   GI  LPHIINA +L   +SA  +++Y +S
Sbjct: 320 VGYDNQNLLSAIASGQSNAAASPFVIGIKEVGIKVLPHIINAAILTGAYSAGTAEMYGAS 379

Query: 388 RSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSI 447
           R L+S+A+   APKIFA+ NR+G+PYY++ V   FC LAY+  S++++++F +  N+ +I
Sbjct: 380 RMLHSMALKGNAPKIFARVNRYGVPYYSIIVPSCFCFLAYLNCSNSASQVFTWLTNISTI 439

Query: 448 FGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVF 507
            G +SW+ + ITY+ F R +    ++     +  PFQ   A+FS  F  +++L   + VF
Sbjct: 440 SGFISWVFVSITYVRFRRVIDYLDLNDR-IKFRKPFQRIFAYFSGCFFVILSLTNGYAVF 498

Query: 508 LNHQFDYKNFITGYIGLP---VFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQEEED 563
               +   +F   YI +    V F     Y   ++ + ++ ++ +L       D+EE +
Sbjct: 499 TKGNWSVSDFFANYITIGFVVVLFIMGTAYYKEWRFRDMEEIRSELIPKIDMADEEESN 557

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  254 bits (648), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 172/579 (29%), Positives = 272/579 (46%), Gaps = 24/579 (4%)

Query: 6   IPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEG 65
           +P   T   YE Y   + ++E   P    + I D  +R        +  ++  I   T  
Sbjct: 22  LPDVETGASYEHYDNYIDEEEQGPPDSRWKKIKDSFKRAEVPELDPNLTEAEKIAIATAR 81

Query: 66  TRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLG 125
           + L+  LK RH+ M                       P   LI +   G +++  +  + 
Sbjct: 82  SPLQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSVA 141

Query: 126 EMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKV 184
           E+A   P+  GFT+YA+R+ D + GFA  + Y+ ++ +  P ++ AA++ + YW   +K 
Sbjct: 142 ELAIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKY 201

Query: 185 NPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRL 244
             G +V +F VVIV IN              S  K+                  P    +
Sbjct: 202 RDG-FVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYI 260

Query: 245 GFRYWRHPGSFKEYSETITGDTG--RFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKS 302
           G RYW HPG+F        GDT   +F  F SVFV A +++ G EL G+ AAEA NPRK 
Sbjct: 261 GARYWYHPGAF-------AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKD 313

Query: 303 IPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINA 362
           +P A K   +RI +FY++ + L+GM V Y DP LI            PFV+AI N GI+ 
Sbjct: 314 VPGAAKQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAAS--PFVIAIKNQGISG 371

Query: 363 LPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLF 422
           LP ++N  +L+ V S  NS +Y  SR+L +LA     PK F+  +R G P   ++V+  F
Sbjct: 372 LPTLVNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAF 431

Query: 423 CLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAP 482
            L+A++  S    ++F++ + +  +  + +W +I + +I F RA+ AQG   +  A+ +P
Sbjct: 432 GLIAFVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASP 491

Query: 483 FQPYGAWFSLFFCCLIALIKNFTVF---LNHQFDYKNFITGYIGLPVFFFCYFGYKFTYK 539
              +GA + LF  C+I L   F V    L       +F  GY+ LP+    + G+K   K
Sbjct: 492 AGVWGAAWGLFL-CIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHKIWKK 550

Query: 540 T--KVIDPLKVDLYTFKAAID-----QEEEDGKMADAEK 571
                I    +D+ T +  +D     Q+ E+ + A A K
Sbjct: 551 NWKLFIKAEDMDIDTGRRELDLDLLRQQVEEERAALAAK 589

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  248 bits (632), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 158/550 (28%), Positives = 270/550 (49%), Gaps = 34/550 (6%)

Query: 46  SSASSQDENDSYNIDG------------KTEGTRLKKALKARHVSMXXXXXXXXXXXXXX 93
           S+ S  +E  +Y +D             + +  ++ + LK+RH+ +              
Sbjct: 33  SADSWNNEKSAYQVDQIIDVEDASMELIEGQEHQVARKLKSRHIQLIALGGAIGTGLFIG 92

Query: 94  XXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSY---ASRYCDPALGF 150
                    P   LI+Y  +   V+  M  L EM   +P+ G TS       Y +  L F
Sbjct: 93  SGGALSVCGPAPLLISYMIMSFFVWCIMNFLTEMVCMMPISGETSMFAMTGTYLNKPLSF 152

Query: 151 AVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXX 210
             G    +   ++ P+++TA A++IQYW D    N  ++++IF+VV VS+          
Sbjct: 153 MCGINLFYAMSMIAPSEITATAILIQYWTDA---NSAIFISIFIVVTVSLTMLPVHFFGE 209

Query: 211 XXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDR-LGFRYWRHPGSFKEYSETITGDTGRF 269
              W+S  K+                  P+ D+ LGF YW+HPG+F  +   + G+TG+F
Sbjct: 210 SEFWVSIIKLFCITGLVILGIVIFFGGAPNQDKVLGFHYWKHPGAFNPH--LVPGNTGKF 267

Query: 270 VAFVSVFVYATYAYLGI-ELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMC 328
           +A  +  + + ++Y+ + E+    AAEA++PR+++P+  +  +YR+ +FY+     +G+ 
Sbjct: 268 LACWTAIIKSGFSYVLVPEVVVSCAAEAKDPRRNMPRVAQRFVYRLALFYVCGSLTIGIM 327

Query: 329 VAYDDP-LLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSS 387
           V YD+  LL             PFV+ I   GI  LPHIINAC+L   +S   S LY +S
Sbjct: 328 VGYDNSRLLNAIAAGESNAAASPFVIGIQEVGIRVLPHIINACILTSAYSCGTSVLYGAS 387

Query: 388 RSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSI 447
           R L+S+A++   PKIFA TNR+G PYY+ + + +FCLLAY+  S +S+ +F +  N+ +I
Sbjct: 388 RVLHSMAVNGAVPKIFATTNRFGTPYYSTAAASVFCLLAYLNCSDSSSVVFTWLSNIATI 447

Query: 448 FGILSWISILITYICFDRAV-RAQGVDKSTF--AYVAPFQPYGAWFSLFFCCLIALIKNF 504
            G + W+ + + Y+ F + +  A   DK  F   ++ P     A+ S  F  +++L   +
Sbjct: 448 SGFVDWMLVCVVYLRFRKVIEHANLTDKMPFRKRFMKPL----AYLSCGFFAILSLTNGY 503

Query: 505 TVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKT---KVIDPLKVDLYTFKAAIDQEE 561
            VF+   ++  +F   Y  L +    Y G    YKT   + +D +  ++   K A+  EE
Sbjct: 504 AVFVADNWNVSDFFACYTTLGLAAVLYIGAAIYYKTIKLRDLDEVAAEIIP-KIAMADEE 562

Query: 562 EDGKMADAEK 571
           E G++    K
Sbjct: 563 EKGEVPIVPK 572

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  249 bits (637), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 169/570 (29%), Positives = 260/570 (45%), Gaps = 28/570 (4%)

Query: 24  KKEFKLPIQEEELINDDLERNISSASSQDEND------SYNIDGKTEGTRLKKALKARHV 77
           K+  + P Q+  L  +DLE ++++A S +  D      + N   K E   LKK++K RHV
Sbjct: 93  KRAEQQPNQQHNLA-EDLENDLTTAISMNSLDRVQNKPTGNGQMKFEEEALKKSIKPRHV 151

Query: 78  SMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIP--LDG 135
            M                       P   +I YA +G  ++  +   GEMA      L G
Sbjct: 152 VMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGEMAVVYSNLLGG 211

Query: 136 FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLV 195
           F +Y S   DP  GFAV + Y  ++  + P +L   +L I+YW     VNP  +V IF V
Sbjct: 212 FNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWT--TTVNPDAFVVIFYV 269

Query: 196 VIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSF 255
           VI+ I             + +  K+                   +   LG +YW  PG+F
Sbjct: 270 VIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGYLGAKYWHDPGAF 329

Query: 256 KEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIV 315
           +      T    RF   ++ FV A +A+   E   + AAE  NPRK+IP A K  +YR++
Sbjct: 330 RG-----TNGIQRFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRVI 384

Query: 316 IFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFV 375
             ++ +I LLG  V +D   L+            P+V+AI   G+  +PH INA +L+ V
Sbjct: 385 CIFVGTIALLGFLVPWDSDQLMGAGGSATKAS--PYVLAISIHGVRVVPHFINAVILISV 442

Query: 376 FSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASA 435
           FS  NS  Y SSR L  LA    APK F   +R G P+ A+  + LF ++A+   S    
Sbjct: 443 FSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAASPKED 502

Query: 436 KIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFC 495
           ++F + + +  +  + +WI+I +++I F RA+  QG       + A    YG++++    
Sbjct: 503 QVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSYYATIMM 562

Query: 496 CLIALIKNFTVFL-----NHQFDYKNFITGYIGLPVFFFCYFGYKFTYK--TKVIDPLKV 548
            L ALI  F V +     N   D + F   Y+ +P+    YFGYK   +     I    +
Sbjct: 563 VL-ALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRDWRLFIRAKDI 621

Query: 549 DLYTFKAAIDQEEEDGKMADAEKAERIKQN 578
           DL +++   D  EE  K  D E  E++K  
Sbjct: 622 DLDSYRQVFD--EELLKQEDEEYKEKLKNG 649

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  246 bits (628), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 151/522 (28%), Positives = 256/522 (49%), Gaps = 15/522 (2%)

Query: 51  QDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAY 110
            D+    +I+      ++ + LK RH+ +                       P   LIAY
Sbjct: 38  SDQGSYSDIENFKPPQKIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIAY 97

Query: 111 AFVGLLVFFTMACLGEMATYIPLDG---FTSYASRYCDPALGFAVGYAYLFKYFILPPNQ 167
             +   V+  M  + EM   IPL G     S A  Y +  + F  G+   +   ++ P +
Sbjct: 98  IIISFFVWSIMNQMTEMVCLIPLPGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIVPAE 157

Query: 168 LTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXX 227
           +TA AL++QYW D    N  ++++IF+VV + +             W+SS K+       
Sbjct: 158 ITACALLVQYWTDA---NSAIFISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLI 214

Query: 228 XXXXXXXXXXXPDHDR-LGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGI 286
                      P  D  LGF YW++PG+F  +     G+TGRF+A  +  + + ++++ +
Sbjct: 215 IVGIVIFFGGGPAQDHVLGFHYWKNPGAFNPH--LAEGNTGRFLAVWTAIIKSGFSFVLV 272

Query: 287 -ELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXX 345
            E     +AE   PR+++PKA +  +YR+ IFY++   ++G+ V +++  LI        
Sbjct: 273 PETVTSCSAECIAPRRNMPKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKS 332

Query: 346 -XXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFA 404
                PFV+ I  +GI  LPHIINAC+L   +S     LY SSR+LYS+A+   APKIFA
Sbjct: 333 DAAASPFVIGIQEAGIKILPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFA 392

Query: 405 KTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFD 464
           K NR+G PYY+  ++ LF  LAY+  S +++ +FN+  N+ +I G +SWI + +TYI F 
Sbjct: 393 KVNRFGTPYYSTGLASLFSFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFR 452

Query: 465 RAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGL 524
           + + A  ++     +  PFQ   A+ +  F  +++L   + VF+   ++  +F   Y+ +
Sbjct: 453 KVINALDLNDRV-PFRRPFQVPLAYLTCGFFFILSLTNGYAVFVKGNWNVSDFFASYVTI 511

Query: 525 PVFFFCYFGYKFTYKT---KVIDPLKVDLYTFKAAIDQEEED 563
               F Y    F YK    +    ++V++       D+EE +
Sbjct: 512 GFVIFLYLVGSFYYKQWTFRDFKEIEVEILPKIDIADEEERN 553

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  243 bits (621), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 164/542 (30%), Positives = 258/542 (47%), Gaps = 29/542 (5%)

Query: 45  ISSASSQDENDSYNIDGKT-EGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXP 103
           + S   + ++D    D +T   +++KK +K+RH+ M                       P
Sbjct: 40  VDSFKKKQDDDVVGYDEETGTSSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGP 99

Query: 104 VSTLIAYAFVGLLVFFTMACLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYF 161
              +I Y     +++  +   GE+   Y  + G +T+Y+S   DPALGF+V + Y  ++ 
Sbjct: 100 GGLIIGYGVASAMLYCIIQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWM 159

Query: 162 ILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVX 221
            + P QL  AA+ I+YW D    NP ++V I   +IV IN              ++ KV 
Sbjct: 160 TVFPLQLVTAAITIKYWTD---TNPDIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVL 216

Query: 222 XXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATY 281
                             +   +G RYW  PG+F          TG F     VF YA +
Sbjct: 217 MMVGFVILGIIINCGGAGNDGYIGARYWHTPGAF---------STG-FKGVCYVFCYAAF 266

Query: 282 AYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXX 341
           AY GIE+  + A+E +NPRKSIP A K  +YRI++ Y+++  ++   V YD P L     
Sbjct: 267 AYGGIEVMVLTASEQENPRKSIPSACKKVIYRILLIYMLTTLIVCFLVPYDAPEL---TS 323

Query: 342 XXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPK 401
                   PFV+AI + GI+ +PHIINA +LV V S  NS LY + R L SL+    APK
Sbjct: 324 TGSASRASPFVIAIASHGISVVPHIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPK 383

Query: 402 IFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYI 461
           +F   +R G P     V++   LLA++  S A   +F++ + +  +  +  WISI ++++
Sbjct: 384 VFNYVDRQGRPLLCFLVAMFVGLLAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHV 443

Query: 462 CFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL-----NHQFDYKN 516
            F  A++AQG       Y +    +G+WF++    L  L+  F V +       +   K+
Sbjct: 444 RFRDAMKAQGRSLGEVGYKSQTGYWGSWFAI-IVSLFVLVAQFWVAIAPIGNGGKLSAKD 502

Query: 517 FITGYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAER 574
           F   Y+  PV  F YFGYK  YK     I   +VDL + +   D++E   K  D +  E+
Sbjct: 503 FFQSYLAAPVLIFIYFGYKIYYKDWRLCIPATEVDLNSHRKIFDEDEL--KQEDLDWKEK 560

Query: 575 IK 576
           ++
Sbjct: 561 MR 562

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  243 bits (620), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 161/565 (28%), Positives = 275/565 (48%), Gaps = 46/565 (8%)

Query: 26  EFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXX 85
            F+ PI   E+   D+E     +SS++               LK  L++RH+ +      
Sbjct: 32  SFEKPIIYSEV---DIESGAKESSSRN---------------LKHGLQSRHIQLIALGGT 73

Query: 86  XXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLD-------GFTS 138
                            P + +I+Y  +  +V+  M   GEM  Y+P +       G+ +
Sbjct: 74  IGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGEMVCYLPGNDDDDESVGYCA 133

Query: 139 Y-ASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVI 197
           Y  S+Y D +LGFA  + Y + + +L   + TAA+ +++YW    K+   V + +FL VI
Sbjct: 134 YLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYWT--SKIPKAVLIFLFLGVI 191

Query: 198 VSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXP---DHDRLGFRYWRHPGS 254
             +N            W +  K+                  P   D+  +GF YW++P S
Sbjct: 192 FLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPNNEDNSFVGFHYWKNPSS 251

Query: 255 FKEYSETITGDTGRFVAFVSVFVYATYAY-LGIELTGIVAAEAQNPRKSIPKAIKLTMYR 313
           F++Y     G  G F+   +  +   +A+ LG EL  + ++E  + R++I KA +  +YR
Sbjct: 252 FRDY--VTNGSLGNFLDVYNALIKGAFAFILGPELVSLTSSECVDQRRNIAKASRRFVYR 309

Query: 314 IVIFYLISIFLLGMCVAYDDPLLIXXXXXXX-XXXXXPFVVAIINSGINALPHIINACVL 372
           ++ FY+     + + V Y+DP L+             PFV+ I N+GI  LPHIIN C+L
Sbjct: 310 LMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVIGIQNAGITILPHIINFCIL 369

Query: 373 VFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSS 432
               SA N+ L+ S+R+L ++  +  AP+IF++ NR G+PY ALS+S++   LA++  S+
Sbjct: 370 TSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVALSLSIMIACLAFLNCSA 429

Query: 433 ASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGV-DKSTFAYVAPFQPYGAWFS 491
           +SAK+F +F N+ +I G + W +  I Y+ F R +   G+ D+  F      Q Y  W+S
Sbjct: 430 SSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTIDYNGLYDRLPFKTKG--QVYLTWYS 487

Query: 492 LFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFT----YKTKVIDPL- 546
             F  ++ L   +   +   ++Y++FI  YI LPVF   YFG+        + K   P+ 
Sbjct: 488 FVFVGILILTNGYMYIIPKFWNYQDFIAAYITLPVFLVLYFGHIIYSGRWRQRKWWKPVD 547

Query: 547 KVDLYTFKAAIDQEEEDGKMADAEK 571
           ++D+ T    +++ E   K+AD E+
Sbjct: 548 EIDVVT---GLEEIELKTKIADEER 569

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  243 bits (619), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 159/534 (29%), Positives = 258/534 (48%), Gaps = 17/534 (3%)

Query: 43  RNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXX 102
           +NI+  S+ ++++  + +   +G+ L K L  RH+                         
Sbjct: 65  KNINGTSNPNDSNMLSKE-DIDGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGG 123

Query: 103 PVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYF 161
           P S +I +  V   +F  +  LGE+A   P+  GF+ Y +R+ DP++ F++   YL ++ 
Sbjct: 124 PASLVIGWVIVSTALFTVINSLGELAAAYPVVGGFSVYMTRFIDPSIAFSINLNYLVQWL 183

Query: 162 ILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVX 221
           +L P +L AA++ I+YW DK  +N   WV+IF  VI  +N             LS  K+ 
Sbjct: 184 VLLPLELVAASITIRYWNDK--INSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKIL 241

Query: 222 XXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATY 281
                            P    +G +YW  PG+F  ++        +F    SVFV A +
Sbjct: 242 AIIGFTILGIVLSCGGGPVGGYIGGKYWHDPGAFVGHTAG-----SQFKGLCSVFVTAAF 296

Query: 282 AYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXX 341
           +Y GIE+  + AAE+ +PRK+IP A K T + I   Y+  + L+G  V YDDP L+    
Sbjct: 297 SYSGIEMIAVSAAESIDPRKTIPVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSS 356

Query: 342 XXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPK 401
                   P V+AI N GI  LP ++NA +L+ V S  NS +Y  SR + S+AI    PK
Sbjct: 357 SVDVASS-PLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPK 415

Query: 402 IFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYI 461
              + ++ G P  A  V++ F L++++  S   A++F +   +  +  I  W+ I I++I
Sbjct: 416 QLGRIDKKGRPINATLVTLFFGLISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHI 475

Query: 462 CFDRAVRAQGVDKSTFAYVAPFQPYGAWFS---LFFCCLIALIKNFTVFLNHQFDYKNFI 518
            F RA+  QG       Y++    YG+W+    LF   + A   +     + Q +   F 
Sbjct: 476 RFRRAMDIQGRSLEEMPYLSQVGVYGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFF 535

Query: 519 TGYIGLPVFFFCYFGYKFTYKT-KVIDPL-KVDLYTFKAAIDQE--EEDGKMAD 568
            GY+ LP+   CY G+KF +K  ++  P  ++DL + K  ID E   E+ KM +
Sbjct: 536 EGYLSLPILLACYVGHKFYFKNWRLFTPYNEIDLDSGKRDIDLELLREEKKMEE 589

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  241 bits (616), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 158/544 (29%), Positives = 261/544 (47%), Gaps = 26/544 (4%)

Query: 32  QEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXX 91
           Q+++ I   +E++I   S  D      ID     T + + LK+RHV              
Sbjct: 34  QKKDAIITAVEQDIERGSLSD------IDTIKPSTEVSRGLKSRHVQFIALGGAIGTGLF 87

Query: 92  XXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSYAS---RYCDPAL 148
                      P   LI+Y+ +   V+  M  + EM   IPL G +S AS    Y +   
Sbjct: 88  IGSGTALSSCGPAPLLISYSVMSFFVWAIMNQMTEMVVLIPLSGESSMASLAGTYLNRPS 147

Query: 149 GFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXX 208
            F  G+   +   ++ P ++TA AL+I+YW D    N  ++VTIF+++   ++       
Sbjct: 148 SFMCGWNCFYAMSMVVPTEITACALLIEYWTD---ANAAIFVTIFMILATLLSLLPVKIF 204

Query: 209 XXXXXWLSSFKVXXXXXXXXXXXXXXXXXXP-DHDRLGFRYWRHPGSFKEYSETITGDTG 267
                 +S  K+                  P  H  LGF YW  PG+F  Y   + G TG
Sbjct: 205 GESEFCVSIIKILTILGLILVGVVIFFGGGPAQHKVLGFHYWNTPGAFNSY--LVKGSTG 262

Query: 268 RFVAFVSVFVYATYAYLGI-ELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLG 326
            F+A     + + +A++ I E+T   +AEA  PRK++P+A +  +YR+ +FY++   ++G
Sbjct: 263 AFLAVWKAIIKSGFAFVMIPEITSSCSAEAAFPRKNMPRACQRFVYRLAVFYVLGCLVIG 322

Query: 327 MCVAYDDPLLIXXXXXXXX-XXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYV 385
           + V YD+  L              PFV+ I  +GI  LPHIINAC+L   +S   S+LY 
Sbjct: 323 VIVGYDNKTLNEAISSGKANAAASPFVIGIQEAGIRILPHIINACILTSAYSCSTSELYG 382

Query: 386 SSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVV 445
           +SR L+SLA+   APK F+K N++G+PYY+++ + LF +LAY+  S +S  +FN+  N+ 
Sbjct: 383 ASRVLHSLALRGDAPKFFSKVNKYGVPYYSVAATSLFGVLAYLNCSKSSLVVFNWLSNIA 442

Query: 446 SIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYG----AWFSLFFCCLIALI 501
           +I G ++W+ + ITY+ F +      ++        P++  G    A+ S  F  L+A+ 
Sbjct: 443 TISGFVNWVFVSITYLRFRKITDYLKINDRV-----PYRRRGQRALAYASAIFFALLAIT 497

Query: 502 KNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQEE 561
             F VF+   ++  +F T Y+ +      + G    YK      + V        IDQ +
Sbjct: 498 NGFYVFIAGNWNVSDFFTCYVTIGFVGVLFIGSSIYYKEWTFRDMDVVGREIMPKIDQAD 557

Query: 562 EDGK 565
           ++ K
Sbjct: 558 QEEK 561

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  241 bits (616), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 160/543 (29%), Positives = 259/543 (47%), Gaps = 33/543 (6%)

Query: 24  KKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXX 83
           K+ FK   + EE+   +L+ N++ A          I  KT  + LK  LK RH+ M    
Sbjct: 49  KESFK---RAEEM---ELDPNLTEAE--------RIAIKTAQSPLKHHLKNRHLQMIAIG 94

Query: 84  XXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASR 142
                              P   LI +   G +++  +  +GE+A   P+  GFT+YA+R
Sbjct: 95  GAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMAVGELAVVFPVAGGFTTYATR 154

Query: 143 YCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINX 202
           + D + GFA  + Y+ ++ ++ P ++ AA++ + YW    K   G +V +F VVIV IN 
Sbjct: 155 FVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGTDPKYRDG-FVALFYVVIVIINM 213

Query: 203 XXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETI 262
                        S  KV                   DH  +G +YW +PG+F       
Sbjct: 214 FGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKDHKYIGAQYWYNPGAF------- 266

Query: 263 TGDTG--RFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLI 320
            GDT   +F  F +VFV A +++ G EL G+  +EA+ PRKS+P A K   +RI +FY++
Sbjct: 267 VGDTAGQQFQGFCTVFVTAAFSFAGSELVGLAGSEAEEPRKSVPGAAKQVFWRITLFYIL 326

Query: 321 SIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACN 380
            + L+GM V  D P LI            PFV+AI+N GI  LP ++N  +L+ V S  N
Sbjct: 327 CLLLIGMLVPSDSPRLIGASSVDAAAS--PFVIAIVNHGIKGLPSVVNVVILIAVLSVGN 384

Query: 381 SDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNY 440
           S +Y  SR+L +LA     P I    +R G P   +++S  F L+A++  S     +FN+
Sbjct: 385 SAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAISAFFGLIAFVAQSKKEGDVFNW 444

Query: 441 FVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIAL 500
            + +  +  + +W  I + +I +  A+ AQG       + AP   +G+++  FF C++  
Sbjct: 445 LMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQAPAGVWGSYWG-FFMCILMF 503

Query: 501 IKNFTVFL---NHQFDYKNFITGYIGLPVFFFCYFGYKFTYKT-KVIDPLK-VDLYTFKA 555
           I  F V L     + +  +F   Y+   +F   Y  +K   +  K+  PLK +D+ T + 
Sbjct: 504 IAQFYVGLFPPGTKPNAYDFFLAYLSFCIFIALYAFHKIWKRNWKLFIPLKDLDIDTGRR 563

Query: 556 AID 558
            +D
Sbjct: 564 EVD 566

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  241 bits (614), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 158/542 (29%), Positives = 259/542 (47%), Gaps = 23/542 (4%)

Query: 47  SASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVST 106
            +++ D+ D  +   K +  +LKK +K+RHV M                       P   
Sbjct: 76  GSNNPDKEDGSDAGDKGD-NKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGL 134

Query: 107 LIAYAFVGLLVFFTMACLGEMAT-YIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILP 164
           +I YA +G  ++  +   GE+A  Y  L G F +Y S   DPALGF+V + Y  ++  + 
Sbjct: 135 VIGYAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVM 194

Query: 165 PNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXX 224
           P +L  A++ I+YW     VNP ++V IF VVI++IN            + ++FKV    
Sbjct: 195 PLELVTASITIKYWTTS--VNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMIS 252

Query: 225 XXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDT--GRFVAFVSVFVYATYA 282
                          +   +G +YW  PGSF       +GD     F   VS  V A +A
Sbjct: 253 GFLILGIIVNCGGAGNDGYIGGKYWNDPGSF-------SGDKPIDHFKGVVSTLVTAAFA 305

Query: 283 YLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXX 342
           +   E   + AAE  NPRKSIP A K  +YRI++ Y+ SI L+G  V ++   L+     
Sbjct: 306 FGATEFIALTAAEQANPRKSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGS 365

Query: 343 XXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKI 402
                  P+V+AI + G+  +PH+INA +L+ V S  NS  Y SSR L +LA    AP  
Sbjct: 366 ATHAS--PYVIAIASHGVKVVPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSF 423

Query: 403 FAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYIC 462
               +R G P  A+ +S +F L++++  S     +F + + +  +  + +W +I +++I 
Sbjct: 424 LKYVDREGRPTLAMVISSVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIR 483

Query: 463 FDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL---NHQFDYKNFIT 519
           F RA++ QG       + +    +G++++     LI + + +T        + D + F  
Sbjct: 484 FRRAMKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFE 543

Query: 520 GYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQ 577
            Y+ +P+    YFGYK   +  T  I   K+DL + +   D  E+  K  DAE  E+++ 
Sbjct: 544 NYLAMPILIALYFGYKVWKRDWTLYIPASKIDLISNRRIFD--EDVLKQEDAEYREKLRN 601

Query: 578 NG 579
           +G
Sbjct: 602 SG 603

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  240 bits (612), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 162/551 (29%), Positives = 259/551 (47%), Gaps = 32/551 (5%)

Query: 17  EYFEQLPKKEFKLPIQEEELIN-DDLERNISSASSQDENDSYNIDGKTEGTRLKKALKAR 75
           E  E L K  + + +  ++  + DD+E+ I + + +  N             L + L  R
Sbjct: 32  EVVESLTKSNYDVQVMGKKYEDMDDVEKAIFNTTKRSLN-------------LNRDLSIR 78

Query: 76  HVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-D 134
           H+                         P S +IA+  +   +F  +  LGE+A   P+  
Sbjct: 79  HLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTCLFTIVNALGELAAVFPVVG 138

Query: 135 GFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFL 194
           GF  Y +R  DP+LGFAV   YL ++ +L P +L AA++ I+YW     VN   WV +F 
Sbjct: 139 GFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITIRYW--NNSVNSDAWVAVFY 196

Query: 195 VVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGS 254
           V I   +             LS  K+                  P +  +G +YW  PGS
Sbjct: 197 VCIFLASLLDVKSFGETEFILSMVKILAIGGFTILGIVLICGGGPKNGYIGAKYWNDPGS 256

Query: 255 FKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRI 314
           F   S        +F    SVFV A ++Y G EL G+ AAE+ NPR ++PKA K T + I
Sbjct: 257 FVGASPG-----SQFKGLCSVFVTAAFSYSGTELVGVSAAESANPRYTLPKASKRTFWLI 311

Query: 315 VIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVF 374
            + YL+ + ++G  V +DDP L+            P V+AI N GI  LP ++NA +L+ 
Sbjct: 312 TLSYLLVLTIIGCLVRHDDPKLLSASSSVDVAAS-PLVIAIENGGIQGLPSLMNAIILIA 370

Query: 375 VFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSAS 434
           + S  NS +Y  SR + S+A     P+IF   +  G P  A+  +++F LL+++  S+  
Sbjct: 371 IISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVAIIFTLVFGLLSFIAASNKQ 430

Query: 435 AKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFF 494
            +IF +   +  +  +  W++I I++I F RA+  QG       Y++     G+W+    
Sbjct: 431 EEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQGYSLDELPYLSMTGVIGSWYGCVV 490

Query: 495 CCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTK---VIDPLK 547
             L+ LI +F   L    +   D+++F  GY+ LP+F FC+ G+K  YK     +I   K
Sbjct: 491 IILV-LIASFWTSLFPAGSSGADWESFFKGYLSLPIFLFCFVGHKL-YKRNWSWMIRSNK 548

Query: 548 VDLYTFKAAID 558
           +D+ T +  ID
Sbjct: 549 IDVNTGRRMID 559

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  237 bits (605), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 151/514 (29%), Positives = 246/514 (47%), Gaps = 15/514 (2%)

Query: 66  TRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLG 125
           T L K L  RH+                         P S ++ +  +   +F  +  LG
Sbjct: 41  TNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVINSLG 100

Query: 126 EMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKV 184
           E+A   P+  GF  Y +R+ DP++GFAV   YL ++ +L P +L AA+L I+YW DK  +
Sbjct: 101 ELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDK--I 158

Query: 185 NPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRL 244
           N   WV IF V IV  N             LS  K+                  P    L
Sbjct: 159 NSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGYL 218

Query: 245 GFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIP 304
           GF+YW +PG+F   +     +  +F    SVFV A +++ GIE+  + AAE++NPRK IP
Sbjct: 219 GFKYWNNPGAFVGGT-----NASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVIP 273

Query: 305 KAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALP 364
           KA K T + +   Y++ + L+G  V Y+D  L+            P V+AI N GI  LP
Sbjct: 274 KAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAAS-PLVIAIENGGIKGLP 332

Query: 365 HIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCL 424
            ++NA +L+ + S  NS +Y  SR + S+A     PK+ +K ++ G P  AL V+++F L
Sbjct: 333 SLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGL 392

Query: 425 LAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQ 484
           L+++  S    ++F +   +  +  I  W++I  + I F RA++ Q        Y++   
Sbjct: 393 LSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTG 452

Query: 485 PYGAWFSLFFCCLIALIKNFTVFL---NHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTK 541
            +GAW+ +    L+ +   +T      +   D ++F   ++ LP+   CYFG+K  +   
Sbjct: 453 IWGAWYGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYFARN 512

Query: 542 ---VIDPLKVDLYTFKAAIDQEEEDGKMADAEKA 572
               I   ++D+ + +  ID+E    +  + EKA
Sbjct: 513 WRLQIGAEEMDIDSGRKIIDEEGLKQEREEEEKA 546

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  238 bits (607), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 166/589 (28%), Positives = 267/589 (45%), Gaps = 54/589 (9%)

Query: 12  SDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQD---------------ENDS 56
           S  YE+       K+  L ++ E +  + L  ++SS  S++               E + 
Sbjct: 2   SSSYEKDISD--GKDAHLRVESEFISQEPLSHDLSSTGSEEHKKGKVWTRFVDSFRERER 59

Query: 57  YNIDG----------KTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVST 106
             +D           +T  + L+  LK RH+ M                       P   
Sbjct: 60  LEVDPNMSELDQIAFRTANSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGI 119

Query: 107 LIAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPP 165
           LI +   G +++  +  LGE+A   P+ G FT+YA+R+ D + GFA    Y+ ++ ++ P
Sbjct: 120 LIGWGLTGTMIYSMVMALGELAVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLP 179

Query: 166 NQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXX 225
            ++ AA++ + YW    +   G +V +F + I  IN              S  KV     
Sbjct: 180 LEIVAASITVNYWGTNPRYRDG-FVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVG 238

Query: 226 XXXXXXXXXXXXXPDHDRLGFRYWRHP-GSFKEYSETITGDTG--RFVAFVSVFVYATYA 282
                        P    +G RYW HP G+F        GD+   RF    SVFV A ++
Sbjct: 239 FIILGIILNCGGGPVKGYIGGRYWHHPYGAF-------VGDSAGARFKGVCSVFVTAAFS 291

Query: 283 YLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXX 342
           + G EL G+ +AE  NPRKS+PKA K   +RI +FYL+++ ++G+ V Y +  LI     
Sbjct: 292 FAGSELVGLASAETANPRKSVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSV 351

Query: 343 XXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKI 402
                  PFV+AI   GI  LP ++N  +L+ V S  NS +Y  SR+L +LA  N  PK 
Sbjct: 352 DAAAS--PFVIAITTHGIRGLPSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKF 409

Query: 403 FAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYIC 462
           F   +R G P Y++ V+  F L+A++  S    ++FN+ + +  +  + +W  I + +I 
Sbjct: 410 FGYIDRSGRPLYSILVTSGFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIR 469

Query: 463 FDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL---NHQFDYKNFIT 519
           F +A+ AQG      ++V+P   YG+++ LF   L+  I  F V L     + + K F  
Sbjct: 470 FRKALSAQGRGTDELSFVSPAGVYGSYWGLFMIILM-FIAQFYVALFPPGAKPNAKAFFE 528

Query: 520 GYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQEEEDGKMAD 568
            Y+  P+   CY G+K   K   I         F  A D + + G+  D
Sbjct: 529 AYLSFPIVIACYLGHKIYKKNWKI---------FIKAEDMDIDTGRKDD 568

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  238 bits (606), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 169/559 (30%), Positives = 270/559 (48%), Gaps = 36/559 (6%)

Query: 25  KEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXX 84
           ++FK   +  E++  +L+ N++ A          I   T  + LK+ LK RH+ M     
Sbjct: 44  QDFKNSFKRMEVV--ELDPNLTEAE--------KIAIATANSPLKRHLKNRHLQMIAIGG 93

Query: 85  XXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRY 143
                             P   LI +A  G +++  +  +GE+A   P+ G FT+YA+R+
Sbjct: 94  AIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAMGELAVTFPVSGGFTTYATRF 153

Query: 144 CDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXX 203
            D + G+A  + Y+ ++ ++ P ++ AA++ + YW    K   G +V +F VVIVSIN  
Sbjct: 154 IDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDPKYRDG-FVALFYVVIVSINMF 212

Query: 204 XXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETIT 263
                       S  KV                  P    +G   W +PG+F        
Sbjct: 213 GVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGYIGGANWHNPGAF-------V 265

Query: 264 GDTG--RFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLIS 321
           G+T   RF    SVFV A +++ G EL G+ +AE  NPRKS+P+A K   +RI +FY+IS
Sbjct: 266 GNTAGKRFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLPRAAKQVFWRITLFYIIS 325

Query: 322 IFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNS 381
           + L+G+ V Y+D  LI            PFV+AI N GI  LP ++N  +L+ V S  NS
Sbjct: 326 LCLIGLLVPYNDTRLIGASSVDAAAS--PFVLAIKNHGIKGLPSVVNVVILIAVLSVGNS 383

Query: 382 DLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYF 441
            ++  SR+L +LA     PKIF   +R G P   +  +  F LL+++  S    ++F++ 
Sbjct: 384 AVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLLSFIAASPKEGEVFDWL 443

Query: 442 VNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALI 501
           + +  +  + +W++I I ++ F RA+ AQG      ++V+   P G W S++   LI LI
Sbjct: 444 LALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVS---PAGVWGSIYGTVLIMLI 500

Query: 502 --KNFTVFL---NHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTK---VIDPLKVDLYTF 553
               F + L       D K+F   Y+ LPV    Y G+K  YK      I    +D+ T 
Sbjct: 501 LAAQFWIALFPIGSPPDAKDFFESYLSLPVVLVMYIGHK-CYKRNWKLFIRAENIDIDTG 559

Query: 554 KAAIDQEEEDGKMADAEKA 572
           +  +D E    ++A+ EKA
Sbjct: 560 RREVDIEALKVELAE-EKA 577

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  237 bits (605), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 151/530 (28%), Positives = 255/530 (48%), Gaps = 17/530 (3%)

Query: 38  NDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXX 97
            D  +R  S     +  D+  I   T  + L++ LK RH+ M                  
Sbjct: 54  KDSFKRMDSVDLDPNLTDAQKIAILTSQSPLQRKLKNRHLQMIAIGGAIGTGLFIGSSKA 113

Query: 98  XXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAY 156
                P   LI +  +  ++      LGEMA   P+ G +T+YA+R+ D + GFA    Y
Sbjct: 114 LRTAGPAGILIGWGLMATMILCMCLSLGEMAVTFPVSGGYTTYATRFIDESYGFANNINY 173

Query: 157 LFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLS 216
           + +  ++ P ++ AA++ + YW  K +     +V +F + IVSIN              S
Sbjct: 174 MMQALVVLPLEIVAASITVDYWGPKSQYR-AAFVALFWLCIVSINMFGVKGYGEAEFVFS 232

Query: 217 SFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTG--RFVAFVS 274
             KV                  P H+ +G ++W +PG+F        GDT   +F    S
Sbjct: 233 LIKVVTVIGFIILGVILVCGGGPTHEYIGSKFWSNPGAF-------VGDTAGQKFKGICS 285

Query: 275 VFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDP 334
           VFV A +++   EL G+ AAE ++PRKS+PKA K   +RI +FY++S+ ++G+ V Y DP
Sbjct: 286 VFVTAAFSFANTELVGLAAAETEDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYTDP 345

Query: 335 LLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLA 394
            L+            PFV+A+ N GI  LP +IN  +L  V S  NS ++  SR L +L+
Sbjct: 346 RLLGSSIVDAAAS--PFVLALKNHGIKGLPSVINVVILTAVLSVGNSSVFSCSRCLTALS 403

Query: 395 IDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWI 454
                P +F   +R G P  ++  S  F LL ++ VS    +IF++ +++  +  +  W+
Sbjct: 404 EQGFLPNVFGYIDRKGRPLVSIIFSSAFGLLCFLAVSHQVQEIFDWMLSLSGLSSLFIWL 463

Query: 455 SILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNF-TVFLNHQF- 512
           +I + +I F +A+ AQ       A+ +P   +G+++S+F   ++ +++ +  +F  HQ  
Sbjct: 464 TISLCHIRFRKALSAQNRSIDELAFASPIGIWGSYYSVFLIIVVLILQFWIALFPGHQKP 523

Query: 513 DYKNFITGYIGLPVFFFCYFGYKFTYKT--KVIDPLKVDLYTFKAAIDQE 560
              NF   Y+ +P+    Y G+K   K    +IDP  +D+ T +  +D E
Sbjct: 524 SASNFFKAYLSMPIAVAMYLGHKIYTKNWKLLIDPKYMDIDTGRRELDIE 573

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  235 bits (599), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 160/546 (29%), Positives = 262/546 (47%), Gaps = 19/546 (3%)

Query: 39  DDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXX 98
           D  +R        +  D   I  KT  + L+  LK+RH+ M                   
Sbjct: 59  DSFKRVEVEEVDPNLTDLEKIAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGRAL 118

Query: 99  XXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYL 157
               P   LI ++  G ++F  +  LGE+A   P+ G FT+YA+R+ D + GFA  + Y+
Sbjct: 119 RTAGPAGILIGWSITGTMIFTMVMALGELAVMFPVSGGFTTYATRFIDESFGFACNFNYM 178

Query: 158 FKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSS 217
            ++ ++ P ++ AA++ + YW    +   G +V +F +V+V IN              S 
Sbjct: 179 LQWLVVLPLEIVAASITVAYWETPVRYTDG-FVALFWLVVVIINMFGVRGYGEAEFVFSI 237

Query: 218 FKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTG--RFVAFVSV 275
            KV                  P    +G RYW +PG+F        G T   +F  F SV
Sbjct: 238 IKVTAVIGFIILGIVLVCGGGPVGGYVGARYWHNPGAF-------VGSTSGQKFHGFCSV 290

Query: 276 FVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPL 335
           FV A +++ G EL G+  +EA+NPRK++P A K   +RI++FY+I + L+G  V Y+DP 
Sbjct: 291 FVTAAFSFAGSELIGLAGSEAKNPRKAVPSAAKQVFWRILLFYIICLLLIGFLVPYNDPR 350

Query: 336 LIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAI 395
           LI            PFV+AI+  GI+ LP +IN  +L+ V S  NS +Y  SR+L +L+ 
Sbjct: 351 LISSSSVDASAS--PFVIAIVTHGISGLPSVINVVILISVLSVGNSAIYSCSRTLVALSE 408

Query: 396 DNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWIS 455
               PKI +  +R G P   +++S  F L+A++  S+   ++FN+ + +  +    +W +
Sbjct: 409 QGFLPKIVSYIDRKGRPLVGIAISSTFGLIAFVAASNKQNEMFNWLLAISGLSSFFTWSA 468

Query: 456 ILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL---NHQF 512
           I I +I F  A++AQG       +V+P    G+++ LF   L+ LI  F + L       
Sbjct: 469 ICICHIRFRGALKAQGRGTDELPFVSPAGVIGSYWGLFLNILM-LIAQFYIALFPIGGSP 527

Query: 513 DYKNFITGYIGLPVFFFCYFGYKFTYKT-KVIDPLK-VDLYTFKAAIDQEEEDGKMADAE 570
               F + Y+  PV    Y  +K   K  K + PL+ VD+ T +   D      ++A+ +
Sbjct: 528 SAYEFFSAYLAAPVILAFYIAHKLWKKNWKFLIPLEDVDIDTGRRDTDVNLLKQEIAEEK 587

Query: 571 KAERIK 576
            A  ++
Sbjct: 588 AALAMR 593

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  234 bits (598), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 167/585 (28%), Positives = 278/585 (47%), Gaps = 36/585 (6%)

Query: 6   IPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEG 65
           IPSN ++   +E       ++FK   +  E +  +++ N++ A          +   T  
Sbjct: 34  IPSNGSATTNDEAGSGSKWQDFKDSFRRVEPV--EVDPNLTEAE--------KVAFVTAQ 83

Query: 66  TRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLG 125
           T LK  LK RH+ M                       P S LI +   G +++  +  LG
Sbjct: 84  TPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMALG 143

Query: 126 EMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKV 184
           E+A   P+ G FT+YA+R+ D + G+A  + Y+ ++ ++ P ++ +A++ + +W    K 
Sbjct: 144 ELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKY 203

Query: 185 NPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRL 244
             G +V +F +VIV IN              S  KV                  P+   +
Sbjct: 204 RDG-FVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYI 262

Query: 245 GFRYWRHPGSFKEYSETITGDT--GRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKS 302
           G +YW  PG+F        GDT   +F    SVFV + +++ G EL G+ A+E+ +PRKS
Sbjct: 263 GGKYWHDPGAF-------AGDTPGAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRKS 315

Query: 303 IPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINA 362
           +PKA K   +RI +FY++S+ ++G+ V Y+DP LI            PFV+AI   GI  
Sbjct: 316 VPKAAKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAAS--PFVIAIKTHGIKG 373

Query: 363 LPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLF 422
           LP ++N  +L+ V S  NS +Y  SR++ +LA     P+IFA  +R G P   ++V+  F
Sbjct: 374 LPTVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAF 433

Query: 423 CLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAP 482
            L+A++  S     +FN+ + +  +  + +W  I I +I F +A+ AQG D    ++ +P
Sbjct: 434 GLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSP 493

Query: 483 FQPYGAWFSLFFCCLIALIKNFTVFL---NHQFDYKNFITGYIGLPVFFFCYFGYKFTYK 539
              +G+++ LF   +I  I  F V L         + F   Y+  P+    Y G+K   +
Sbjct: 494 TGVWGSYWGLFM-VVIMFIAQFYVALFPVGASPSAEGFFEAYLSFPLVVAMYLGHKIYKR 552

Query: 540 T-KVIDPLK-VDLYTFKAAIDQE-------EEDGKMADAEKAERI 575
             K+  P + +D+ T +  +D E       EE   MA   K  RI
Sbjct: 553 NWKLFIPAEDMDIDTGRREVDLELLKQEIAEEKAIMATKPKWYRI 597

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  233 bits (595), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 159/594 (26%), Positives = 273/594 (45%), Gaps = 22/594 (3%)

Query: 3   IRQIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGK 62
           +R  P N   + ++   ++    E K   Q   L++  L++  +     ++  S   +  
Sbjct: 6   LRNGPLNKIVNGFKSAEDEKSILEGKSSTQSS-LLDLTLKKCDNGIEVVNDATSTVSNAS 64

Query: 63  TEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMA 122
                L K L  RH+                         P S +I +  +   +F  + 
Sbjct: 65  VTNVNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVIN 124

Query: 123 CLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDK 181
            LGEMA   P+  GF  Y +R+ DP++GFAV   YL ++ +L P +L AA++ I+YW D 
Sbjct: 125 ALGEMAAAFPVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNDT 184

Query: 182 EKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDH 241
             +N   WV IF  VI   N             LS  K+                  P  
Sbjct: 185 --INSDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPQG 242

Query: 242 DRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRK 301
             LG +YW +PGSF  ++        +F    SVFV A ++Y GIE+T + AAE+++PR+
Sbjct: 243 GYLGGKYWHNPGSFVGHTSGT-----KFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRR 297

Query: 302 SIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGIN 361
           +IPKA K T + I   Y+  + L+G  V YD+P L+            P V+AI N GI 
Sbjct: 298 TIPKAAKRTFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASS-PLVIAIENGGIK 356

Query: 362 ALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVL 421
            LP ++NA +L+ + S  NS +Y  SR + ++A     P++    ++ G P  A+  ++ 
Sbjct: 357 GLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAILFTLF 416

Query: 422 FCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVA 481
           F LL+++  S   A++F +   +  +  I  W++I I++I F +A++ Q        Y++
Sbjct: 417 FGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDELPYLS 476

Query: 482 PFQPYGAWFSLFFCCLIALIKNFTVFL---NHQFDYKNFITGYIGLPVFFFCYFGYKFTY 538
               +G+W+ +    L+ ++  +T          D ++F  GY+  P+   CY G+K  Y
Sbjct: 477 QTGVWGSWYGVIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACYVGHKLVY 536

Query: 539 KTK--VIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKFL 590
           + K  V+    +D+ T +  +D      +M   E+ E + ++      F+ +FL
Sbjct: 537 RKKQIVVALEDMDIDTGRRQVDLTIRRQEM--KEEQEHLAKSS-----FFARFL 583

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  234 bits (596), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 167/597 (27%), Positives = 269/597 (45%), Gaps = 39/597 (6%)

Query: 7   PSNSTSDQYEEYFEQLPKKEF-------KLPIQEEELIN-DDLERNISSASSQ----DEN 54
           PS+     YE++     ++ F       + P  E E    +DL   IS +S Q    ++N
Sbjct: 40  PSSQPHLGYEQHNTSAVRRFFDSFKRADQGPQDEVEATQMNDLTSAISPSSRQAQELEKN 99

Query: 55  DSYNIDGKTEGTR---LKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYA 111
           +S +  G   G +   LKK ++ RHV M                       P   LI YA
Sbjct: 100 ESSDNIGANTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYA 159

Query: 112 FVGLLVFFTMACLGEMA-TYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLT 169
            +G +++  +   GEMA  Y  L  G+ +Y S   D   GFAV + Y  ++  + P +L 
Sbjct: 160 IMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELV 219

Query: 170 AAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXX 229
            A++ I+YW     VNP V+V IF V++++IN            + +  K+         
Sbjct: 220 TASMTIKYWT--TSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFIL 277

Query: 230 XXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELT 289
                     +   +G +YW  PG+F            RF    +  V A +A+ G E  
Sbjct: 278 GIIIDVGGAGNDGFIGGKYWHDPGAFNGKHAI-----DRFKGVAATLVTAAFAFGGSEFI 332

Query: 290 GIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXX 349
            I  AE  NPRK+IP A K  +YRI+  +L +I LLG  V Y+   L+            
Sbjct: 333 AITTAEQSNPRKAIPGAAKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKAS-- 390

Query: 350 PFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRW 409
           P+V+A+ + G+  +PH INA +L+ V S  NS  Y S+R   +L+    APK+F+  +R 
Sbjct: 391 PYVIAVASHGVRVVPHFINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRA 450

Query: 410 GIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRA 469
           G P  A+ VS LF ++A+   S    ++F + + +  +  + +W +I ++++ F RA++ 
Sbjct: 451 GRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKV 510

Query: 470 QGVDKSTFAYVAPFQPYGAWFSLFFCCL--IALIKNFTVFL----NHQFDYKNFITGYIG 523
           QG       + +     G W S + C +  + LI  F V +      + D + F   Y+ 
Sbjct: 511 QGRSLGELGFKS---QTGVWGSAYACIMMILILIAQFWVAIAPIGEGKLDAQAFFENYLA 567

Query: 524 LPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQN 578
           +P+    Y GYK  +K     I   K+DL + +   D  EE  K  D E  ER++  
Sbjct: 568 MPILIALYVGYKVWHKDWKLFIRADKIDLDSHRQIFD--EELIKQEDEEYRERLRNG 622

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  233 bits (595), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 164/597 (27%), Positives = 263/597 (44%), Gaps = 39/597 (6%)

Query: 7   PSNSTSDQYEEY--------FEQLPKKEFKLPIQEEELINDDL-------ERNISSASSQ 51
           PS+     YE++        F+   + +     + E +  +DL        RN       
Sbjct: 40  PSSQPHLDYEQHNTSAVRRFFDSFKRADQGGQDESEAVQMNDLTSAISPSSRNAQGLEKN 99

Query: 52  DENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYA 111
           D  D  N     +   LKK ++ RHV M                       P   LI YA
Sbjct: 100 DSTDKINPPAGNKSGSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYA 159

Query: 112 FVGLLVFFTMACLGEMA-TYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLT 169
            +G +++  +   GE+A  Y  L  G+ +Y S   D   GFAV + Y  ++  + P +L 
Sbjct: 160 IMGSILYCIIQACGELALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELV 219

Query: 170 AAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXX 229
            A++ I+YW     VNP V+V IF V++++IN            + +  K+         
Sbjct: 220 TASMTIKYWT--TSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFIL 277

Query: 230 XXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELT 289
                     +   +G +YW  PG+F            RF   V+  V A +A+ G E  
Sbjct: 278 SIIIDVGGAGNDGFIGGKYWHDPGAFNGKHSI-----DRFKGVVATLVTAAFAFGGSEFI 332

Query: 290 GIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXX 349
            I  AE  NPRK+IP A K  +YRI+  +L +I +LG  V Y+   L+            
Sbjct: 333 AITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKAS-- 390

Query: 350 PFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRW 409
           P+V+AI + G+  +PH +NA +L+ V S  NS  Y S+R   +L+    APK F+  +R 
Sbjct: 391 PYVIAIASHGVRVVPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRA 450

Query: 410 GIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRA 469
           G P  A+ VS LF ++A+   S    ++F + + +  +  + +W +I  ++I F RA++ 
Sbjct: 451 GRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKV 510

Query: 470 QGVDKSTFAYVAPFQPYGAWFSLFFC--CLIALIKNFTVFL----NHQFDYKNFITGYIG 523
           QG       + +     G W S++ C   L+ LI  F V +      + D + F   Y+ 
Sbjct: 511 QGRSLGELGFKS---QTGVWGSMYACIMMLLILIGQFWVAIAPIGEGKLDAQAFFENYLA 567

Query: 524 LPVFFFCYFGYK-FTYKTKV-IDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQN 578
           +P+    Y GYK +T   K+ I   K+DL + +   D  EE  K  D E  ER++  
Sbjct: 568 MPILIALYVGYKIWTKDWKLFIRADKIDLESHRQIFD--EELIKQEDEEYRERLRNG 622

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  232 bits (592), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 169/570 (29%), Positives = 268/570 (47%), Gaps = 42/570 (7%)

Query: 38  NDDLERNISSASS-----QDENDSYN--IDGKTEGTRLKKALKARHVSMXXXXXXXXXXX 90
           +DD+    SS        Q   DS+   +DG      LK+ LKARH+ M           
Sbjct: 48  DDDIAEGHSSYQPPRNIFQRCIDSFKPPLDGSFHTHNLKRTLKARHLIMIAIGGSIGTGL 107

Query: 91  XXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALG 149
                       P++ +I ++  G  +  T+  LGE+    P+ G F +Y++R+ DP++ 
Sbjct: 108 FIGSGQALASGGPLALIIGWSIAGTQIVGTIHGLGEITVRFPVVGAFANYSTRFLDPSIS 167

Query: 150 FAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXX 209
           F +   Y+ ++F + P ++ A+A+ IQYW   + ++P VWV IF  VIVSIN        
Sbjct: 168 FVISTIYVIQWFFVLPLEIIASAMTIQYW--NQSIDPVVWVAIFYCVIVSINLFGARGFG 225

Query: 210 XXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRF 269
                 SS KV                  PDHD +G RYW  PG               F
Sbjct: 226 EAEFLFSSIKVITIIGFIILCIVLICGGGPDHDFVGARYWHDPGCLSH----------GF 275

Query: 270 VAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCV 329
              +SV V A+Y+  G E+  + + E  NPR+ +P AIK T +RI+ F+LIS+ L+G  V
Sbjct: 276 PGVLSVLVVASYSLGGTEMVCLASGET-NPRE-LPSAIKQTFWRILFFFLISLTLIGFLV 333

Query: 330 AYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRS 389
            Y +P L+            PFV+AI    I ALP I+NA +L+ + S  NS ++ SSR+
Sbjct: 334 PYTNPNLLGGSSVNNS----PFVIAIKLHHIKALPSIVNAVILISIMSVGNSCIFASSRT 389

Query: 390 LYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFG 449
           L S+A     PK F   +R G P   +  + LF LLA++  SS+  ++F++ + +  +  
Sbjct: 390 LCSMAHQGLIPKFFGYIDRAGRPLTGILTNSLFGLLAFLVKSSSMGEVFDWLMAIAGLAT 449

Query: 450 ILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL- 508
            + W+SI I++I F  A++AQG       +V+    +G+ +S     LI LI  F   L 
Sbjct: 450 CIVWLSINISHIRFRLAMKAQGKSLDELEFVSAVGMWGSAYSALINSLI-LIAQFYCALW 508

Query: 509 ------NHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTK------VIDPLKVDLYTFKAA 556
                 +     K F   Y+   +  F +  +K  Y+ K      ++D  K+DL T +  
Sbjct: 509 PIGGWKDSSERAKTFFQSYLCALIMAFLFVCHKVFYRYKTGKWWAIMDLDKIDLETDRKN 568

Query: 557 IDQEEEDGKMADAEKAERIKQNGKNFEWFY 586
           ID +    K   AE+   ++ +     W++
Sbjct: 569 IDIDVL--KQEIAERNRHLQASPWYVRWYH 596

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  232 bits (591), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 157/536 (29%), Positives = 255/536 (47%), Gaps = 35/536 (6%)

Query: 52  DENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYA 111
           D ND       T+ ++L K L  RH+                         P S +IA+ 
Sbjct: 48  DMNDVEKAIYNTKDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWT 107

Query: 112 FVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTA 170
            +   +F  +  LGE++   P+  GF  Y +R+ +P+ GFAV + YL ++ IL P +L A
Sbjct: 108 IISTCLFTIVNSLGELSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCA 167

Query: 171 AALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXX 230
           A++ I+YW   + +NP  WV+IF V I   N             LS  K+          
Sbjct: 168 ASITIRYW--NKSINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILG 225

Query: 231 XXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDT--GRFVAFVSVFVYATYAYLGIEL 288
                   P    +G +YW  PG+F        GDT   RF    +VF+ A ++Y G+EL
Sbjct: 226 IVLICGGGPSGGFIGGKYWNDPGAF-------VGDTPAQRFKGLSAVFITAAFSYSGLEL 278

Query: 289 TGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXX 348
            G+ AAE++NPR ++PKA K T + I + YL+ + L+G  V  +DPLL+           
Sbjct: 279 VGVSAAESRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAAS 338

Query: 349 XPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNR 408
            P V+AI N GI  LP ++NA +L+ + S  NS +Y  SR + S+A     P+  A  ++
Sbjct: 339 -PLVIAIQNGGIKGLPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDK 397

Query: 409 WGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVR 468
            G P YA+++++L  LL+++  S+   ++F +   +  +  +  W +I + ++ F  A++
Sbjct: 398 KGRPLYAIAITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMK 457

Query: 469 AQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGL 524
            Q        YV+    +G+W+      L+ LI +F   L     +  D  +F   Y+ L
Sbjct: 458 HQNRSLEELPYVSMTGEWGSWYGCIVIGLV-LIASFWTSLFPAGGNGADATSFFESYLSL 516

Query: 525 PVFFFCYFGYKFTYKTKV----------IDPLKVDLYTFKAAIDQEEEDGKMADAE 570
           P+F  CY G+K  +K  +          +D  + D  T  A + QE+E    A+AE
Sbjct: 517 PIFIACYLGHKI-WKRNLRLYIKLSEVDVDSGRTD--TDAATLKQEKE----AEAE 565

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  231 bits (590), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 154/544 (28%), Positives = 256/544 (47%), Gaps = 32/544 (5%)

Query: 37  INDDLERNISSASSQDEN-DSYNIDGKTE----GTRLKKALKARHVSMXXXXXXXXXXXX 91
           I+  + R I+S   + E+ D   + G+ E     T++KK++K+RH+ M            
Sbjct: 34  ISGQVNRFINSFRRKGESEDVKELKGENEECGAATKMKKSIKSRHLLMISLGTGIGTGLL 93

Query: 92  XXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMA-TYIPLDG-FTSYASRYCDPALG 149
                      P   +I YA   ++++  +   GE+   Y  + G +T+Y+S   DPALG
Sbjct: 94  VGNGKALAKAGPAGLVIGYAVASIMLYCIIQAAGELGICYSGMAGNYTAYSSLLVDPALG 153

Query: 150 FAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXX 209
           F+V + Y  ++  + P QL  AA+ ++YW +    NP ++V +F VVI+ IN        
Sbjct: 154 FSVSWVYCVQWMTVLPLQLVTAAMTVRYWTN---ANPDIFVAVFFVVIMVINMFGAKGYA 210

Query: 210 XXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRF 269
                 +  KV                       +G +YW  PGSF             F
Sbjct: 211 EAEFLFNICKVLMIAGFVILGIAINCGGAGTSGYIGAKYWHSPGSF----------AAGF 260

Query: 270 VAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCV 329
                VF YA ++Y GIE+  + A+E +NPRKSIP A K  +YRI++ Y+++  ++   V
Sbjct: 261 KGVCYVFCYAAFSYGGIEVMVLTASEQENPRKSIPNACKKVIYRILMIYMLTTIIVCFLV 320

Query: 330 AYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRS 389
            Y+   L+            P V+A+ + G+  +PHIINA +L+ V S  NS +Y + R 
Sbjct: 321 PYNSSELMGSSGESASHAS-PLVIAVASHGVKIVPHIINAVILISVISVGNSSMYSAPRL 379

Query: 390 LYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFG 449
           L SL+    APK     +R G P    ++++L  L+A++  S A   IF + + +  +  
Sbjct: 380 LLSLSEQGYAPKFLNYVDRQGRPLICFAITLLVALIAFVAASDAEEDIFAWLLAISGLSQ 439

Query: 450 ILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL- 508
           I  W SI ++++ F  A+ AQG+      Y +    +G+WF++    L+ LI  F V + 
Sbjct: 440 IFIWTSICLSHVRFRDAMHAQGLSLGQIGYKSQTGYWGSWFAIVISVLV-LIAQFWVAIA 498

Query: 509 ----NHQFDYKNFITGYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAIDQE-- 560
                 + + + F   Y+  P+    YFGYK  +K     I   +VDL + +   D+E  
Sbjct: 499 PIGEEGRLNAETFFQNYLAFPILLGAYFGYKVYHKDWRLCIPASEVDLSSHRNISDEEIL 558

Query: 561 -EED 563
            +ED
Sbjct: 559 RQED 562

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  232 bits (592), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 162/580 (27%), Positives = 261/580 (45%), Gaps = 31/580 (5%)

Query: 16  EEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQ----DENDSYNIDGKTEGTR---L 68
             +F+   K +     + E    +DL   IS +S Q    ++N+S +  G   G +   L
Sbjct: 57  RRFFDSFKKADQSAEERVETAQMNDLASAISPSSRQRQELEKNESSDNIGARTGNKSDSL 116

Query: 69  KKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMA 128
           KK ++ RHV M                       P   LI Y  +G +++  +   GEMA
Sbjct: 117 KKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQACGEMA 176

Query: 129 -TYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNP 186
             Y  L  G+ +Y S   D   GFAV + Y  ++  + P +L  A++ I+YW     VNP
Sbjct: 177 LVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS--VNP 234

Query: 187 GVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGF 246
            V+V IF V++++IN            + +  K+                   +   +G 
Sbjct: 235 DVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGG 294

Query: 247 RYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKA 306
           +YW  PG+F            RF   V+  V A +A+ G E   I  AE  NPRK++P A
Sbjct: 295 KYWHDPGAFNGKH-----SIDRFKGVVATLVTAAFAFGGSEFIAITTAEQANPRKAVPGA 349

Query: 307 IKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHI 366
            K  +YRI+  +L +I LLG  V Y+   L+            P+V+A+ + G+  +PH 
Sbjct: 350 AKQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGTKAS--PYVIAVASHGVRVVPHF 407

Query: 367 INACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLA 426
           INA +L+ V S  NS  Y S+R L +L+    AP++F   ++ G P  A+ VS LF ++A
Sbjct: 408 INAVILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVIA 467

Query: 427 YMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPY 486
           +   S    ++F + + +  +  + +W +I +++I F RA++ QG       + +     
Sbjct: 468 FCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRS---QT 524

Query: 487 GAWFSLFFCCL--IALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCYFGYKFTYK- 539
           G W S + C +  + LI  F V +      + D + F   Y+ +P+    Y GYK   K 
Sbjct: 525 GVWGSTYACIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWKKD 584

Query: 540 -TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQN 578
               I   K+DL + +   D  EE  K  D E  ER+K  
Sbjct: 585 WKLFIRADKIDLISHRQIFD--EELIKQEDEEFRERLKNG 622

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  231 bits (590), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 161/554 (29%), Positives = 268/554 (48%), Gaps = 29/554 (5%)

Query: 25  KEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXX 84
           ++FK   +  EL  ++L+ N++ A          I   T  + L++ LK RH+ M     
Sbjct: 44  QDFKDGFKRVEL--EELDPNLTEAE--------KIAIITAQSPLQRHLKNRHLQMIAIGG 93

Query: 85  XXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRY 143
                             P   LI +  +GL+++  +  +GE+A   P+ G FT+YA+R+
Sbjct: 94  AIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSMGELAVTFPVSGGFTTYATRF 153

Query: 144 CDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXX 203
            D + GFA+ Y Y+ ++ ++ P ++ AA++ + +W    K   G +V +F +VIV IN  
Sbjct: 154 VDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPKYRDG-FVALFYIVIVIINFF 212

Query: 204 XXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETIT 263
                       S  KV                  P    +G +YW +PG+F       +
Sbjct: 213 GVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYIGGKYWHNPGAF-------S 265

Query: 264 GDTG--RFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLIS 321
           GD    RF    SVFV A +++ G EL G+ +AE  NPRK++P+A K   +RI++FY+IS
Sbjct: 266 GDDAGSRFKGVCSVFVTAAFSFAGTELVGLASAETANPRKALPRAAKQVFWRILLFYIIS 325

Query: 322 IFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNS 381
           + L+G+ V +    LI            PFV+AI   GI  LP +IN  +L+ V S  NS
Sbjct: 326 LCLIGLLVPHTSERLIGTSSVDAAAS--PFVLAIQTHGIKGLPSVINVVILISVLSVGNS 383

Query: 382 DLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYF 441
            +Y  SRS+ +LA     P IFA  +R G P  A+  + +F LL+++  S     +FN+ 
Sbjct: 384 AVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLSFIAQSEKEGDVFNWL 443

Query: 442 VNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALI 501
           + +  +  + SW +I I +I F RA+ AQG      A+V+     G++F +    L+ LI
Sbjct: 444 LALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYAGIAGSYFGVILVLLV-LI 502

Query: 502 KNFTVF---LNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKT-KVIDPLK-VDLYTFKAA 556
             F V    +    + ++F + Y+  PV    Y  +K   +  K+    K +D+ T +  
Sbjct: 503 AQFWVAVWPIGGSPNAEDFFSAYLSFPVLLAFYIFHKIWKRNWKLFTRAKDIDIDTGRRE 562

Query: 557 IDQEEEDGKMADAE 570
           +D E    ++A+ +
Sbjct: 563 MDTEALRQEIAEEK 576

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  231 bits (589), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 159/552 (28%), Positives = 262/552 (47%), Gaps = 25/552 (4%)

Query: 39  DDLERNISSASSQD--EN-DSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXX 95
           D  ++++ S S     EN DS + + + +  R  K L  RH+                  
Sbjct: 40  DSKQKDLMSGSETKALENLDSTSQEVEDQDARYNKDLSVRHLLTLAVGGAIGTGLFVNSG 99

Query: 96  XXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGY 154
                  P S +I +  +   +F  +  LGE+++  P+  GF  Y SR+ +P+ GFAV  
Sbjct: 100 AALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVGGFNVYISRFVEPSFGFAVNL 159

Query: 155 AYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXW 214
            YL ++ +L P +L AA+L I+YW     +N   WV IF  +I+  N             
Sbjct: 160 NYLAQWAVLLPLELVAASLTIRYW--NHTINSDAWVAIFYTIILLANLLDVKSFGETEFV 217

Query: 215 LSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVS 274
           LS  K+                  P    +G +YW +PG+F  ++    GD  RF    S
Sbjct: 218 LSMVKILAIIGFTILGIVLTCGGGPKGGYIGGKYWSNPGAFVGHT---AGD--RFHGLCS 272

Query: 275 VFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDP 334
           VFV A ++Y G EL  + AAE+ NPR ++PKA K T + I + Y++ + L+G  V+ DDP
Sbjct: 273 VFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVSSDDP 332

Query: 335 LLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLA 394
            L+            P V+AI N GI  LP ++NA +L+ V S  NS +Y  SR + S+A
Sbjct: 333 RLLNGSSSVDVAAS-PLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMA 391

Query: 395 IDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWI 454
                PK+F   +R G P YA+  +++F LL+++  S    ++F +   +  +  +  W 
Sbjct: 392 QIGNLPKVFTYVDRKGRPLYAIVATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWF 451

Query: 455 SILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQF-- 512
           +I +++I F R ++ +G       +V+     G W S ++ C++  I     F    F  
Sbjct: 452 AINVSHIRFRRTMKERGRTLDELPFVS---MTGVWGS-YYGCIVIFIVLVVCFWTSLFPG 507

Query: 513 -----DYKNFITGYIGLPVFFFCYFGYK-FTYKTKVIDPLK-VDLYTFKAAIDQEEEDGK 565
                + ++F   Y+  P+   CYFG+K +T   +++ P K +DL + + A+D E    +
Sbjct: 508 GGEGANAESFFETYLSFPILLACYFGHKLYTRSWRLLTPTKEIDLDSGRRAVDLELMKDE 567

Query: 566 MADAEKAERIKQ 577
               E+A R K 
Sbjct: 568 KRIEEQAMRQKS 579

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  231 bits (589), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 160/554 (28%), Positives = 254/554 (45%), Gaps = 24/554 (4%)

Query: 37  INDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXX 96
           I D  +R        +  ++  I   T    LK  LK RH+ M                 
Sbjct: 64  IKDSFKRAEKEEVDPNLTEAERIAINTAKAPLKHTLKGRHMQMVAIGGAIGSGLFVGSST 123

Query: 97  XXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYA 155
                 P   +I +     +++  +  LGE+A   P+ G FT+YA+R+ D + GFA  + 
Sbjct: 124 ALRTAGPAGIVIGWGLTSTMIYCMVMALGELAVVFPVSGGFTTYATRFIDESFGFASNFN 183

Query: 156 YLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWL 215
           Y  ++    P ++ +A++ + YW   E+   G +V +F +VIV IN              
Sbjct: 184 YALQWLATLPLEIVSASITVNYWQTPERYRDG-FVALFWLVIVIINLFGVRGFGEAEFVF 242

Query: 216 SSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTG--RFVAFV 273
           S+ KV                  P+   +G RYW +PG+F        GD    +F    
Sbjct: 243 STIKVLTVIGFIILGIVLVAGGGPEGGFVGGRYWHNPGAF-------VGDNAGTQFKGVC 295

Query: 274 SVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDD 333
           SVFV A +++ G EL GI AAEA NPRKS+P+A K  ++RIV+FY+ S+ ++G+ V Y D
Sbjct: 296 SVFVTAAFSFAGSELVGITAAEAANPRKSVPRAAKQVVWRIVLFYMGSLIMIGLLVPYTD 355

Query: 334 PLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSL 393
           P LI            PFV+AI+  GI  LP +IN  +L+ V S  NS ++  SR++ +L
Sbjct: 356 PRLIGASSVDASAS--PFVIAIVTHGIRGLPSVINVVILIAVLSVGNSAIFAGSRTIAAL 413

Query: 394 AIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSW 453
           +     P+IF   +R G P   + V   F L+A++  S    ++F + + +  +  + +W
Sbjct: 414 SEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIAFIAASKKQGEVFAWLMALSGLSSLFTW 473

Query: 454 ISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL---NH 510
             I + +I F  A++AQG   +   +V+P    G+ + LF   L+  I  F V L     
Sbjct: 474 GGICLCHIRFRMALKAQGRSTNELPFVSPAGIIGSSWGLFMLLLM-FIAQFYVALFPPGS 532

Query: 511 QFDYKNFITGYIGLPVFFFCYFGYKFTYKT--KVIDPLKVDLYTFKAAID-----QEEED 563
           +   + F   Y+  P+    YFG+K   K     I    +D+ T +   D     QE E+
Sbjct: 533 KPSAEVFFESYLSFPIVLAFYFGHKIYKKNWKLFIKAEDMDIDTGRRETDLELLKQEIEE 592

Query: 564 GKMADAEKAERIKQ 577
            K   A K    +Q
Sbjct: 593 EKAILATKGWWYRQ 606

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  232 bits (592), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 157/548 (28%), Positives = 259/548 (47%), Gaps = 28/548 (5%)

Query: 23  PKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXX 82
           P+K+    I   E++ D+   ++S+   Q       I+ K++   LKK +K RHV M   
Sbjct: 107 PEKD-TASITSNEMMIDEEILSLSNLDGQRVPPPRKIENKSD--ELKKTIKPRHVLMISL 163

Query: 83  XXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIP--LDGFTSYA 140
                               P   L+ +  +G  ++  +  +GEMA      + GF +Y 
Sbjct: 164 GTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQAVGEMAVAYSDLVGGFNAYP 223

Query: 141 SRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSI 200
           S   DPA GF+V + Y  ++  + P +L  A++ I+YW  K  V+P V+V IF V+I++I
Sbjct: 224 SFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTTK--VDPDVFVIIFYVLILAI 281

Query: 201 NXXXXXXXXXXXXWL-SSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFK-EY 258
           N            ++ +S K+                   +   +G +YW  PG+F+ E+
Sbjct: 282 NIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDGYIGGKYWHEPGAFRGEH 341

Query: 259 SETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFY 318
           +        RF   ++  V A +A+   E  G+ A+E  NPRK+IP A K  +YRIV  +
Sbjct: 342 A------IDRFKGVMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMLYRIVCMF 395

Query: 319 LISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSA 378
           L SI ++G  V YD   L+            P+V+A+   G+  +PH INA +L+ V S 
Sbjct: 396 LASITIVGFLVPYDSDQLLGSSGGGVKAS--PYVLAVSTHGVKVVPHFINAVILISVLSV 453

Query: 379 CNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIF 438
            NS  Y SSR L SLA    APKIF   +R G P   ++++ LF ++A+   S    ++F
Sbjct: 454 ANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFGVIAFCATSPKEDEVF 513

Query: 439 NYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFS--LFFCC 496
            + + +  +  + +WI+I ++++ F RA+  QG       + +    +G+ ++  +  C 
Sbjct: 514 VWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQVGAWGSSYAAIMMVCI 573

Query: 497 LIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDL 550
           LIA    F V +      + D KNF   Y+ +P+    YFGYK   K  T  I    +DL
Sbjct: 574 LIA---QFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYTKNWTIFIRAKDIDL 630

Query: 551 YTFKAAID 558
            + +   D
Sbjct: 631 VSHRNIFD 638

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  231 bits (588), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 150/518 (28%), Positives = 254/518 (49%), Gaps = 20/518 (3%)

Query: 63  TEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMA 122
           T  T LK  LK RH+ M                       P S LI +  +G +++  + 
Sbjct: 80  TAQTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVM 139

Query: 123 CLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDK 181
            LGE+A   P+ G FT+YA+R+ D + GFA  + Y+ ++ +  P ++ +A++ + YW   
Sbjct: 140 ALGELAVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGTD 199

Query: 182 EKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDH 241
            K   G +V +F +VIV IN              S  KV                  P+ 
Sbjct: 200 PKYRDG-FVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEK 258

Query: 242 DRLGFRYWRHPGSFKEYSETITGDT--GRFVAFVSVFVYATYAYLGIELTGIVAAEAQNP 299
             +G +Y+  PG+F        GDT   +F    SVFV A +++ G EL G+ A+E+ +P
Sbjct: 259 GYIGGKYFHDPGAF-------AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVDP 311

Query: 300 RKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSG 359
           RKS+PKA K   +RI +FY++S+ ++G+ V Y+D  LI            PFV+AI+  G
Sbjct: 312 RKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAAS--PFVIAIVTHG 369

Query: 360 INALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVS 419
           I  LP ++N  +L+ V S  NS ++  SR+  +LA     P+IFA  +R G P   + ++
Sbjct: 370 IKGLPSVVNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIIT 429

Query: 420 VLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAY 479
               L+A++  S+    +FN+ + +  +  + +W  I I +I F +A+ +QG      ++
Sbjct: 430 SAVGLIAFVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSF 489

Query: 480 VAPFQPYGAWFSLFFCCLIALIKNFTVFL---NHQFDYKNFITGYIGLPVFFFCYFGYKF 536
            +P   +G+++ LF   +I  I  F V L   N     + F   Y+  P+    Y G+K 
Sbjct: 490 KSPTGVWGSYWGLFM-IVIMFIAQFYVALFPVNGSPSAEGFFEAYLSFPLVLAMYIGHKI 548

Query: 537 TYKT-KVIDPL-KVDLYTFKAAIDQEEEDGKMADAEKA 572
             +  K++ P  ++D+ + +  +D E    ++A+ EKA
Sbjct: 549 YKRNWKLLIPAGEMDIDSGRREVDLELLKQEIAE-EKA 585

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  231 bits (588), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 156/542 (28%), Positives = 247/542 (45%), Gaps = 29/542 (5%)

Query: 40  DLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXX 99
           D + NI S      +   N+      ++L K L  RH+                      
Sbjct: 60  DSKENIKSDVPHVSDFENNVYDTANDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLN 119

Query: 100 XXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLF 158
              P S ++A+  V   +F  +  LGE+A   P+  GF  Y +R+ +P+ GFAV   YL 
Sbjct: 120 TGGPASLIVAWVIVSTCLFTIVNALGELAAVFPVVGGFNVYITRFVEPSFGFAVNINYLA 179

Query: 159 KYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSF 218
           ++ +L P +L AA++ I+YW     +N   WV IF   I   N             LS  
Sbjct: 180 QWAVLLPLELVAASITIRYW--NNTINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMI 237

Query: 219 KVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDT--GRFVAFVSVF 276
           K+                  P  + +G RYW  PG+F        GDT   RF    +VF
Sbjct: 238 KILAIIGFTILGIVLACGGGPSGEYIGGRYWNDPGAF-------VGDTPGRRFKGVCAVF 290

Query: 277 VYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLL 336
           V A ++Y G EL  + AAE+ NPR ++PKA K T + I + Y+  + ++G  V Y+D  L
Sbjct: 291 VTAAFSYSGTELVAVSAAESHNPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDERL 350

Query: 337 IXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAID 396
           +            P V+AI N GI  LP ++NA +L+ + S  NS +Y  SR + ++A  
Sbjct: 351 LNGNSSVDAAAS-PLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAEI 409

Query: 397 NKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISI 456
              PK     ++ G P YA+  +++F LL+++  S    ++F +   +  +  +  W SI
Sbjct: 410 GNLPKRLNYIDKRGRPLYAIFATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSI 469

Query: 457 LITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL----NHQF 512
            +++I F +A++AQ    +   +V+    YG+W+      L+ LI +F   L    +   
Sbjct: 470 NLSHIRFRQAMKAQDRSLNELPFVSITGVYGSWYGCIVIFLV-LIASFWTSLFPVGSDGA 528

Query: 513 DYKNFITGYIGLPVFFFCYFGYK-------FTYKTKVID----PLKVDLYTFKAAIDQEE 561
           D ++F  GY+ LP+F  CY G+K          KTK +D      ++DL   K  I  E 
Sbjct: 529 DAESFFEGYLSLPIFIVCYLGHKVYKKDWRLYVKTKDMDLDTGRREIDLDILKQEIRLER 588

Query: 562 ED 563
           E 
Sbjct: 589 EQ 590

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  229 bits (585), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 154/519 (29%), Positives = 246/519 (47%), Gaps = 20/519 (3%)

Query: 38  NDDLERNISSASSQDENDSYNIDGKTE-GTRLKKALKARHVSMXXXXXXXXXXXXXXXXX 96
           + D    IS+ S+ D +  +  +   E G  L K L  RH+                   
Sbjct: 47  SKDSGYKISTGSAIDSDSLHGNNVAFEYGENLNKDLDIRHLLTLAIGGSIGTGLFVNSGT 106

Query: 97  XXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYA 155
                 P S +I +  +   +F  +  LGE+A   P+  GF  Y +R+ DP+  FAV   
Sbjct: 107 SLNTGGPASLIIGWVIISSALFTVINALGELAATFPIVGGFNVYMTRFVDPSFAFAVNLN 166

Query: 156 YLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWL 215
           YL  + +  P +L AA++ I+YW    ++N   WVTIF V I  +N             +
Sbjct: 167 YLILWIVSLPLELVAASITIRYW--NREINSDAWVTIFFVFIALLNMMDVKFFSEAEFVM 224

Query: 216 SSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTG--RFVAFV 273
           S  K+                  P    +G +YW  PG+F        GD+   RF    
Sbjct: 225 SIIKILAIVGFFILGIVLAVGGGPTGGYIGGKYWNDPGAFH-------GDSAGSRFKGLC 277

Query: 274 SVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDD 333
           SVFV A ++Y G+E+T + AAE++NPRK+IPKA K T + I   Y+  + L+G+ V Y+D
Sbjct: 278 SVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKATKRTFWVITFSYISILTLIGILVPYND 337

Query: 334 PLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSL 393
             L+            P V+AI N+GI  LP ++NA +L+ + S  NS +YV SR + S+
Sbjct: 338 KRLLSGSSSVDASAS-PLVIAIENAGIKGLPSLMNAIILIALLSVANSCVYVCSRVMVSM 396

Query: 394 AIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSW 453
           A+ N  PK+F+K ++ G P Y++  ++   LL+++  S    ++F +   +  +  I  W
Sbjct: 397 ALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFIAASDKQEEVFTWLSAICGLSTIFCW 456

Query: 454 ISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL----N 509
           I I + +I F  A++ Q       AY++    +G+W+ +    L+ LI +F V L     
Sbjct: 457 IGINLAHIRFRAALKFQNRSLDELAYISQSGIWGSWYGVIILVLV-LIASFWVSLFPVGE 515

Query: 510 HQFDYKNFITGYIGLPVFFFCYFGYKFTYKT-KVIDPLK 547
              D + F  GY+  P+    Y G+K   K  K + PL+
Sbjct: 516 SSADAEAFFEGYLSFPILIASYIGHKVYIKNWKWVIPLE 554

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  229 bits (584), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 155/536 (28%), Positives = 252/536 (47%), Gaps = 27/536 (5%)

Query: 6   IPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEG 65
           IPSN ++   EE       ++FK          D  +R    A   +  ++  +   T  
Sbjct: 34  IPSNGSAASAEEAGSGSKWQDFK----------DSFKRVEPIAVDPNLTEAEKVAIVTAQ 83

Query: 66  TRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLG 125
           T LK  LK RH+ M                       P S LI +   G +++  +  LG
Sbjct: 84  TPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALG 143

Query: 126 EMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKV 184
           E+A   P+ G FT+YA+R+ D + G+A  + Y+ ++ ++ P ++ +A++ + +W    K 
Sbjct: 144 ELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKY 203

Query: 185 NPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRL 244
             G +V +F VVIV IN              S  KV                  P+   +
Sbjct: 204 RDG-FVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYI 262

Query: 245 GFRYWRHPGSFKEYSETITGDT--GRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKS 302
           G +YW  PG+F        GDT   +F    SVFV + +++ G EL G+ A+E+  PRKS
Sbjct: 263 GGKYWHDPGAF-------AGDTPGAKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRKS 315

Query: 303 IPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINA 362
           +PKA K   +RI +FY++S+ ++G+ V Y+D  LI            PFV+AI   GI  
Sbjct: 316 VPKAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAAS--PFVIAIKTHGIKG 373

Query: 363 LPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLF 422
           LP ++N  +L+ V S  NS +Y  SR++ +LA     P+IFA  +R G P   + V+  F
Sbjct: 374 LPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAF 433

Query: 423 CLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAP 482
            L+A++  S     +FN+ + +  +  + +W  I I +I F +A+ AQG D    ++ +P
Sbjct: 434 GLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSP 493

Query: 483 FQPYGAWFSLFFCCLIALIKNFTVFL---NHQFDYKNFITGYIGLPVFFFCYFGYK 535
              +G+++ LF   +I  I  F V L         + F   Y+  P+    Y G+K
Sbjct: 494 TGVWGSYWGLFM-VVIMFIAQFYVALFPVGGSPSAEGFFEAYLSFPLVMAMYIGHK 548

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  230 bits (587), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 157/528 (29%), Positives = 259/528 (49%), Gaps = 20/528 (3%)

Query: 54  NDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFV 113
            D+  I   T  + LK  LK+RH+ M                       P   LI +   
Sbjct: 73  TDAEKIAIATARSPLKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVT 132

Query: 114 GLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAA 172
           G +++  +  +GE+A   P+ G FT+YA+R+ D + GFA+ + Y+ ++ I  P ++ +A+
Sbjct: 133 GTMIYSMVMAVGELAVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSAS 192

Query: 173 LVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXX 232
           + + YW    K   G +V +F V  V IN              +  KV            
Sbjct: 193 ITVNYWGVDAKYRDG-FVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVI 251

Query: 233 XXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTG--RFVAFVSVFVYATYAYLGIELTG 290
                 P    +G +YW HPG+F        GDT   +F  F +VF+ A++++ G E+ G
Sbjct: 252 LICGGGPVGGYIGAKYWHHPGAF-------VGDTAGQKFKGFCTVFITASFSFGGSEVVG 304

Query: 291 IVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXP 350
           +  +E++NPRKS+P A K   +RI +FY++ + L+GM V Y+D  LI            P
Sbjct: 305 VAGSESENPRKSVPGAAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAAS--P 362

Query: 351 FVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWG 410
           FV+A++N GI  LP +IN  +L+ V S  NS +Y+ SR+L +LA     PKI A  +R G
Sbjct: 363 FVIAVVNQGIRGLPSVINVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNG 422

Query: 411 IPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQ 470
            P  A+ ++  F L+A++  SS   ++FN+ + +  +  + SW +I I +I F RA+ AQ
Sbjct: 423 RPLVAIGIASAFGLIAFVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQ 482

Query: 471 GVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL---NHQFDYKNFITGYIGLPVF 527
           G       +V+     G+++ +F C L+ LI  F V L       + K+F   Y+  P+ 
Sbjct: 483 GRSTDELPFVSTVGIAGSYWGIFICVLM-LIAQFYVGLFPAGASPNAKDFFMAYLSFPIV 541

Query: 528 FFCYFGYKFTYKT--KVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAE 573
              Y  +K   K     I    +D+ T +  +D++    ++A AE+A+
Sbjct: 542 LAFYIFHKIWKKNWKLYIKAEDMDIDTGRREVDRDLLKQEVA-AERAD 588

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  229 bits (585), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 160/589 (27%), Positives = 275/589 (46%), Gaps = 50/589 (8%)

Query: 9   NSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRL 68
            S+  +++++ +   + E             DL+ N++ A          +   T  + L
Sbjct: 40  TSSGSRWQDFVDGFKRVEL-----------GDLDPNLTQAE--------KVAIATARSPL 80

Query: 69  KKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMA 128
           ++ LK RH+ M                       P + LI +  +GL+++  +  +GE+A
Sbjct: 81  QRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAMGELA 140

Query: 129 TYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPG 187
              P+  GFT+Y  R+ D + GFA+ Y Y+ ++ ++ P ++ AA++ + YW    K   G
Sbjct: 141 VTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAKYRDG 200

Query: 188 VWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFR 247
            +V +F VVIV IN              S  KV                  P    +G +
Sbjct: 201 -FVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYVGGK 259

Query: 248 YWRHPGSFKEYSETITGDTG--RFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPK 305
           YW +PG+F        GD    RF A  SVFV A +++ G EL G+ AAE +NPRK++P+
Sbjct: 260 YWHNPGAFN-------GDNAGQRFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALPR 312

Query: 306 AIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPH 365
           A K   +RI +FY+IS+ L+G+ V Y    LI            PFV+AI   GI+ LP 
Sbjct: 313 AAKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAAS--PFVLAIKTHGISGLPS 370

Query: 366 IINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLL 425
           +IN  +L+ V S  NS +Y  SR+L +LA     P+IF+  +R G P   +  +  F LL
Sbjct: 371 VINVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLL 430

Query: 426 AYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQP 485
            ++  S     +FN+ + +  +  + +W  I I ++ F RA+ AQG      A+ +    
Sbjct: 431 CFIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGV 490

Query: 486 YGAWFSLFFCCLIALIKNFTVF---LNHQFDYKNFITGYIGLPVFFFCYFGYK-----FT 537
           +G++F +   CL+  I  F +    +    +  +F   Y+ + V  F Y  +K     +T
Sbjct: 491 WGSYFGVILICLV-FIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLFFYLAHKLYTRNWT 549

Query: 538 YKTKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFY 586
           +  +  D   +D+ T +  +D +    ++A+    E+++ + K   W+Y
Sbjct: 550 FAKRAKD---IDIDTGRRELDLDALKQEIAE----EKLRLSTK--PWWY 589

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  229 bits (585), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 156/526 (29%), Positives = 254/526 (48%), Gaps = 22/526 (4%)

Query: 63  TEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMA 122
           T  T LK  LK+RH+ M                       P S +I ++  G +++  + 
Sbjct: 84  TAHTPLKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVM 143

Query: 123 CLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDK 181
            + EMA   P+ G FT+YA+R+ D + GFA  + Y+ ++ ++ P ++ +A++ + YW   
Sbjct: 144 AVAEMAVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTP 203

Query: 182 EKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDH 241
            K   G +V +F +VIV IN              S+ KV                  P  
Sbjct: 204 TKYRDG-FVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTG 262

Query: 242 DRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRK 301
             +G +YW  PG+F   +        +F  F SVFV A +++ G EL GI  +EA+NPRK
Sbjct: 263 GYVGAKYWHDPGAFVGATAG-----AQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRK 317

Query: 302 SIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGIN 361
           ++P A K   +RI++FY++S+  +G+ V  +D  LI            PFV+AI   GI 
Sbjct: 318 AVPPAAKQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAAS--PFVIAITVHGIR 375

Query: 362 ALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVL 421
            LP +IN  +L+ V S  NS +Y  SR+L +LA     PK+ +  +R G P   +++S  
Sbjct: 376 GLPSVINVVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSF 435

Query: 422 FCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVA 481
           F L+A++  S     +FN+ + +  +    +W +I + +I F  A++AQ        +V+
Sbjct: 436 FGLVAFVAQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVS 495

Query: 482 PFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDY---KNFITGYIGLPVFFFCYFGYK-FT 537
           P   +G+++ LF   L+ L   F V +    D     NF + Y+ LPV    Y  +K +T
Sbjct: 496 PLGVFGSYWGLFLIVLM-LAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWT 554

Query: 538 YKTKVIDPL-KVDLYTFKAAID-----QE--EEDGKMADAEKAERI 575
              K+  PL ++DL T +  +D     QE  EE   +A   +  RI
Sbjct: 555 KNWKIFIPLGQLDLDTGRKQLDLDLLRQEVAEERATLAARPRWFRI 600

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  229 bits (585), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 162/544 (29%), Positives = 255/544 (46%), Gaps = 23/544 (4%)

Query: 50  SQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIA 109
           + D +D   I  +T    LK  LK RH+ M                       P   LI 
Sbjct: 63  TDDMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIG 122

Query: 110 YAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQL 168
           +   G +++  +  +GE++   P+ G FT+YA+R+ D + GFA  + Y+ ++  + P ++
Sbjct: 123 WGLTGTMIYCMVMAMGELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCVLPLEI 182

Query: 169 TAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXX 228
            AA++ + YW    K   G +V +F VVIV IN              S  KV        
Sbjct: 183 VAASITVNYWGTDPKYRDG-FVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGFII 241

Query: 229 XXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTG--RFVAFVSVFVYATYAYLGI 286
                     P+   +G +Y+  PG+F        GDT   RF    SVFV A +++ G 
Sbjct: 242 MGIVLNCGGGPEGGYIGGKYFHDPGAF-------VGDTAGARFQGVCSVFVTAAFSFAGS 294

Query: 287 ELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXX 346
           EL GI AAE+  PRKS+PKA K   +RI +FY++S+ ++G+ V Y D  LI         
Sbjct: 295 ELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDAAA 354

Query: 347 XXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKT 406
              PFV+AI + GI  LP ++N  +L+ V S  NS +Y  SR+L +LA  N  PKIF   
Sbjct: 355 S--PFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYI 412

Query: 407 NRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRA 466
           +R G P + ++ +  F L+A++  S    ++F + + +  +  + +W  I   +I F  A
Sbjct: 413 DRSGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAA 472

Query: 467 VRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL--NHQFDYKNFITGYIGL 524
           + AQG       + AP   YG+ + LF   L+ + + +        +   + F   Y+  
Sbjct: 473 LTAQGRSTDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALFPPGGKPSAEVFFQSYLSF 532

Query: 525 PVFFFCYFGYKFTYKT-KVIDPL-KVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNF 582
           PV    YFG+K   +  K++ PL K+D+ T      + E D  +   E AE  KQ     
Sbjct: 533 PVVLAFYFGHKLYARNWKLLIPLSKLDIDT-----GRREMDLDVLRQEIAEE-KQMMSTR 586

Query: 583 EWFY 586
            W+Y
Sbjct: 587 PWWY 590

>TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  228 bits (582), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 148/528 (28%), Positives = 256/528 (48%), Gaps = 27/528 (5%)

Query: 18  YFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHV 77
           YF    K+  K  + E   + D+ + +IS    + +N+            + + LK+RH+
Sbjct: 16  YFPNQMKENMKASVNE---VIDEEQGSISELEVKPQNE------------MVRGLKSRHI 60

Query: 78  SMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDG-- 135
            +                       P   LI+Y  +   V+  +  L EM   IPL G  
Sbjct: 61  QLIALGDAIGTGLFIGSGGALSTCGPAPILISYIVMSFFVWTIVNQLTEMVALIPLPGEA 120

Query: 136 -FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFL 194
              S A  Y    L F  G+   +   ++ P+++TA A++IQYW D    N  ++++IF+
Sbjct: 121 SMYSLARMYVGRPLAFMCGWNLFYAMAMIAPSEITACAMLIQYWTD---ANSAIFISIFI 177

Query: 195 VVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDR-LGFRYWRHPG 253
           V  V+I              +SS K+                  P  D  LGF YW+ PG
Sbjct: 178 VFSVAITMLPVRVFGESEFCVSSIKLLTIVGLIIVGIVIFFGGGPSQDHILGFHYWKKPG 237

Query: 254 SFKEYSETITGDTGRFVAFVSVFVYATYAYLGI-ELTGIVAAEAQNPRKSIPKAIKLTMY 312
           +FKE+   + G TG+F+A  +  + + ++++ + E     +AE+ +PR+++P+A +  +Y
Sbjct: 238 AFKEH--LVPGSTGKFLAVWTAIIKSGFSFVLVPETVASCSAESASPRRNMPRACQRFVY 295

Query: 313 RIVIFYLISIFLLGMCVAYDDP-LLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACV 371
           R+ +FY+  + ++ + V  DD  LL             P+V+ I  +GI  LPHIINAC+
Sbjct: 296 RLALFYVAGVLVVTVVVGSDDANLLNAIHSGASNAAASPYVIGIKEAGIKVLPHIINACI 355

Query: 372 LVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVS 431
           L   +S   ++LY  SR L+S+A+   AP+IFAK NR+G+PYY+ +V+ LF LLAY+  S
Sbjct: 356 LTSAYSCGTAELYGCSRILHSMAMKGDAPQIFAKVNRFGVPYYSTAVACLFTLLAYLNCS 415

Query: 432 SASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFS 491
            +S+ +FN+  N+ +I G +SW+ + +TY  F   +    ++     +   FQ   A+  
Sbjct: 416 KSSSLVFNWLSNIATISGFISWVFVSVTYTRFRTVIDKLDLNDR-IPFRRRFQKGFAYAC 474

Query: 492 LFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYK 539
           + F  L++L   + VF+   ++  +F   Y+ +      + G    YK
Sbjct: 475 IAFFVLLSLTNGYAVFIKGNWNTSDFFASYVTIGFVAVLFIGSTIYYK 522

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  229 bits (584), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 156/547 (28%), Positives = 254/547 (46%), Gaps = 28/547 (5%)

Query: 46  SSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVS 105
           SS  S+D +D   +D     T L K L  RH+                         P S
Sbjct: 66  SSERSRDNDDVEQVD--INNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGGPAS 123

Query: 106 TLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILP 164
            +I +  +G  +F  +  LGE++   P+  GF  Y  R+ +P+  FAV   YL ++ +L 
Sbjct: 124 LVIDWVIIGTCLFTVINSLGELSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYLAQWLVLL 183

Query: 165 PNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXX 224
           P +L AA++ I+YW DK  +N   WV IF   I   N             LS  K+    
Sbjct: 184 PLELVAASITIKYWNDK--INSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSII 241

Query: 225 XXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYL 284
                         P    +G +YWR+PG+F  ++        +F    SVFV A ++Y 
Sbjct: 242 GFSILGIVLSCGGGPHGGYIGGKYWRNPGAFVGHNSGT-----KFKGLCSVFVTAAFSYS 296

Query: 285 GIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXX 344
           GIE+T + AAE++NPR++IPKA K T + I   Y+  + L+G  V  +DP L+       
Sbjct: 297 GIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVD 356

Query: 345 XXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFA 404
                P V+AI N  I  LP ++NA +L+ V S  NS +Y  SR + ++A     PK   
Sbjct: 357 AASS-PLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLN 415

Query: 405 KTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFD 464
           + ++ G P  A+ +++ F LL+++  S+  A++F +   +  +  I  W++I +++I F 
Sbjct: 416 RVDKRGRPMNAILLTLFFGLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFR 475

Query: 465 RAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITG 520
           +A++ Q        +++     G+W+  F    + LI +F   L    +     ++F  G
Sbjct: 476 KAMKVQERSLDELPFISQTGVLGSWYG-FVVLFLVLIASFWTSLFPIGSSGASAESFFEG 534

Query: 521 YIGLPVFFFCYFGYK-----FTYKTKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERI 575
           Y+  P+   CYFG+K     +T   K+ D   +DL T +  +D      +M    K ER 
Sbjct: 535 YLSFPILIVCYFGHKIYTRNWTLMVKIED---IDLDTGRKQVDLTLRREEM----KIERE 587

Query: 576 KQNGKNF 582
               K+F
Sbjct: 588 NLAKKSF 594

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  229 bits (585), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 160/549 (29%), Positives = 250/549 (45%), Gaps = 24/549 (4%)

Query: 39  DDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXX 98
           D +  NI   +  + N S ++    +G  LK+ +K RHV M                   
Sbjct: 74  DHINTNIHGNAELELNPSQSLL-PEKGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKAL 132

Query: 99  XXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIP-LDG-FTSYASRYCDPALGFAVGYAY 156
               P    I YA +G  ++  +   GE+A   P L G F +Y S   DPA+ FA    Y
Sbjct: 133 ATGGPAGLTIGYAIMGSCLYSIIQAAGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALY 192

Query: 157 LFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLS 216
             ++  + P ++ +AA+ I+YW     +NP VW  IF V+I+ IN            + +
Sbjct: 193 CIQWLCVFPLEVISAAITIKYW--NTSINPNVWCVIFYVMIIGINMCGSAGYAEADFFFN 250

Query: 217 SFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTG--RFVAFVS 274
           + K+                   D   +G +YW  PG+F        GDTG  RF A VS
Sbjct: 251 TCKILMFAGFFILGIIINCGGAGDSVYIGGKYWNDPGAFN-------GDTGISRFKAIVS 303

Query: 275 VFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDP 334
             V A +A+   E   + A+E  NPRK+IP A K  +YRI+  YL SI L+G  V Y+ P
Sbjct: 304 TLVTAAFAFGASEAVALTASEQANPRKAIPSAAKQVLYRIIAIYLASIILVGFLVPYNSP 363

Query: 335 LLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLA 394
            L+            P+V+A+ + G+  +P  INA +L+ V S  N   Y SSR L  L+
Sbjct: 364 ELMGSGSSSVHSS--PYVIAVASHGVKVVPSFINAVILISVLSVGNFSFYSSSRILLCLS 421

Query: 395 IDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWI 454
               APK F   +R G P YA+ V  L   + ++  SSA   +F + + V  +  + +W 
Sbjct: 422 EIGYAPKFFQYVDRQGRPLYAMIVGALVGCICFVSASSAEESVFTWLMAVSGLSQLFTWT 481

Query: 455 SILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIAL----IKNFTVFLNH 510
           +I I+++ F +A++ Q        + +    +G+++ +F   L+ +    +  F V    
Sbjct: 482 NICISHVRFRKAMQVQNRSIGELGFRSQVGVWGSYYGIFMMILVFIGQFWVALFPVGGTD 541

Query: 511 QFDYKNFITGYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAIDQEEEDGKMAD 568
             D +NF   Y+ +PVF   YFG+K   K     I   ++DL + +   D  EE  K  D
Sbjct: 542 GADAENFFANYLAMPVFLALYFGFKIWKKDWRLYIPASEIDLISHRKIFD--EEILKQED 599

Query: 569 AEKAERIKQ 577
            E   ++K 
Sbjct: 600 EEYKIKMKH 608

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  228 bits (582), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 160/527 (30%), Positives = 246/527 (46%), Gaps = 31/527 (5%)

Query: 60  DGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFF 119
           DG T   ++KK +K RH+ M                       P   ++ Y     +++ 
Sbjct: 59  DGTT--AKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYL 116

Query: 120 TMACLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQY 177
            +   GE+   Y  + G +T+Y+S   DPA+GF+V + Y  ++  + P QL  AA++IQY
Sbjct: 117 IVEAAGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQY 176

Query: 178 WVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXX 237
           W D   +NP ++V I   VIV IN            + +  KV                 
Sbjct: 177 WTD---INPDIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGG 233

Query: 238 XPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQ 297
                 +G +YW  P  F             F     VF YA +AY GIE+  + A+E +
Sbjct: 234 AGTSGYIGDKYWHEPRPFMN----------GFKGLCFVFCYAAFAYGGIEVMVLSASEQE 283

Query: 298 NPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIIN 357
           NPRKSI  A K  +YRIV+ YL++  ++   V  D P L             P V+A+  
Sbjct: 284 NPRKSISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSL-----ASEGSRASPLVIAVSF 338

Query: 358 SGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALS 417
            G+  +PHIINA +L+ V S  NS LY + R L SLA    APKIF   +R G P  A  
Sbjct: 339 HGVKIVPHIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFF 398

Query: 418 VSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTF 477
           V+++F LLA++  S A   +F + + +  +  +  W+SI I++I F  A++AQG      
Sbjct: 399 VAMVFGLLAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEV 458

Query: 478 AYVAPFQPYGAWFSLFFCCLIALIKNFTVFLN----HQFDYKNFITGYIGLPVFFFCYFG 533
            Y A    +G+W ++    LI LI  F V ++       D ++F   Y+  P+    YFG
Sbjct: 459 GYKARTGYWGSWIAVVTAFLI-LIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFG 517

Query: 534 YKFTYKT-KVIDPL-KVDLYTFKAAIDQEEEDGKMADAEKAERIKQN 578
           YK  +K  ++  P  +VDL + +   D++E   K  D E   ++K +
Sbjct: 518 YKIYHKDWRICIPASEVDLISHRQVFDEDEL--KQEDLEWKLKLKSS 562

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  229 bits (585), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 165/595 (27%), Positives = 263/595 (44%), Gaps = 39/595 (6%)

Query: 7   PSNSTSDQYEEYFEQLPKK---EFKLPIQEEELIND-----DLERNISSASSQ------- 51
           PS      YE++     ++    FK   Q++E   +     DL   IS +S Q       
Sbjct: 40  PSQQPHLDYEQHNTSAVRRFLDSFKRADQDQEQEAEVAQMNDLTSAISPSSRQAHELEKD 99

Query: 52  DENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYA 111
           +  D        +   LKK ++ RHV M                       P   LI YA
Sbjct: 100 ETTDKIAPHTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYA 159

Query: 112 FVGLLVFFTMACLGEMA-TYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLT 169
            +G +++  +   GEMA  Y  L  G+ +Y S   D   GFAV + Y  ++  + P +L 
Sbjct: 160 IMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELV 219

Query: 170 AAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXX 229
            A++ I+YW     VNP V+V IF V++++IN            + +  K+         
Sbjct: 220 TASMTIKYWT--TSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFIL 277

Query: 230 XXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELT 289
                     +   +G +YW  PG+F            RF   V+  V A +A+ G E  
Sbjct: 278 GIIIDVGGAGNDGYIGGKYWHEPGAFNGVHAI-----DRFKGVVATLVTAAFAFGGSEFI 332

Query: 290 GIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXX 349
            I  AE  NPRK+IP A K  +YRI+  +L +I ++G  V Y+   L+            
Sbjct: 333 AITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLLGSSGGGTKAS-- 390

Query: 350 PFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRW 409
           P+V+AI + G+   PH +NA +L+ V S  NS  Y S+R   +L+    APKIF+  +R 
Sbjct: 391 PYVIAIASHGVRVAPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRA 450

Query: 410 GIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRA 469
           G P  A+ VS LF ++A+   S    ++F + + +  +  + +W +I +++I F RA++ 
Sbjct: 451 GRPLIAMCVSALFAVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKV 510

Query: 470 QGVDKSTFAYVAPFQPYGAWFSLFFCCL--IALIKNFTVFL----NHQFDYKNFITGYIG 523
           QG       + +     G W S++ C +  + LI  F V +      + D + F   Y+ 
Sbjct: 511 QGRSLGELGFKS---QTGVWGSIYSCIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLA 567

Query: 524 LPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIK 576
           +P+    Y GYK   K     I   K+DL + +   D  EE  K  D E  ER++
Sbjct: 568 MPILIVLYVGYKMWNKDWKLFIRADKIDLTSHRQIFD--EELIKQEDDEYRERLR 620

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  229 bits (584), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 153/539 (28%), Positives = 248/539 (46%), Gaps = 23/539 (4%)

Query: 9   NSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRL 68
           + T  +++ + +   + + + P   E  +    E  +    S+D      + GK+E   L
Sbjct: 68  SRTRAKFQNFIDSFKRADKEQPSTLEHDLTKTFEGTLEP--SEDGTQPAEVAGKSE--EL 123

Query: 69  KKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMA 128
           K ++K RHV M                       P   +I YA +G  ++  +   GEMA
Sbjct: 124 KHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGEMA 183

Query: 129 TYIP--LDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNP 186
                 + GF SY S   +PALGF+V + Y  ++  + P +L  A++ I+YW  K  V+P
Sbjct: 184 VLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTK--VDP 241

Query: 187 GVWVTIFLVVIVSINXXXXXXXXXXXXWL-SSFKVXXXXXXXXXXXXXXXXXXPDHDRLG 245
            V+V IF V+I+ IN            +  +S K+                   D   +G
Sbjct: 242 DVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIILICGGAGDDGYIG 301

Query: 246 FRYWRHPGSFK-EYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIP 304
            RYW  PG+F+ E++        RF   VS  V A +A+   E+ G+ A+E  NPRK+IP
Sbjct: 302 GRYWHDPGAFRGEHA------IDRFKGVVSTLVNAAFAFGLSEMIGVTASEQSNPRKAIP 355

Query: 305 KAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALP 364
            A K  +YRIV  YL S+ ++G  V ++   L+            P+V+A+   G+  +P
Sbjct: 356 SAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVKAS--PYVLAVSTHGVRVVP 413

Query: 365 HIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCL 424
           H INA +L+ V S  NS  Y SSR L  LA    APKIF   +R G P   + V+ L  +
Sbjct: 414 HFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAALVNV 473

Query: 425 LAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQ 484
           +++   S    ++F + + +  +  + +W +I +++I F RA+  QG       + +   
Sbjct: 474 ISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFKSQCG 533

Query: 485 PYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCYFGYKFTYK 539
            +G+W++     LI LI  F V +      + D + F   Y+  P+    YFGYK   K
Sbjct: 534 VWGSWYAFIMMMLI-LIAQFWVAIAPIGEGRLDVQAFFENYLAAPILIALYFGYKIYTK 591

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  228 bits (581), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 156/563 (27%), Positives = 257/563 (45%), Gaps = 29/563 (5%)

Query: 5   QIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTE 64
            I +N   ++ +     L   + K+P  E+     D    IS      E+D  N++    
Sbjct: 25  NIDANFALEEKDSTLSPLASLDSKVP-HEKIQTTTDFASVIS-----HEDDINNVN---- 74

Query: 65  GTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACL 124
              L K L  RH+                         P S +I +  +   +F  +  L
Sbjct: 75  ---LNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINAL 131

Query: 125 GEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEK 183
           GEMA   P+  GF  Y +R+ DP++GFAV   YL ++ +L P +L AA++ I+YW   E 
Sbjct: 132 GEMAAAFPVVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYW--NET 189

Query: 184 VNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDR 243
           +N   WV IF  VI   N             LS  K+                  P    
Sbjct: 190 INSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGGF 249

Query: 244 LGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSI 303
           +G +YW HPGSF  ++        +F    SVFV A ++Y GIE+T + AAE+++PR +I
Sbjct: 250 IGGKYWNHPGSFVGHNSGT-----KFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTI 304

Query: 304 PKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINAL 363
           PKA K T + I   Y+  + L+G  V YDDP L+            P V+AI N GI  L
Sbjct: 305 PKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASS-PLVIAIENDGIKGL 363

Query: 364 PHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFC 423
           P ++NA +L+ + S  NS +Y  SR + ++A     P+I  + +  G P  A+  ++ F 
Sbjct: 364 PSLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFG 423

Query: 424 LLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPF 483
           LL+++  S   A +F +   +  +  I  W++I +++I F +++  Q        +++  
Sbjct: 424 LLSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQT 483

Query: 484 QPYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCYFGYKFTYK 539
             +G+W+      L+ L+ +F   L        D ++F  GY+  P+   CYFG+K   +
Sbjct: 484 GVWGSWYGTIVLFLV-LVASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVR 542

Query: 540 TK--VIDPLKVDLYTFKAAIDQE 560
            +  ++    +DL T +  +D +
Sbjct: 543 KREFMVGLADMDLDTGRRQVDLD 565

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  228 bits (582), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 155/557 (27%), Positives = 261/557 (46%), Gaps = 18/557 (3%)

Query: 9   NSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRL 68
           +S+ D +E      P +        ++++  D +       +  E  SY  D     T L
Sbjct: 31  SSSPDNFELSSVNSPVRVNVSSSGNDDILKGDTKEYPRDVKATPEAASYVED--INNTNL 88

Query: 69  KKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMA 128
            K L  RH+                         P S +I +  V   +F  +  LGE+A
Sbjct: 89  NKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVINSLGELA 148

Query: 129 TYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPG 187
              P+  GF  Y +R+ +P+  FA+   YL ++ +L P +L AA++ I+YW DK  +N  
Sbjct: 149 AAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYWNDK--INSD 206

Query: 188 VWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFR 247
            WV IF   I   N             LS  K+                  P    +G +
Sbjct: 207 AWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGGYIGGK 266

Query: 248 YWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAI 307
           YW +PG+F  +S        +F    SVFV A ++Y GIE+T + AAE++NP+++IPKA 
Sbjct: 267 YWHNPGAFVGHSAG-----SQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKETIPKAA 321

Query: 308 KLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHII 367
           K T + I + Y+  + L+G  V Y+DP L+            P V+AI N GI  LP ++
Sbjct: 322 KRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAAS-PLVIAIENGGIKGLPSLM 380

Query: 368 NACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAY 427
           NA +L+ + S  NS +Y  SR + S+A     PK  +K ++ G P  A+ +++ F LL++
Sbjct: 381 NAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFGLLSF 440

Query: 428 MCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYG 487
           +  S    ++F +   +  +  I  W++I ++ I F  A++AQG       +++    +G
Sbjct: 441 IAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQSGTWG 500

Query: 488 AWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCYFGYKFTYKT-KV 542
           AW+ +    L+ L+ +F   L    +     K+F  GY+ LP+   CY G+K   +  ++
Sbjct: 501 AWYGVIVLFLV-LVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKLWKRDWRL 559

Query: 543 IDPL-KVDLYTFKAAID 558
           + PL ++DL + +  +D
Sbjct: 560 LVPLMEMDLDSGRRVLD 576

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  228 bits (581), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 169/586 (28%), Positives = 266/586 (45%), Gaps = 34/586 (5%)

Query: 5   QIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDD-LERNISSASSQDENDSYNIDGKT 63
           +IP ++ S   +  F +     FK    + + I ++ LE  + +  + D    YN   K 
Sbjct: 20  EIPIDTESVHSQHGFVRNFMDSFKRAEPQGQTIREEKLENGLETVRTND----YNATQK- 74

Query: 64  EGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTM-A 122
              ++K+ +K+RH++M                       P   +I Y     +++  + A
Sbjct: 75  ---KMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTMLYCVIQA 131

Query: 123 CLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDK 181
           C     +Y  L G + SY S   D    FAV + Y  ++ I+ P +L  +++ I+YW D 
Sbjct: 132 CCELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIKYWNDS 191

Query: 182 EKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDH 241
             +NP V+V IF   IV I+              +S KV                     
Sbjct: 192 --INPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCGASKS- 248

Query: 242 DRLGFRYWRHPGSFKEYSETITGDTG--RFVAFVSVFVYATYAYLGIELTGIVAAEAQNP 299
             +G +YW  PG+F        G+     F    SV+V + +AY G E   + AAE  NP
Sbjct: 249 GYIGGKYWHTPGAF-------VGEKAIDHFKGICSVWVQSAFAYGGSEFIALTAAEQTNP 301

Query: 300 RKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSG 359
           RKS+PKA K  +YR++I +L  I L+G  V YD PLL+            PFV+A  + G
Sbjct: 302 RKSVPKATKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHAS-PFVIAAASHG 360

Query: 360 INALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVS 419
           +  +PHIINA +L+ V S  NS  Y + R L SLA     PK+F   +R G P   +   
Sbjct: 361 VKVVPHIINAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTMLFV 420

Query: 420 VLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAY 479
            +F L++++  S     +F +   +VS+  + +W +I +++I F  A++ QG       Y
Sbjct: 421 AIFGLISFVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGELGY 480

Query: 480 VAPFQPYGAWFSLFFCCLIALIKNFTVFL-----NHQFDYKNFITGYIGLPVFFFCYFGY 534
            A    +G+W+++ F  +I L   F V +       + D  NF   Y+  PV  F YFGY
Sbjct: 481 KANTGYWGSWYAIAF-NIIVLAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFFYFGY 539

Query: 535 KFTYKT-KVIDPL-KVDLYTFKAAIDQEEEDGKMADAEKAERIKQN 578
           K  Y+  K+  P  KVDL + +   D +    K  D E  ERI+ +
Sbjct: 540 KLWYRDWKLFIPADKVDLESHRKIFDADLI--KQEDFEHKERIRNS 583

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  229 bits (583), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 167/548 (30%), Positives = 262/548 (47%), Gaps = 27/548 (4%)

Query: 48  ASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTL 107
           +SS  E +  + + K+E   LKK +K RHV M                       P + +
Sbjct: 102 SSSISETNKGHQNEKSE--DLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALV 159

Query: 108 IAYAFVGLLVFFTMACLGEMAT-YIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPP 165
           I YA +G  ++  +   GE+A  Y  L+G F +Y S   DPALGF+V + Y  ++  + P
Sbjct: 160 IGYAIMGTCLYCIIQAAGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCP 219

Query: 166 NQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXX 225
            +L  A++ I+YW    KV+P V+V IF V+I++IN            + +  KV     
Sbjct: 220 LELVTASMTIKYWT--TKVDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTG 277

Query: 226 XXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTG--RFVAFVSVFVYATYAY 283
                         +   LG +YW  PG+F        GD    RF   +  FV A +A+
Sbjct: 278 FFILGIIITAGGAGNDGYLGAKYWHDPGAF-------NGDKSIDRFKGVMDTFVTAAFAF 330

Query: 284 LGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXX 343
              E   + AAE  NPRK+IP A K  +YRIV  +L SI L+G  V Y+   L+      
Sbjct: 331 GATEFIALTAAEQSNPRKAIPSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSG 390

Query: 344 XXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIF 403
                 P+V+A+ + G+  +PH INA +L+ V S  NS  Y SSR L SLA    APK F
Sbjct: 391 IKAS--PYVIAVSSHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWF 448

Query: 404 AKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICF 463
              +R G P+ A+ +S LF ++A+   S    ++F++ + +  +  + +WI+I +++I F
Sbjct: 449 DYVDREGRPFRAMLMSALFGVIAFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRF 508

Query: 464 DRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFIT 519
            RA++ QG       Y++    YG+ ++      +ALI  F V +      + D +NF  
Sbjct: 509 RRAMQVQGRSLGEVGYLSQSGVYGSAYAAIM-LFLALIAQFWVAIAPIGEGKLDAENFFQ 567

Query: 520 GYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQ 577
            Y+ +P+    YFGY+   +     I    +DL T +   D  E   +  D E  E+++ 
Sbjct: 568 NYLAMPILIAFYFGYRVWKRDWKLFIRAKDIDLDTHRQIFD--ENILRQEDEEYKEKLR- 624

Query: 578 NGKNFEWF 585
           NG  +  F
Sbjct: 625 NGPMWRRF 632

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  228 bits (581), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 159/560 (28%), Positives = 266/560 (47%), Gaps = 29/560 (5%)

Query: 7   PSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGT 66
           PS +++ Q      Q  K  FK   + E++   +L+ N++ A          I   T   
Sbjct: 56  PSFTSTTQPSTTRWQKFKDSFK---KAEDV---ELDPNLTEAE--------RIAQATAKA 101

Query: 67  RLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGE 126
            L+  LK R  +M                       P   +I +     +++  +  LGE
Sbjct: 102 PLQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMALGE 161

Query: 127 MATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVN 185
           +A   P+  GFT+YA+R+ D + G+A  + Y  ++ ++ P ++ +A++ + YW    +  
Sbjct: 162 LAVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTRYR 221

Query: 186 PGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLG 245
            G +V +F +VIV IN              S  KV                  P    +G
Sbjct: 222 DG-FVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFVG 280

Query: 246 FRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPK 305
            +YW  PG+F  +     G   +F    SVFV A +++ G EL GI AAEA NPRKSIP 
Sbjct: 281 AKYWHDPGAFVGH-----GSGAQFKGVCSVFVTAAFSFAGSELIGITAAEAANPRKSIPG 335

Query: 306 AIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPH 365
           A K  ++RIV+FY+ ++ ++G+ V Y+D  LI            PFV+AI+  GI  LP 
Sbjct: 336 AAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSVDAAAS--PFVIAIVTHGIKGLPS 393

Query: 366 IINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLL 425
           +IN  +L+ V S  NS ++  SR++ +L+     PK+F   +R G P   ++++  F LL
Sbjct: 394 VINVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFGLL 453

Query: 426 AYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQP 485
           A++  S    ++FN+ + +  +  + +W  I + +I F  A++AQG D +   +V+P   
Sbjct: 454 AFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDTNELTFVSPAGV 513

Query: 486 YGAWFSLFFCCLIALIKNFTVFL---NHQFDYKNFITGYIGLPVFFFCYFGYKFTYKT-K 541
            G+++ LF   L+  I  F V L     + D + F   Y+  P+    YFG+K   +  K
Sbjct: 514 AGSYWGLFMIVLM-FIAQFYVALFPPGGKPDAEVFFQSYLSFPIVVATYFGHKIYKRNWK 572

Query: 542 VIDPLK-VDLYTFKAAIDQE 560
           +  PL+ +D+ T +   D E
Sbjct: 573 LFIPLEDMDIDTGRRETDME 592

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  227 bits (579), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 168/593 (28%), Positives = 272/593 (45%), Gaps = 52/593 (8%)

Query: 10  STSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYN--IDGKTEGTR 67
           +T   ++EY +  P   F  P            RNI     Q   DS+   +DG  +   
Sbjct: 40  TTKHAHDEYEDNFPGNGFYQP-----------PRNIF----QRCIDSFKPPLDGSFDTNN 84

Query: 68  LKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEM 127
           LK++LKARH+ M                       P++ +I +A  G  +  T+  LGE+
Sbjct: 85  LKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIGTIHGLGEI 144

Query: 128 ATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNP 186
               P+ G F +Y++R+ DP+L F +   Y+ ++F + P ++ ++A+ +QYW   + ++P
Sbjct: 145 TVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYW--NQSIDP 202

Query: 187 GVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGF 246
            VWV IF   IVSIN              SS KV                  PDHD +G 
Sbjct: 203 VVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGGPDHDFVGA 262

Query: 247 RYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKA 306
           +YW  PG               F   +SV V A+Y+  G E+  +  A  +   K +P A
Sbjct: 263 KYWHDPGCLAH----------GFPGVLSVLVVASYSLGGTEM--VCLASGETDPKELPSA 310

Query: 307 IKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHI 366
           IK T +RI+ F+L+S+ L+G  V Y +  L+            PFV+AI    I  LP I
Sbjct: 311 IKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSSVNNS----PFVIAIKLHQIKVLPSI 366

Query: 367 INACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLA 426
           +NA +L+ + S  NS ++ SSR+L S+A     P+ F   +R G P   +  + LF LLA
Sbjct: 367 VNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIITNSLFGLLA 426

Query: 427 YMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPY 486
           ++  SS+ +++F++ + +  +   + W+SI I++I F  A++AQG       +V+    +
Sbjct: 427 FLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELEFVSAVGIW 486

Query: 487 GAWFSLFFCCLIALIKNFTVFL-------NHQFDYKNFITGYIGLPVFFFCYFGYKFTYK 539
           G+ +S     LI L+  F   L       N     K F   Y+   +    + G+K  Y+
Sbjct: 487 GSAYSAVINSLI-LVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLFVGHKIFYR 545

Query: 540 TKV-----IDPL-KVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFY 586
            K      + PL K+DL T +  ID E    K   AE+   ++ +     W++
Sbjct: 546 YKTGKWWSMLPLNKIDLETDRKNIDIEIL--KQEIAERNRHLRASPWYVRWYH 596

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  228 bits (582), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 167/584 (28%), Positives = 262/584 (44%), Gaps = 48/584 (8%)

Query: 6   IPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEG 65
           I +N +S Q +   E  PK  F              E  I   S + + +  N       
Sbjct: 104 ISTNDSSSQLDN--ELNPKGSFVT------------ESGIKQPSQEQDQNQEN------- 142

Query: 66  TRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLG 125
             LKK +K RH+ M                       P   +I YA +G  ++  +   G
Sbjct: 143 --LKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCIIQACG 200

Query: 126 EMATYIP--LDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEK 183
           E+A      + GF +Y S   DPALGF+V + Y  ++  + P +L  A++ I+YW    K
Sbjct: 201 ELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWT--VK 258

Query: 184 VNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDR 243
           V+P V+V IF V+I+ IN            + +  K+                       
Sbjct: 259 VDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGY 318

Query: 244 LGFRYWRHPGSFKEYSETITGDTG--RFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRK 301
           +G RYW +PG+F+       G+TG  RF   V+ FV A +A+   E   + A+E  NPRK
Sbjct: 319 IGSRYWHNPGAFR-------GNTGIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRK 371

Query: 302 SIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGIN 361
           +IP A K  +YRI+  +L S+ L+G  V Y    L+            P+V+A+ + G+ 
Sbjct: 372 AIPSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLLGASGSATKAS--PYVIAVASHGVR 429

Query: 362 ALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVL 421
            +PH INA +L+ V S  N   Y SSR L SLA    APK F   +R G P  A+ VS +
Sbjct: 430 VVPHFINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSSI 489

Query: 422 FCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVA 481
           F ++A+   S     +F + + +  +  + +WI+I +++I F RA++ QG       Y +
Sbjct: 490 FGIIAFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKS 549

Query: 482 PFQPYGAWFSLFFCCLIALIKNFTVFLN-----HQFDYKNFITGYIGLPVFFFCYFGYKF 536
               +G+ +++    L ALI  F V ++      +   ++F   Y+ +P+    Y  YK 
Sbjct: 550 QVGIWGSMYAIVMMVL-ALIAQFWVAISPIGGGGKLSAQSFFENYLAMPILIALYVFYKV 608

Query: 537 TYK--TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQN 578
             K  T  I   K+DL T +   D  EE  K  D E  E+++  
Sbjct: 609 WKKDWTLFIPADKIDLVTDRQIFD--EELLKQEDEEYQEKLRNG 650

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  228 bits (581), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 161/564 (28%), Positives = 259/564 (45%), Gaps = 33/564 (5%)

Query: 32  QEEELINDDLERNISSASSQDENDSYNIDGKTEG---TRLKKALKARHVSMXXXXXXXXX 88
           +++E   +DLE  + S  S  +  S  + G+  G     L+K+++ RHV M         
Sbjct: 82  EDDEETAEDLENELVSTLSPSK--SKQLHGQKNGDDDAHLQKSIRPRHVLMMSLGTGIGT 139

Query: 89  XXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMAT-YIPLDG-FTSYASRYCDP 146
                         P + +I Y  +G  ++  +   GEMA  Y  L G F +Y S   D 
Sbjct: 140 GLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQACGEMAVCYSGLPGNFNAYPSFLVDE 199

Query: 147 ALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXX 206
            + F V + Y  ++  + P +L  A++ I YW    KVN  V+V IF V+I  IN     
Sbjct: 200 GMAFGVAWVYCLQWLCVMPLELVTASMTIDYWT--TKVNSDVFVVIFFVLITLINTFGAK 257

Query: 207 XXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDT 266
                  + +S KV                   +   +G +YW +PG+F+       GD 
Sbjct: 258 GYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR-------GDK 310

Query: 267 G--RFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFL 324
              RF   +S F  A +A+   E   I A+E  NPR++IP A K  +YRI+  +L SI L
Sbjct: 311 SIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITL 370

Query: 325 LGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLY 384
           +G  V YD   L+            P+V+A+ + G+  +PH INA +L+ V S  NS  Y
Sbjct: 371 VGFLVPYDSTELLGSGGSASSQAS-PYVIAVASHGVRVVPHFINAVILLSVLSVANSAYY 429

Query: 385 VSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNV 444
            S R LYSLA    APK F   +R G P  A+ V+ +F ++A+   S     +F + +++
Sbjct: 430 SSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVIAFCSCSDKEEDVFAWLLSI 489

Query: 445 VSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNF 504
             +  + +W +I +++I F RA++ QG       + +    +G+ ++     ++ALI  F
Sbjct: 490 AGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSGYAAIM-MILALIAEF 548

Query: 505 TVFL----NHQFDYKNFITGYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAID 558
            V +        D +NF   Y+ +P+    YFGYK   K     I    +DL + +   D
Sbjct: 549 WVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIYKKDWKLFIRAKDIDLISHRTIFD 608

Query: 559 -----QEEED--GKMADAEKAERI 575
                QEEE+   K+ +  K +R+
Sbjct: 609 GELVRQEEEEYKEKLRNGPKWKRV 632

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  226 bits (577), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 163/563 (28%), Positives = 259/563 (46%), Gaps = 43/563 (7%)

Query: 26  EFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXX 85
            FK P+++E+    DLE    S  S D +             LKKA+K+RHV M      
Sbjct: 42  SFKPPVEDEK---SDLEE--MSMESTDRH-------------LKKAMKSRHVIMMTLGTG 83

Query: 86  XXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMA-TYIPLDG-FTSYASRY 143
                            P + +I Y  V  + +F +   GEMA TY  L G F +Y S +
Sbjct: 84  VGTGLLVANAKGLSYGGPGALVIGYILVSFVTYFMIQAAGEMAVTYPTLPGSFNTYTSTF 143

Query: 144 CDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXX 203
               +GFA  + +L ++  + P +L    + IQYW D   +N  VW+ IF V ++ ++  
Sbjct: 144 ISKPVGFATVWLFLIQWLTVLPLELITGTMTIQYWNDS--INADVWIVIFYVFLLCVHVF 201

Query: 204 XXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETIT 263
                       ++ K+                       +G +YW++PGSF   +    
Sbjct: 202 GVKAYGELEFIFNTCKILFIGGFIIFSIVVNAGGAGTDGYIGAKYWKNPGSFASST---- 257

Query: 264 GDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIF 323
              GRF     V V A ++Y G EL  +   E  NPR+S PKA K ++YRI+I YL+++ 
Sbjct: 258 -SAGRFKDVCYVLVTAYFSYGGTELYVLSVNEQANPRRSTPKAAKQSIYRILIIYLLTMI 316

Query: 324 LLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDL 383
           L+G  V +D+  L+            P+V+A    G+  +PHIINA +L+ V S  NS L
Sbjct: 317 LIGFNVPHDNDQLMGAGGSSTHAS--PYVLAASIHGVKVVPHIINAVILICVTSMGNSSL 374

Query: 384 YVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVN 443
           Y + R   SLA    APK  A  +R G P  AL+   +  ++A+   SS   ++F +   
Sbjct: 375 YAAQRLFASLAEQGYAPKCLAYIDREGRPIIALAACAVVGVIAFAAASSQEEQVFTWLAA 434

Query: 444 VVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKN 503
           + ++  + +W +IL+++I F  A++ QG D +   Y A    +G+ +   FC L+  I  
Sbjct: 435 IAALSELFTWSTILLSHIRFRMAMKVQGKDLNELGYKALTGVWGSMWGFGFCVLV-FIAQ 493

Query: 504 FTVFLN---HQFDYKNFITGYIGLPVFFFCYFGY-----KFTYKTKVIDPLKVDLYTFKA 555
           F V L+        + F   Y+  P++ F YF Y      FT+ TK+ D   +DL   + 
Sbjct: 494 FWVALSPPGGTISAEGFFESYLAFPLWLFFYFAYMLWKRDFTFLTKLED---IDLDAHRR 550

Query: 556 AIDQEEEDGKMADAEKAERIKQN 578
             D E    +  D E+ E+I+ +
Sbjct: 551 IYDPEFL--RQEDEERKEKIRNS 571

>Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}
           complement(18362..20104) [1743 nt, 581 aa]
          Length = 580

 Score =  226 bits (576), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 154/541 (28%), Positives = 256/541 (47%), Gaps = 14/541 (2%)

Query: 35  ELINDDLERNISSASSQDEN-DSYNIDGKTE---GTRLKKALKARHVSMXXXXXXXXXXX 90
            L  D L+R+ SS +S     +   +D  T     T+  + L  RHV +           
Sbjct: 30  RLSEDWLDRSDSSLTSNTTQIEEEEVDSTTNLIYSTKTHRKLLNRHVQLIAISGVIGTAL 89

Query: 91  XXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALG 149
                       P   LIA+A   + +        EM +++P+   F   AS+  D +L 
Sbjct: 90  FVAIGKALYHGGPAFLLIAFALWCIPILCITVSTAEMVSFLPVASPFLRLASKCADESLA 149

Query: 150 FAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXX 209
               + + F   +  P ++ +   +I YW  ++  N  + + + +V+ + I+        
Sbjct: 150 VTASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYNAAIPLVVQVVLYLFISIATVKYYG 207

Query: 210 XXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDT--- 266
               WL+SFK+                  P HDR GFRYW      K Y +  T  T   
Sbjct: 208 EMEFWLASFKIILAIGLFFFTLVTMLGGNPKHDRYGFRYWGEEPFKKYYPDNNTNGTDSL 267

Query: 267 GRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLG 326
           G F  F++  + A +   G E   ++A E + PRK +PKA K   +R+ I +L +   LG
Sbjct: 268 GYFQGFLTCLIQAAFTIAGGEYISMLAGEIKLPRKVLPKAFKQVFWRLTIIFLGTCLCLG 327

Query: 327 MCVAYDDPLLIXXXXXXX-XXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYV 385
           +  + +DP L              PFV+A+ N  I  LP I+NA ++   FSA N+  Y 
Sbjct: 328 IVCSPNDPSLTAAINEARPGAGSSPFVIAMNNLRIRVLPDIVNAALITSAFSAGNAYTYC 387

Query: 386 SSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVV 445
           SSR+LY +A+D  APKIF + N++G+P YA+ VS+L+ L++ + ++S SA + N+ VN++
Sbjct: 388 SSRTLYGMALDGYAPKIFTRCNKYGVPIYAVGVSLLWALISLLQLNSNSAIVLNWLVNLI 447

Query: 446 SIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFT 505
           +   +++++ + + Y+ F RA  AQ        + +  QPY A F L     +  I+ +T
Sbjct: 448 TASQLINFVFLCVIYLFFRRAYNAQKDKLPPLPFRSWGQPYTAIFGLVCAFSMIFIQGYT 507

Query: 506 VFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKT---KVIDPLKVDLYTFKAAIDQEEE 562
           VF++  ++ ++F+  Y+ + +    Y GYKF +K    K IDP KVD  T    I+  E 
Sbjct: 508 VFIHSLWNTRDFLFCYLMVFINVAIYLGYKFIWKRGKDKFIDPHKVDFITDLKEIEAHEL 567

Query: 563 D 563
           D
Sbjct: 568 D 568

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  227 bits (578), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 163/585 (27%), Positives = 264/585 (45%), Gaps = 45/585 (7%)

Query: 8   SNSTSDQYEEYFEQLPKKE-FKL------PIQEEELINDDLERNISSASSQDENDSYNID 60
           SN    +++E+ +   + E  ++      PI   E + D     IS+  +Q         
Sbjct: 44  SNGLRGRFDEFIDSFRRAEDVRILPNEMNPILSHESVFDTAVVEISAVDNQINE------ 97

Query: 61  GKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFT 120
                 +LKK ++ RHV M                       P   +I YA +   ++  
Sbjct: 98  ------KLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMSTCIYCV 151

Query: 121 MACLGEMA-TYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYW 178
           M  +GEMA  Y+ L  GF++Y     DP L FAV + Y  ++F + P +L  A++ IQYW
Sbjct: 152 MQAVGEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASMTIQYW 211

Query: 179 VDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSF-KVXXXXXXXXXXXXXXXXX 237
               KVN  ++V IF ++++ IN            +  +  K+                 
Sbjct: 212 T--TKVNADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIILICGG 269

Query: 238 XPDHDRLGFRYWRHPGSFKEYSETITGDTG--RFVAFVSVFVYATYAYLGIELTGIVAAE 295
             +   +G RYW  PG+F+       GD G  RF   VS  V A +A+ G E   I A+E
Sbjct: 270 AGNSGFIGARYWHSPGAFR-------GDNGINRFKGIVSTLVTAAFAFGGTEFLAITASE 322

Query: 296 AQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAI 355
             NPRK+IP A K  +YR +I Y+ SI ++G  V Y+   L+            P+V+A+
Sbjct: 323 QANPRKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKAS--PYVIAV 380

Query: 356 INSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYA 415
            + GI  +PH INA +L+ VFS  +S  Y SSR L +LA    APKIF   ++ G P   
Sbjct: 381 ASHGIRVVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLG 440

Query: 416 LSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKS 475
             V  +  ++++   SS  A +FN+ +++  +  + +W  I +++I F RA++ QG    
Sbjct: 441 FVVGAIIAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLD 500

Query: 476 TFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCY 531
              + +    +G+ ++ F   ++ LI  F V +        D  +F   Y+ +PVF   Y
Sbjct: 501 EIGFKSQAGVWGSVYA-FVMMILVLIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLY 559

Query: 532 FGYKFTYK--TKVIDPLKVDLYTFKAAIDQE---EEDGKMADAEK 571
           FGYK   +     I    +DL   +   D E   +E  +M +  +
Sbjct: 560 FGYKIWNRDWRLFIRAKNIDLIAHRHIYDPELLRQERKEMRERAR 604

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  226 bits (575), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 173/568 (30%), Positives = 266/568 (46%), Gaps = 31/568 (5%)

Query: 27  FKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXX 86
           FK P  EEE    D   +     S ++ +    D  ++   LK+ +K RHV M       
Sbjct: 48  FKRP--EEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGI 105

Query: 87  XXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMAT-YIPLDG-FTSYASRYC 144
                           P S LI YA V  +++  +    E+A  Y  L G F +Y +   
Sbjct: 106 GTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLV 165

Query: 145 DPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXX 204
           D A  F+V + Y  ++  + P +L  A++ I+YW D   +NP  +V IF VV++ IN   
Sbjct: 166 DKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDS--INPDAFVVIFYVVLIVINFIG 223

Query: 205 XXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITG 264
                    + ++ KV                   +   LG  YW  PG+F+       G
Sbjct: 224 AAGYAEAEFFFNTCKVLMLIGFFILGIIVNCGGAGNDGYLGSVYWHDPGAFR-------G 276

Query: 265 DTG--RFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISI 322
           + G  RF   V+V V A +AY G E + + AAE QNP+KSI  A K  +YRI+  YL++ 
Sbjct: 277 NNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTA 336

Query: 323 FLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSD 382
            LLG  V Y+ P L+            PFV+AI + G+  +PHIINA +L+ V S  NS 
Sbjct: 337 ALLGFLVPYNSPELLGSGSAATHAS--PFVIAIASHGVKVVPHIINAVILLSVLSVANSA 394

Query: 383 LYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFV 442
           LY SSR L SL+    APK+F   +R G P   L VS +F LL ++  S     +F + +
Sbjct: 395 LYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLL 454

Query: 443 NVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIK 502
            +  +  + +W SI ++++ F R++  QG       Y +    +GA++++    LI LI 
Sbjct: 455 AISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAMIMILLI-LIG 513

Query: 503 NFTVFL----NHQFDYKNFITGYIGLPVFFFCYFGYKFTYKT-KVIDPL-KVDLYTFKAA 556
            F V +    +++ D  NF   Y+ +P+    Y GYK  Y+  +VI P  +VDL + +  
Sbjct: 514 QFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKI 573

Query: 557 IDQE-------EEDGKMADAEKAERIKQ 577
            D E       EE  ++  A   +R  +
Sbjct: 574 FDAEIMQSEQLEEKEQLRHASWTKRAAE 601

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  226 bits (575), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 165/585 (28%), Positives = 275/585 (47%), Gaps = 36/585 (6%)

Query: 6   IPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEG 65
           IPSN ++   +E       ++FK   +  + I  +++ N+S A          +   T  
Sbjct: 34  IPSNGSAVSIDETGSGSKWQDFKDSFKRVKPI--EVDPNLSEAE--------KVAIITAQ 83

Query: 66  TRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLG 125
           T LK  LK RH+ M                       P S LI +   G +++  +  LG
Sbjct: 84  TPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALG 143

Query: 126 EMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKV 184
           E+A   P+ G FT+YA+R+ D + G+A  + Y+ ++ ++ P ++ +A++ + +W    K 
Sbjct: 144 ELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKY 203

Query: 185 NPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRL 244
             G +V +F + IV IN              S  KV                  P    +
Sbjct: 204 RDG-FVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYI 262

Query: 245 GFRYWRHPGSFKEYSETITGDT--GRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKS 302
           G +YW  PG+F        GDT   +F    SVFV A +++ G EL G+ A+E+  PRKS
Sbjct: 263 GGKYWHDPGAF-------AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKS 315

Query: 303 IPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINA 362
           +PKA K   +RI +FY++S+ ++G+ V Y+D  LI            PFV+AI   GI  
Sbjct: 316 VPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAAS--PFVIAIKTHGIKG 373

Query: 363 LPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLF 422
           LP ++N  +L+ V S  NS +Y  SR++ +LA     P+IF+  +R G P   ++V+  F
Sbjct: 374 LPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAF 433

Query: 423 CLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAP 482
            L+A++  S    ++FN+ + +  +  + +W  I I +I F +A+ AQG      ++ +P
Sbjct: 434 GLIAFVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSP 493

Query: 483 FQPYGAWFSLFFCCLIALIKNFTVF---LNHQFDYKNFITGYIGLPVFFFCYFGYKFTYK 539
              +G+++ LF   +I  I  F V    +      + F   Y+  P+    Y G+K   +
Sbjct: 494 TGVWGSYWGLFM-VIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVMVMYIGHKIYKR 552

Query: 540 T-KVIDPL-KVDLYTFKAAID-----QE--EEDGKMADAEKAERI 575
             K+  P  K+D+ T +  +D     QE  EE   MA   +  RI
Sbjct: 553 NWKLFIPAEKMDIDTGRREVDLDLLKQEIAEEKAIMATKPRWYRI 597

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  225 bits (574), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 166/594 (27%), Positives = 271/594 (45%), Gaps = 57/594 (9%)

Query: 28  KLPIQEEELINDDLERNISSASSQD--------------------ENDSYNIDGKTEG-- 65
           KLP  E    N +L  +ISS    D                     +D+++     EG  
Sbjct: 13  KLPATECGSSNSNLRESISSNDLSDGDRGFVNRKLHNFCNSFKRANSDTFDASQDLEGAS 72

Query: 66  -------TRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVF 118
                  ++ K+++K+RHV M                       P   LI Y+ V ++ +
Sbjct: 73  INSVRSNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGLLIGYSLVSVVAY 132

Query: 119 FTMACLGEMATYIP-LDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQ 176
             M   GEMA   P L G F  Y+S +   + GFA  + Y  ++  + P +L  A+L I+
Sbjct: 133 IMMQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVLPLELITASLTIK 192

Query: 177 YWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXX 236
           YW     +NP  ++ IF  VIV I+              S+ KV                
Sbjct: 193 YW--NSSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGFIILSIVINCG 250

Query: 237 XXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEA 296
                  +G  YWR+PG+F   S       G F     V V A ++Y G+EL  +   E 
Sbjct: 251 GAGTGGYIGGEYWRNPGAFAGGSPI-----GHFKGIAYVLVTAYFSYGGMELFALTVNEQ 305

Query: 297 QNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAII 356
            NPRK++P A K  +YRI+I Y++++ L+G  V Y+   L+            P+V+A+ 
Sbjct: 306 ANPRKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSATHAS-PYVIAVA 364

Query: 357 NSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYAL 416
           + G+  +PHIINA +L+ V S  NS +Y + R L SLA    APKIF+  +R G P  AL
Sbjct: 365 SHGVKVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDRAGRPLVAL 424

Query: 417 SVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKST 476
               +F LL+++  S    ++F +   +  +  + +W +I ++++ F  A++ QG   S 
Sbjct: 425 VGCSIFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMKYQGYSLSE 484

Query: 477 FAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL-----NHQFDYKNFITGYIGLPVFFFCY 531
             Y +    +G+ +++FF  +I  +  F V L       + D + F   Y+  P++  CY
Sbjct: 485 LGYKSKTGYWGSIYAIFF-NIIVFVAQFWVALAPIGNGGKADAEAFFQSYLAFPIWISCY 543

Query: 532 FGYK-FTYKTKVIDPL-KVDL----YTFKAAIDQEEEDGKMADAEKAERIKQNG 579
            GYK ++ + K++ PL ++DL    + F   I Q+E+D      E  E++K +G
Sbjct: 544 VGYKIYSKEWKLLVPLDEIDLNSHRHIFDKHILQQEDD------EHKEKLKNSG 591

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  225 bits (574), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 164/594 (27%), Positives = 273/594 (45%), Gaps = 30/594 (5%)

Query: 1   MTIRQIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYN-- 58
           + ++++ SN+ S+  E     LP  ++K    + +       R    A    +  S N  
Sbjct: 19  IGMQELKSNTGSESVERI--SLPGDDYKFHEDDSKSRFRRFARTFHRADGLGDGASGNDV 76

Query: 59  -----IDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFV 113
                +  +TE T+LK+ +  RHV M                       P   +I YA +
Sbjct: 77  EFGAEVARQTE-TKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIM 135

Query: 114 GLLVFFTMACLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAA 171
           G  ++  +   GE+A +Y  L G F +Y S   + A GF+V + Y  ++  + P +L  A
Sbjct: 136 GSCLYCIIQAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTA 195

Query: 172 ALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXX 231
           ++ I+YW     VNP ++V IF V+I+ +N            + +  KV           
Sbjct: 196 SITIKYWTTS--VNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGI 253

Query: 232 XXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGI 291
                   +   +G RYW +PG+F       T     F   +S  V A +A+   E   +
Sbjct: 254 IVNCGGAGNDGYIGGRYWNNPGAFYG-----TKPIHHFKGIISTMVTAAFAFGATEFIAL 308

Query: 292 VAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPF 351
            AAE  NPR++IP A K  +YRI++ +L  I L+G  V ++ P L+            P+
Sbjct: 309 TAAEQANPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHAS--PY 366

Query: 352 VVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGI 411
           V+A+ + G+  +PH INA +L+ V S  NS  Y SSR L +LA  + AP      +R G 
Sbjct: 367 VIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGR 426

Query: 412 PYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQG 471
           P  A+ VS +F L++++  S     +F + + +  +  + +WISI +++I F +A+  QG
Sbjct: 427 PMRAMLVSCVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQG 486

Query: 472 VDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVF 527
                  Y +     G++++ F    I LI  F V +    + + D  +F   Y+ LP+F
Sbjct: 487 KPIGELGYKSQTGVAGSYYATFIMGCI-LIGQFWVAIAPMGSAKLDANSFFENYLALPLF 545

Query: 528 FFCYFGYKFTYKT-KVIDPL-KVDLYTFKAAIDQEEEDGKMADAEKAERIKQNG 579
              YFG+K   +  ++  PL ++DL + +   D  EE  K  DAE  E I+  G
Sbjct: 546 VVLYFGFKIWKRDWRLYIPLEQIDLDSHRKTFD--EELLKQEDAEYEENIRNKG 597

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  224 bits (572), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 156/550 (28%), Positives = 257/550 (46%), Gaps = 28/550 (5%)

Query: 42  ERNISSASSQDENDSYNIDGK---TEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXX 98
           E + +     +EN S   DG    T  ++LKK++K+RHV M                   
Sbjct: 62  EGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGL 121

Query: 99  XXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL--DGFTSYASRYCDPALGFAVGYAY 156
               P + +I Y  V  + +F +   GEMA   P     F +Y+S +   + GFA  + Y
Sbjct: 122 HYGGPAALIIGYILVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLY 181

Query: 157 LFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLS 216
            F++  + P +L  A++ IQ+W DK  +NP +++ IF V +V I+              +
Sbjct: 182 CFQWLTVLPLELITASMTIQFWNDK--INPDIYILIFYVFLVFIHFFGVKAYGETEFIFN 239

Query: 217 SFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDT--GRFVAFVS 274
             K+                   +   +G  YW +PG+F        GDT  GRF     
Sbjct: 240 CCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAF-------AGDTSIGRFKNVCY 292

Query: 275 VFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDP 334
           + V A +++ G+EL  +   E  NPRKS P A K ++YRIV+ YL+++ L+G  V Y+D 
Sbjct: 293 ILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDD 352

Query: 335 LLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLA 394
            L+            P+V+A    G+  +PHIINA +L+ V S  NS LY   R + SLA
Sbjct: 353 QLMGAGGSATHAS--PYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLA 410

Query: 395 IDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWI 454
               APK     +R G P  AL V  +F ++A++  SS    +F +   +  +  + +W 
Sbjct: 411 QQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWT 470

Query: 455 SILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL-----N 509
           SI+++++ F +A++ QG       Y A    +G+ + +FF  L+  +  F V L      
Sbjct: 471 SIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILV-FVAQFWVALAPLGNG 529

Query: 510 HQFDYKNFITGYIGLPVFFFCYFGYK-FTYKTKVIDPL-KVDLYTFKAAIDQEEEDGKMA 567
            + D ++F   Y+  P++   YFGY  +     +++PL K+DL   +   D E    +  
Sbjct: 530 GKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELM--RQE 587

Query: 568 DAEKAERIKQ 577
           D E  E+++ 
Sbjct: 588 DEENKEKLRN 597

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  224 bits (571), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 164/559 (29%), Positives = 257/559 (45%), Gaps = 38/559 (6%)

Query: 30  PIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXX 89
           P Q     ++D+E  I+S  S               T+ KK+L +RHV M          
Sbjct: 53  PSQLHNARSEDVEDGIASIRSD--------------TQFKKSLSSRHVIMMSLGTGIGTG 98

Query: 90  XXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIP-LDG-FTSYASRYCDPA 147
                        P S +I Y  V  + +F +   GEMA   P L G F +Y S +   +
Sbjct: 99  LLVANAKGLYYGGPGSLIIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNAYQSIFISKS 158

Query: 148 LGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXX 207
            GFA  + +  ++  + P +L  ++L I+YW DK  +N  ++V IF V +V+I+      
Sbjct: 159 WGFATVWLFCIQWLTVLPLELITSSLTIKYWNDK--INADIFVMIFYVFLVAIHLVGGIR 216

Query: 208 XXXXXXWL-SSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGD- 265
                 +L +S K+                   +   +G +YW  PGSF E      GD 
Sbjct: 217 AYGETEFLFNSCKILMVIGFIILSIVINAGGAGNDGYIGGKYWHEPGSFAE------GDA 270

Query: 266 TGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLL 325
           T RF     V V   ++Y G EL  +   E   PRK+ P A K ++YRI+I YL+++ L+
Sbjct: 271 TSRFKGICLVLVSGYFSYGGTELYVLSVNEQAEPRKATPAAAKKSIYRILIIYLLTMILI 330

Query: 326 GMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYV 385
           G  V +++  L+            P+V+A    G+  +PH INA +L+ V S  NS L+ 
Sbjct: 331 GFNVPHNNDQLMGAGGSATHAS--PYVLAATIHGVKIVPHFINAVILISVISVANSSLFA 388

Query: 386 SSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVV 445
             R L SLA    APKI +  +R G P  AL +S L  L+A++  +S   ++F +   + 
Sbjct: 389 GPRLLSSLATQGYAPKILSYVDREGRPLVALGISFLIGLIAFVSCTSHEEEVFTWLAAIA 448

Query: 446 SIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFT 505
            +  I +W  I+ +++ F  A++ QG D +   Y A    +G+ +  FF  L+ LI  F 
Sbjct: 449 GLSEIFTWSGIMFSHVRFRAAMKVQGKDINELGYKANTGVWGSAYGAFFGVLV-LIAQFW 507

Query: 506 VFL-----NHQFDYKNFITGYIGLPVFFFCYFGYKFTYKT-KVIDPL-KVDLYTFKAAID 558
           V L       + D + F   Y+  P++  CYFGY    K   ++ PL K+DL +++   D
Sbjct: 508 VALAPIGNGGKCDAEAFFESYLAFPIWVACYFGYMIYNKDFTLLSPLDKIDLDSYRRIYD 567

Query: 559 QEEEDGKMADAEKAERIKQ 577
            E    K  D E  E +K 
Sbjct: 568 PELI--KQEDEENKENLKS 584

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  224 bits (571), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 157/521 (30%), Positives = 239/521 (45%), Gaps = 24/521 (4%)

Query: 68  LKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEM 127
           LK+ +K+RH+ M                       P  + I +  +GL V+  +   GE+
Sbjct: 90  LKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQAAGEL 149

Query: 128 AT-YIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVN 185
           A  Y  L  GF +Y S   DPALGFA  + Y  ++  + P +L  A++ I++W     VN
Sbjct: 150 AVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWPGSRSVN 209

Query: 186 PGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLG 245
           P ++V IF V+I+ IN            + +S KV                       +G
Sbjct: 210 PDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVGTSGYIG 269

Query: 246 FRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPK 305
            +YWR PGS    +         F   V+  V A ++    E   + AAE  NPRKSIP 
Sbjct: 270 GKYWRDPGSLGGRTHF-----DHFKGIVATLVNAAFSLGCSEFVALTAAEQANPRKSIPA 324

Query: 306 AIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPH 365
           A K  +Y+I + +L S+ L+G  V  D   L+            P+V+A+   G+N +P 
Sbjct: 325 AAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVS--PYVIAVRMHGVNVVPS 382

Query: 366 IINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLL 425
            INA +L+ V S  NS  Y SSR L+SLA  N APKIF   +R G P  A+ +S+LF  +
Sbjct: 383 FINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISILFGTI 442

Query: 426 AYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQP 485
            ++  S    ++F + + +  +  + +W +I +++I F RA+  QG       + A    
Sbjct: 443 CFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFKAQTGI 502

Query: 486 YGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCYFGYKFTYK-- 539
            G++ S     L ALI  F V L      + D ++F TGY+ +P+F   YFGYK   K  
Sbjct: 503 IGSYVSAIMMVL-ALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIWNKDW 561

Query: 540 TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGK 580
              I   ++DL + +   D        AD  K E I+   K
Sbjct: 562 RLFIRADQIDLVSHRRIFD--------ADVLKQEDIEYRAK 594

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  225 bits (573), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 158/546 (28%), Positives = 250/546 (45%), Gaps = 30/546 (5%)

Query: 38  NDDLERNIS---SASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXX 94
           N D+E  ++   S  S  ++  +    + +   L+K +K RHV +               
Sbjct: 98  NRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVLLMSLGTGIGTGLLVGN 157

Query: 95  XXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMA-TYIPLDG-FTSYASRYCDPALGFAV 152
                   P   +I YA +G  ++  +   GEMA  Y  L G F +Y S   D A GF+V
Sbjct: 158 GSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSV 217

Query: 153 GYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXX 212
            + Y  ++  + P +L  A++ IQYW     VN  V+V IF V+I+ IN           
Sbjct: 218 AWVYCLQWLCVMPLELVTASMTIQYWT--TTVNADVFVVIFYVLIIFINVFGAKGYAEAE 275

Query: 213 XWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTG--RFV 270
            + +S KV                   +   +G +YW +PG+F+       GD    RF 
Sbjct: 276 FFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR-------GDKSIDRFK 328

Query: 271 AFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVA 330
             +S F  A +A+   E   I A+E  NPR++IP A K  +YRI+  +L SI L+G  V 
Sbjct: 329 DVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVP 388

Query: 331 YDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSL 390
           Y+   L+            P+V+A+ + G+  +PH INA +L+ V S  NS  Y S R L
Sbjct: 389 YNSTELMGSGSAATKAS--PYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRIL 446

Query: 391 YSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGI 450
           YSL+    AP  F   +R G P  A+ +S LF ++A+   SS    +F + + +  +  +
Sbjct: 447 YSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQL 506

Query: 451 LSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL-- 508
            +WI+I +++I F RA++ QG       + +    +G+ ++     L ALI  F V +  
Sbjct: 507 FTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTL-ALIAEFWVSIAP 565

Query: 509 --NHQFDYKNFITGYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAID-----Q 559
                 D +NF   Y+ +P+    YFGYK   +     I    +DL + +   D     Q
Sbjct: 566 IGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGELIKQ 625

Query: 560 EEEDGK 565
           EEE+ K
Sbjct: 626 EEEEFK 631

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  224 bits (570), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 158/558 (28%), Positives = 253/558 (45%), Gaps = 23/558 (4%)

Query: 32  QEEELIN---DDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXX 88
           Q+  +I+   +  +R       QD +   + D     T+LKK +K+RHV M         
Sbjct: 36  QDSTMIHRFVNSFKRAEQPPLKQDSDLEEDTDTIVTDTQLKKTMKSRHVVMMSLGTGIGT 95

Query: 89  XXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIP-LDG-FTSYASRYCDP 146
                         P   +IAY  V  + +F +   GEMA   P L G F +Y S +   
Sbjct: 96  GLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQAAGEMAVVYPTLPGNFNAYISTFISK 155

Query: 147 ALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXX 206
             GFA  + +  ++  + P +L  AA+ +QYW D   +N  V+V IF V ++ I+     
Sbjct: 156 PFGFATVWLFFIQWLTVLPLELITAAMTVQYWNDS--INADVYVVIFYVFLLFIHFFGVK 213

Query: 207 XXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDT 266
                    +  K+                   +   +G +YW  PG+F     T   + 
Sbjct: 214 AYGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSGYIGAKYWHDPGAF-----TSDTNA 268

Query: 267 GRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLG 326
           GRF     V V A ++Y G+EL  +   E +NPR+S P A K ++YRIV+ YL+++ L+G
Sbjct: 269 GRFKGVCYVLVTAYFSYGGMELFALSVNEQENPRRSTPTAAKQSIYRIVVIYLLTMILVG 328

Query: 327 MCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVS 386
             V  +   L+            P+V+A    G+  +PHI+NA +L+ + S  NS LY +
Sbjct: 329 FNVPSNSNELMGSGGSVTHAS--PYVLAASIHGVKVVPHIVNAVILISLISVGNSALYAA 386

Query: 387 SRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVS 446
            R + +LA    APK     +R G P +AL V  +F ++ ++  SS   ++FN+   +  
Sbjct: 387 PRLMCALAQQGFAPKFMDYVDREGRPLFALIVCSVFGVIGFVACSSKEEQVFNWLAAIAG 446

Query: 447 IFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTV 506
           +  + +W  I+I++I F +A++ Q        Y +PF  YG++F +FF  L+  +  F V
Sbjct: 447 LAELFTWSGIMISHIRFRQAMKLQNKSLDEVGYKSPFGVYGSYFGVFFNLLV-FVAQFWV 505

Query: 507 FLN----HQFDYKNFITGYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAIDQE 560
            L      +     F   Y+  P+FF  YFGY    +  T   D   VDL   +   D E
Sbjct: 506 ALAPPMYTEMSADTFFESYLAFPIFFAFYFGYMIWKRDFTLFSDLESVDLDYHRRIYDPE 565

Query: 561 EEDGKMADAEKAERIKQN 578
               K  D EK E +K +
Sbjct: 566 LV--KQEDEEKKEMLKNS 581

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  223 bits (569), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 153/544 (28%), Positives = 251/544 (46%), Gaps = 21/544 (3%)

Query: 35  ELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXX 94
           E   D  +R  +     +  D+  +   T    LK+ LK+RH+ M               
Sbjct: 43  ERFRDSFKRADTQDLDPNLTDAEKMAILTANAPLKRTLKSRHLQMIAIGGAIGTGLFVGS 102

Query: 95  XXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVG 153
                   P   LI +A  G +++  +  +GE+A   P+  GFT+YASR+ D + GFA  
Sbjct: 103 GKALATAGPAGILIGWALTGTMIYCMVMAMGELAVTFPIAGGFTTYASRFVDESFGFAFN 162

Query: 154 YAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXX 213
             Y+ ++ ++ P ++ AA++ + YW   +K   G +V +F VVIV+IN            
Sbjct: 163 TIYMLQWLVVLPLEIVAASITVNYWGTPDKYRDG-FVALFYVVIVAINFFGVKGYGEAEF 221

Query: 214 WLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFV 273
             S  KV                  P    +G R W +PG+F             F    
Sbjct: 222 IFSFIKVITVIGYIILGVILVCGGGPQGGYIGGRLWHNPGAFAN----------GFKGVC 271

Query: 274 SVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDD 333
           SVFV A +++ G EL G+ AAE  NPRKS+P A K   +RI +FY++++ ++G+ V Y  
Sbjct: 272 SVFVTAAFSFAGSELVGLAAAETANPRKSLPSAAKQVFWRITLFYILALLMVGLLVPYTS 331

Query: 334 PLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSL 393
             LI            PFV++I N+GI  LP +IN  +L+ V S  NS ++  SRS+ +L
Sbjct: 332 DRLIGQSSVDAAAS--PFVISIQNAGIKGLPSVINVVILIAVLSVGNSAVFACSRSMAAL 389

Query: 394 AIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSW 453
           A     PKIF   +R G P   + V+ +F LL+++  S    ++F++ + +  +  + +W
Sbjct: 390 ANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTW 449

Query: 454 ISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL---NH 510
             I++ +I   RA+ AQ    +  ++ AP   +G+ +      LI L+  F + L     
Sbjct: 450 GGIMLCHIRVRRALAAQNRTTAELSFTAPTGVWGSVYGFVLIILI-LMAQFWIALFPIGD 508

Query: 511 QFDYKNFITGYIGLPVFFFCYFGYKFTYKT--KVIDPLKVDLYTFKAAIDQEEEDGKMAD 568
           +     F   Y+  P+    Y G+K   K     I    +D+ T +   D E    ++A+
Sbjct: 509 KPSASAFFEAYLSFPILIAFYIGHKIWKKNWKLFIRAKNIDIDTGRRETDIEALKQEIAE 568

Query: 569 AEKA 572
            EKA
Sbjct: 569 -EKA 571

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  224 bits (572), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 156/522 (29%), Positives = 241/522 (46%), Gaps = 25/522 (4%)

Query: 68  LKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEM 127
           LKK++K RH  M                       P   +I YA +G  V+  +   GE+
Sbjct: 145 LKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGEL 204

Query: 128 ATYIP--LDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVN 185
           A      + GF +Y     DPALGF+V + +  ++  + P +L  A++ I+YW     VN
Sbjct: 205 AVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTS--VN 262

Query: 186 PGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLG 245
           P V+V IF V+IV IN            + +  K+                       +G
Sbjct: 263 PDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGYIG 322

Query: 246 FRYWRHPGSFKEYSETITGDT--GRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSI 303
            +YWR PG+F+       GDT   RF   V+ FV A +A+   E   + A+E  NPRK+I
Sbjct: 323 SKYWRDPGAFR-------GDTPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAI 375

Query: 304 PKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINAL 363
           P A K  +YRI+  +L S+ L+G  V Y    L+            P+V+A+ + G+  +
Sbjct: 376 PSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKAS--PYVIAVSSHGVRVV 433

Query: 364 PHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFC 423
           PH INA +L+ V S  N   Y SSR L SLA    APK F   +R G P  A+ VS LF 
Sbjct: 434 PHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFG 493

Query: 424 LLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPF 483
           ++A+   S     +F + + +  +  + +WI+I +++I F RA++ QG       Y +  
Sbjct: 494 VIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQV 553

Query: 484 QPYGAWFSLFFCCLIALIKNFTVFL-----NHQFDYKNFITGYIGLPVFFFCYFGYKFTY 538
             +G+ +++    L ALI  F V +       +   ++F   Y+ +P++   Y  YK   
Sbjct: 554 GVWGSAYAVLMMVL-ALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYKVWK 612

Query: 539 K--TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQN 578
           K  +  I   KVDL + +   D  EE  K  D E  ER++  
Sbjct: 613 KDWSLFIPADKVDLVSHRNIFD--EELLKQEDEEYKERLRNG 652

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  224 bits (571), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 167/559 (29%), Positives = 267/559 (47%), Gaps = 30/559 (5%)

Query: 38  NDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXX 97
           +D++ ++++SA  +  N+       TE   L+K +K RHV M                  
Sbjct: 99  DDEIMQSVASAEHRKVNN-------TESDDLQKTIKPRHVIMISLGTGIGTGLLVGNSSV 151

Query: 98  XXXXXPVSTLIAYAFVGLLVFFTMACLGEMAT-YIPLDG-FTSYASRYCDPALGFAVGYA 155
                P   +I Y+ +G  ++  +   GEMA  Y  L+G F +Y S   DPALGF+V + 
Sbjct: 152 LSAAGPAPLVIGYSIMGSCLYCIIQAAGEMAVVYSDLNGGFNNYPSFLLDPALGFSVAWV 211

Query: 156 YLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWL 215
           Y  ++  + P +L  A+L I+YW    KV+P V+V IF V+I+SIN            + 
Sbjct: 212 YCLQWLCVCPLELVTASLTIKYWT--TKVDPDVFVIIFYVLIISINVFGARGYAEAEFFF 269

Query: 216 SSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFK-EYSETITGDTGRFVAFVS 274
           +  KV                   +   LG +YW  PG+F+ E++        RF   + 
Sbjct: 270 NVCKVLMMIGFFILGIIITAGGAGNDGYLGAKYWHEPGAFRGEHA------VDRFKGVMD 323

Query: 275 VFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDP 334
            FV A +A+   E   + AAE  NPRK+IP A K  +YRIV+ +L+SI +LG  V YD  
Sbjct: 324 TFVAAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRIVLIFLVSIIMLGFLVPYDSD 383

Query: 335 LLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLA 394
            L+            P+V+A+   G+  +PH INA +L+ V S  NS  Y SSR L SL+
Sbjct: 384 QLLGSSGSGVKAS--PYVLAVSLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLS 441

Query: 395 IDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWI 454
               APK F   +R G P  A+ +S LF ++A+   S     +FN+ + +  +  + +W 
Sbjct: 442 QQGYAPKWFDYVDRQGRPARAMLMSALFGVIAFCATSPKETDVFNWLLAISGLSQLFTWF 501

Query: 455 SILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL----NH 510
           +I ++++ F  A++ QG       + +    YG+ ++     ++AL+  F V +      
Sbjct: 502 AICMSHVRFRYAMKVQGRSIGEVGFHSQTGVYGSLYAATM-MILALMAQFWVAIAPLNEG 560

Query: 511 QFDYKNFITGYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAIDQEEEDGKMAD 568
           + D +NF   Y+ +P+    YFGYK  Y+     I   K+DL + +   D  E   K  D
Sbjct: 561 KLDAQNFFQSYLAMPILIALYFGYKLYYRDWKLYIKADKIDLISHRQIFD--ENILKQED 618

Query: 569 AEKAERIKQNGKNFEWFYD 587
            E  E+++ NG  +    D
Sbjct: 619 EEYKEKLR-NGPAWRRIAD 636

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  224 bits (571), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 152/522 (29%), Positives = 238/522 (45%), Gaps = 26/522 (4%)

Query: 68  LKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEM 127
           LK+ ++ RHV M                       P   +I Y+ +G +++  +   GEM
Sbjct: 130 LKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCIIQATGEM 189

Query: 128 A---TYIPLDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKV 184
           A   + +P  G+  Y S   +   GFA+ + Y  ++  + P +L  A+L I+YW     V
Sbjct: 190 AIAYSNLP-GGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYWT--TSV 246

Query: 185 NPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRL 244
           N  ++V IF  +I+ IN            + +  KV                   +   L
Sbjct: 247 NSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAGNDGYL 306

Query: 245 GFRYWRHPGSFKEYSETITGDTG--RFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKS 302
           G  YW  PG+F+       GD+    F       V A +AY G E   + AAE  NPR +
Sbjct: 307 GGLYWHTPGAFR-------GDSSIDHFKGICGTLVTAAFAYGGTEFLALTAAEQSNPRAA 359

Query: 303 IPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINA 362
           IP A K  +YRI+  YLISI ++G  V +D   L+            P+V+A    G+  
Sbjct: 360 IPSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSAS--PYVLAASLHGVRV 417

Query: 363 LPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLF 422
           +PH INA +L+ V S  NS  Y SSR L SLA    APK F   +R G P  A+ +S LF
Sbjct: 418 VPHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMSALF 477

Query: 423 CLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAP 482
            ++A+   S    ++F + + +  +  + +W +I +++I F  A++ QG       Y+A 
Sbjct: 478 GVIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYLAQ 537

Query: 483 FQPYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCYFGYKFTY 538
              +G+W++LF   LI  I  F V +    + +   +NF   Y+ +P+    Y GYK  Y
Sbjct: 538 TGVWGSWYALFMMFLI-YIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYKIYY 596

Query: 539 K--TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQN 578
           K  T +I    +DL + +   D  E+  K  D E  +R+K  
Sbjct: 597 KDWTLLIKAEDIDLQSHRQIFD--EDLLKEEDFEYRQRLKNG 636

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  223 bits (567), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 169/590 (28%), Positives = 278/590 (47%), Gaps = 48/590 (8%)

Query: 8   SNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYN--IDGKTEG 65
           S S+ D   ++ + +  KE ++ + ++E  N ++ R +         DS+   +DG    
Sbjct: 16  SPSSGDLEMKFSDGIMSKETEIDLDKKEDKNKNIVRRMI--------DSFKPPLDGSYHS 67

Query: 66  TRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLG 125
             LK+ LK+RH+ M                       P++ +I ++  G  +  T+  LG
Sbjct: 68  DNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVGTIHGLG 127

Query: 126 EMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKV 184
           E+    P+ G F +Y++R  DP++ F V   Y+ +++ + P +L A+A+ +Q+W    KV
Sbjct: 128 EITMRFPVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFWT--TKV 185

Query: 185 NPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRL 244
           +P VWV IF V++VS+N              S  KV                  PDH  +
Sbjct: 186 DPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGGPDHRFI 245

Query: 245 GFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIP 304
           G  YW HPG+              F    SVFV A+Y+  G E+  + +AE  +P K +P
Sbjct: 246 GTEYWHHPGALAN----------GFKGVASVFVTASYSLGGSEMVCLCSAET-DP-KELP 293

Query: 305 KAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALP 364
            AIK   +RIV F+L+S+ L+G  V Y +  L+            PFV+AI  SGI  LP
Sbjct: 294 HAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSSVNNS----PFVIAIKLSGIRVLP 349

Query: 365 HIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCL 424
            IINA +L+ + S  NS ++ SSR+L S+A     P++F   +R G P   + V+ LF L
Sbjct: 350 SIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLFGL 409

Query: 425 LAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQ 484
           LA++  S++   +F++ + +  +   + W+SI I++I F  A++AQ        + +   
Sbjct: 410 LAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELEFKSSVG 469

Query: 485 PYGAWFSLFFCCLIALIKNFTVFL-------NHQFDYKNFITGYIGLPVFFFCYFGYKFT 537
            YG+ +S     LI LI  F + L       + Q   ++F   Y+   V  F +  +K  
Sbjct: 470 VYGSIYSATVNILI-LIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLVFVFVTHKIY 528

Query: 538 YKTKV-----IDPL-KVDLYTFKAAID-----QEEEDGKMADAEKAERIK 576
           +K          PL ++DL T +  ID     QE  + +M  A K   I+
Sbjct: 529 FKCSTGKWFDFKPLAEIDLETDRKNIDIEIVKQEVREREMYLASKPWYIR 578

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  223 bits (568), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 156/546 (28%), Positives = 257/546 (47%), Gaps = 23/546 (4%)

Query: 43  RNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXX 102
           +    +++ D+ D  +   K +  +LKK +K+RHV M                       
Sbjct: 72  KRAPGSNNPDKEDGSDAGDKGD-NKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGG 130

Query: 103 PVSTLIAYAFVGLLVFFTMACLGEMAT-YIPLDG-FTSYASRYCDPALGFAVGYAYLFKY 160
           P   +I YA +G  ++  +   GE+A  Y  L G F +Y S   DPALGF+V + Y  ++
Sbjct: 131 PAGLVIGYAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQW 190

Query: 161 FILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKV 220
             + P +L  A++ I+YW     VNP ++V IF V+ ++IN            + ++ KV
Sbjct: 191 LCVMPLELVTASITIKYWT--TSVNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKV 248

Query: 221 XXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDT--GRFVAFVSVFVY 278
                              +   +G +YW  PGSF       +GD     F   VS  V 
Sbjct: 249 LMITGFFILGIIVNCGGAGNDGYIGGKYWNDPGSF-------SGDKPIDHFKGVVSTLVT 301

Query: 279 ATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIX 338
           A +A+   E   + AAE  NPRKSIP A K  +YRI++ +L SI L+G  V ++   L+ 
Sbjct: 302 AAFAFGATEFIALTAAEQANPRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMG 361

Query: 339 XXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNK 398
                      P+V+AI + G+  +PH INA +L+ V S  NS  Y SSR L SLA    
Sbjct: 362 SGGSATHAS--PYVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGY 419

Query: 399 APKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILI 458
           AP      +R G P  A+ +S +F L++++  S     +F + + +  +  + +W +I +
Sbjct: 420 APSFLKYVDREGRPTLAMIISAVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICL 479

Query: 459 TYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL---NHQFDYK 515
           ++I F RA++ QG       + +    +G++++     LI + + +T        + D +
Sbjct: 480 SHIRFRRAMKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAE 539

Query: 516 NFITGYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAE 573
            F   Y+ +P+    YFGYK   +  T  I   K+DL + +   D  E+  K  DAE  E
Sbjct: 540 AFFENYLAMPILIALYFGYKVWKRDWTLYIPASKIDLISNRRIFD--EDVLKQEDAEFRE 597

Query: 574 RIKQNG 579
           +++ +G
Sbjct: 598 KLRNSG 603

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  223 bits (567), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 156/560 (27%), Positives = 255/560 (45%), Gaps = 26/560 (4%)

Query: 8   SNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTR 67
             +TS+    +  +  + +FK   +E    +DD     +S  S +     +I      + 
Sbjct: 32  GGTTSNPESSFLSEKNRYDFK---EETTSFSDD---RFNSQHSYNPGSPDDIKEDIHTSN 85

Query: 68  LKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEM 127
           + + L  RH+                         P S +I +  V   +F  +  LGE+
Sbjct: 86  MNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTALFTVINSLGEL 145

Query: 128 ATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNP 186
           A   P+  GF  Y +R+ DP+  F+V   YL ++ +L P +L AA+L I+YW D   +N 
Sbjct: 146 AAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIRYWDDT--INS 203

Query: 187 GVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGF 246
             WV IF  +I+  N             LS  K+                  P    +G 
Sbjct: 204 DAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGGGPKGGYIGG 263

Query: 247 RYWRHPGSFKEYSETITGDTG--RFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIP 304
           +YW  PG+F        GD+   +F    SVFV A ++Y GIE+  + AAE+QNPRK+IP
Sbjct: 264 KYWHDPGAF-------VGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQNPRKTIP 316

Query: 305 KAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALP 364
            A K T + I   Y+  + L+G  VAY+D  L+            P V+AI N GI  LP
Sbjct: 317 TAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAAS-PLVIAIENGGIKGLP 375

Query: 365 HIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCL 424
            ++NA +L+ + S  NS +Y  SR + S+A+    PK  +  ++ G P  A+  ++ F L
Sbjct: 376 SLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFTTLFFGL 435

Query: 425 LAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQ 484
           L+++  S    ++F +   +  +  I  W+ I I +I F +A+  Q        Y++   
Sbjct: 436 LSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMPYLSQTG 495

Query: 485 PYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCYFGYKFTYKT 540
            YG+++      L+ LI +F   L        D + F  GY+  P+   CY G+K  +K 
Sbjct: 496 IYGSYYGTAILFLV-LIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGHKLYFKN 554

Query: 541 -KVIDPL-KVDLYTFKAAID 558
            +++ PL ++DL T +  +D
Sbjct: 555 WRIMTPLEEIDLLTGRKEVD 574

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  223 bits (567), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 161/601 (26%), Positives = 271/601 (45%), Gaps = 44/601 (7%)

Query: 5   QIPSNSTS-DQYEEYFEQLPKKEFKL-------PIQEEELINDDLERNISSASSQDENDS 56
           ++P++ST+  ++  + +     E          PI   + + DD +  IS       +D 
Sbjct: 40  ELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPILSHQSVFDDAKVEISQV-----DDE 94

Query: 57  YNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLL 116
            N        +LKK ++ RHV M                       P   +I YA +   
Sbjct: 95  LN-------EKLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAIMASC 147

Query: 117 VFFTMACLGEMA-TYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALV 174
           ++  +  +GEMA  Y+ L  GF +Y     DPAL F++ + Y  ++F + P +L  A++ 
Sbjct: 148 IYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMT 207

Query: 175 IQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWL-SSFKVXXXXXXXXXXXXX 233
           IQYW    KVN  ++V IF +++++IN            ++ +S K+             
Sbjct: 208 IQYWT--TKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVI 265

Query: 234 XXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTG--RFVAFVSVFVYATYAYLGIELTGI 291
                 +   +G +YWR PG+F+       G  G  RF   VS  V A +++   E   I
Sbjct: 266 ICGGAGNDGFIGGKYWRDPGAFR-------GSDGPNRFKGVVSTLVTAAFSFGQTEFLAI 318

Query: 292 VAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPF 351
            A+E  NPRK+IP A K  +YR ++ YL SI ++G+ V YD   L+            P+
Sbjct: 319 TASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKAS--PY 376

Query: 352 VVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGI 411
           V+A+   G+  +PH INA +L+ VFS  +S  Y SSR L +LA    APK+F   +R G 
Sbjct: 377 VLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGR 436

Query: 412 PYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQG 471
           P     V  +  ++A+   SS   ++FN+ + +  +  + +W  I +++I F RA++ QG
Sbjct: 437 PSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQG 496

Query: 472 VDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL---NHQFDYKNFITGYIGLPVFF 528
                  Y +    +G+ ++     LI + + +   +       D + F   Y+ +PVF 
Sbjct: 497 RSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFI 556

Query: 529 FCYFGYKFTYK--TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFY 586
             Y GYK   +     I    +DL + +   D E    +    E  E+++ NG  +   Y
Sbjct: 557 VLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEIL--RQEREEYQEKLR-NGPVWRRVY 613

Query: 587 D 587
           D
Sbjct: 614 D 614

>ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} similar
           to uniprot|Q03770 Saccharomyces cerevisiae YDR160W SSY1
           Component of the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p) which senses external amino
           acid concentration and transmits intracellular signals
           that result in regulation of expression of amino acid
           permease genes
          Length = 836

 Score =  226 bits (577), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 147/558 (26%), Positives = 253/558 (45%), Gaps = 60/558 (10%)

Query: 61  GKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFT 120
           G  +   +++ L+ RH+ M                       P  TL+ ++  G +V  T
Sbjct: 255 GTGDSHHIQRKLRVRHIQMIGIGACLGVGIFLTSGKAFSIAGPFGTLLGFSLSGSIVLAT 314

Query: 121 MACLGEMATYIPLD-GFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWV 179
           +    E++T IPL  GF+  ASR+ + A GFA+G+ Y F   I  P Q+ A    ++Y+ 
Sbjct: 315 LLSFTELSTLIPLSSGFSGLASRFVEDAFGFALGWTYWFSCMITMPTQVVACTFYLKYF- 373

Query: 180 DKEKVNPGV---WVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXX 236
           D   +N G    + T+F++  V +N                 K+                
Sbjct: 374 DSLNLNKGAIAGFATLFMLYAVLVNLLDVRLMGEIVYITGLIKIIISIIMILAMVILNSG 433

Query: 237 XXPDHDRLGFRYWRHPGSFKEYS------------------ETITGDTGRFVAFVSVFVY 278
               +DR+GFR+W    S    +                  + I G  GRF+A  S  + 
Sbjct: 434 TGTKYDRVGFRFWDSSKSSSNLTYGLFRPTFDLNDIGDGSTKGIEGSGGRFLALASTMLI 493

Query: 279 ATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLI- 337
           +T+AY G+E+  + + EA NPRK+IP A K T   +++ Y+ +IF + + +   DP L  
Sbjct: 494 STFAYTGVEMAFVASGEAINPRKTIPSATKRTFCIVLVIYVFTIFSVSINIYCGDPRLQP 553

Query: 338 --------------------------------XXXXXXXXXXXXPFVVAIINSGINALPH 365
                                                       P+V+A+ N G+     
Sbjct: 554 YFTGSYSARYQAVQRGVGSQWQLSHKCHTNIPYSTKDPVDHNSSPWVLALQNFGLCTFAA 613

Query: 366 IINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLL 425
           + N  ++ F   A  S L+ SSR+LYS+A+  KAP IF + N+ G+PY ++  S +F ++
Sbjct: 614 VFNGILIFFTSGAEISSLFSSSRTLYSMAVQRKAPTIFQRCNKRGVPYVSVIFSGMFGVV 673

Query: 426 AYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQ----GVDKSTFAYVA 481
            Y+ V S + + FN   N+ S    + W+ + ++++ F  A++ +      D+ ++ Y +
Sbjct: 674 GYLAVDSGAVENFNVLSNMSSASTSIIWMGLNVSFLRFYYALKTRRDIISRDEKSYPYRS 733

Query: 482 PFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTK 541
           PFQPY A++ LF CCL  +   FT F++H ++ K+F + Y GL +F  CY GYK    +K
Sbjct: 734 PFQPYLAFYGLFGCCLFIIFMGFTNFIHHFWNVKSFFSAYGGLILFVVCYLGYKMIGTSK 793

Query: 542 VIDPLKVDLYTFKAAIDQ 559
           +    ++D+ T +  +D+
Sbjct: 794 IQRLDQLDMDTGRREMDR 811

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  222 bits (566), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 161/588 (27%), Positives = 269/588 (45%), Gaps = 33/588 (5%)

Query: 4   RQIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKT 63
           +  P ++ S+Q  E      +     PI E+   +D++   ++ + +++     NI+   
Sbjct: 20  KSTPDDAHSEQEGETSFSNIRSFTSSPIPEKS--SDNMTTYVTDSKTKEGGSEKNIETTP 77

Query: 64  E----------GTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFV 113
                         L K L  RH+                         P S +I +  +
Sbjct: 78  SEQFSIAKEDINENLNKDLSIRHLITLAVGGSIGVGLFVNSGAALASGGPASLVIDWVII 137

Query: 114 GLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAA 172
              +F  +  LGE+A   P+  GF  Y +R+ DP++ FA+   YL ++ +L P +L AA+
Sbjct: 138 STCLFTVINALGELAAAYPVVGGFNVYITRFVDPSVAFAINLNYLAQWLVLLPLELVAAS 197

Query: 173 LVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXX 232
           + I+YW D   +N   WV IF  VI   N             LS  K+            
Sbjct: 198 ITIKYWNDT--INSDAWVAIFYSVIALANMLDVKSFGETEFVLSMVKILAIIGFTILGIV 255

Query: 233 XXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDT--GRFVAFVSVFVYATYAYLGIELTG 290
                 P    LG  YW  PGSF        GD    +F    SVFV A ++Y GIELT 
Sbjct: 256 LACGGGPQGGFLGGHYWHDPGSF-------VGDKPGTQFKGLCSVFVTAAFSYSGIELTA 308

Query: 291 IVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXP 350
           + AAE+++PRK+IPKA K T + +   Y+  + ++G  V +DDP L+            P
Sbjct: 309 VSAAESKDPRKTIPKATKRTFWLVTASYVTILTIIGCLVPFDDPRLLNGSSSVDAAAS-P 367

Query: 351 FVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWG 410
            V++I N+GI  L  ++NA +L+ + S  NS +Y  SR + S+A     PK+ ++ ++ G
Sbjct: 368 LVISIKNAGIKGLDSLMNAIILISIVSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRG 427

Query: 411 IPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQ 470
            P  A+  ++ F LL+++  S   A++F +   +  +  I  W++I  ++I F  A++ Q
Sbjct: 428 RPVNAILSTLFFGLLSFIAASDKQAEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQ 487

Query: 471 GVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPV 526
                   Y++     G+W+ +    L+ L+ +F   L    +   D  +F  GY+ LP+
Sbjct: 488 NKTLDELPYLSQCGVIGSWYGVIVLFLV-LVASFWTSLFPLGSGTADVTSFFEGYLSLPI 546

Query: 527 FFFCYFGYK-FTYKTKVIDPLK-VDLYTFKAAIDQEEEDGKMADAEKA 572
              CY G+K +    +V+  L+ +DL T +  ID  E   ++  AEKA
Sbjct: 547 LIACYVGHKLYVRNLQVLVKLEDMDLETGRKHIDAHEHRAEIL-AEKA 593

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  221 bits (564), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 160/559 (28%), Positives = 255/559 (45%), Gaps = 32/559 (5%)

Query: 37  INDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXX 96
           ++ D+ERN  +A S + +           T LKKA+K RHV M                 
Sbjct: 71  VDSDVERNGDAAYSVNTD-----------THLKKAMKTRHVIMMTLGTGIGTGLLVANAK 119

Query: 97  XXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIP-LDG-FTSYASRYCDPALGFAVGY 154
                 P + +I Y  V ++ +  +   GEMA   P L G F +YAS +     GFA  +
Sbjct: 120 GLHFGGPAALVIGYGLVSMVTYIMIQAAGEMAVAYPTLPGNFNTYASIFVSKPFGFATVW 179

Query: 155 AYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXW 214
            +  ++  + P +L  A+L+I+YW   EKVN  V+V IF V ++ I+             
Sbjct: 180 LFCIQWLTVLPLELITASLIIKYWT--EKVNADVFVVIFYVFLLFIHFIGVKAYGETEFV 237

Query: 215 LSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVS 274
            +  K+                       +G +YW  PG+F       T    RF     
Sbjct: 238 FNLCKILMIAGFIIFSIVVNCGGAGHDGYIGGKYWHSPGAFAG-----TNAAERFKGVCY 292

Query: 275 VFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDP 334
           V V   ++Y G EL  +   E +NPRKS P A K ++YRI++ YL+++ L+G  V ++D 
Sbjct: 293 VLVSGYFSYGGTELYVLSVNEQENPRKSTPIAAKQSIYRILVIYLLTMILIGFTVPFNDD 352

Query: 335 LLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLA 394
            L+            P+V+A    G+  +PHIINA +L+ V S  NS LY + R L SLA
Sbjct: 353 QLMGAGGSATHAS--PYVLAASIHGVRVVPHIINAVILIAVISVANSSLYAAPRLLCSLA 410

Query: 395 IDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWI 454
               APK     +R G P YAL    +F ++A+   S    ++F +   +  +  + +W 
Sbjct: 411 EQGYAPKFMTYVDREGRPLYALLACAVFGVIAFSACSDQEEQVFTWLAAIAGLSELFTWS 470

Query: 455 SILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL---NHQ 511
           SI+++++ F +A++ QG D +   Y+A    +G+ + + F  L+  I  F V L      
Sbjct: 471 SIMLSHVRFRQAMKLQGRDLNEVGYIANTGYWGSVYGVVFNILV-FIAQFWVALAPPKSP 529

Query: 512 FDYKNFITGYIGLPVFFFCYFGYKFTYKT-KVIDPL-KVDLYTFKAAIDQEEEDGKMADA 569
              ++F   Y+  P++   YFGY    K    ++PL K+DL   +   D E    K  D 
Sbjct: 530 ITAQSFFESYLAFPIWIAFYFGYMIWNKDYTFLNPLDKIDLDHHRRIYDPEVL--KQEDM 587

Query: 570 EKAERIKQNG--KNFEWFY 586
           E  ER++        +WF+
Sbjct: 588 ENKERVRNGNIWTKLKWFW 606

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  223 bits (568), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 159/591 (26%), Positives = 259/591 (43%), Gaps = 29/591 (4%)

Query: 7   PSNSTSDQYEEYFEQLPKKEFKLPIQEEELIN-----DDLER----NISSASSQDENDSY 57
           PS     +Y    +      F   +++++ +      DDLE      +   + QDE    
Sbjct: 89  PSKDEPTEYPGNNQYQRSSPFSNGLEDDQKVGPDIYIDDLENKQQVELIGTTIQDEELLP 148

Query: 58  NIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLV 117
               +     L++ +K RHV M                       P   +I Y  +G  +
Sbjct: 149 GQKKEDSNAELRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCI 208

Query: 118 FFTMACLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVI 175
           +  +   GEMA  Y  L G F ++ S   DP   FAV + Y  ++  + P +L  A++ I
Sbjct: 209 YCIIQACGEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTI 268

Query: 176 QYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXX 235
           QYW    KV+P V+V IF V+I+ IN              ++ KV               
Sbjct: 269 QYWT--TKVDPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDT 326

Query: 236 XXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAE 295
                   +G +YW  PG+F+  ++       RF   +  FV A +A+   E   + AAE
Sbjct: 327 GAAGTDGYIGAKYWNDPGAFRGQTKI-----ERFKGVMDTFVTAAFAFGATEFIALTAAE 381

Query: 296 AQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAI 355
             NPRK+IP A K  +YR+++ +L +I L+G  V YD   L+            P+V+AI
Sbjct: 382 QSNPRKAIPSAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKAS--PYVLAI 439

Query: 356 INSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYA 415
              G+    H +NA +L+ V S  NS  Y SSR L SLA    APKIF   +R G P  A
Sbjct: 440 SLHGVRVAQHFVNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIA 499

Query: 416 LSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKS 475
           +  S +  ++A+   S    ++F + + +  +  + +W +I ++++ F RA++ QG    
Sbjct: 500 MCCSAVIAVIAFCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLG 559

Query: 476 TFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCY 531
              Y++     G+ ++     ++ALI  F V L     H  D  +F + Y+ +P+    Y
Sbjct: 560 EMGYLSQTGILGSLYAAIM-MILALIAQFWVALVPMGTHTPDANSFFSNYLAMPILIVFY 618

Query: 532 FGYKFTYK--TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGK 580
           FGYK   +     I    +DL + +   D  EE  +  D E  E+++   K
Sbjct: 619 FGYKIWKRDWRLFIRAKDIDLISHRTIYD--EELLRQEDEEYREKLRNGPK 667

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  221 bits (563), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 162/587 (27%), Positives = 269/587 (45%), Gaps = 33/587 (5%)

Query: 7   PSNSTSDQYEE-----YFEQLPKKE--FKLPIQEEELINDDLERNISSASSQDENDSYNI 59
           PS  T  + E+       EQ PK +  F L  +    +N       SS     ++D    
Sbjct: 20  PSAPTGPENEKDSSAFVTEQTPKTDSGFPLSAKGSSGVNQTTNDITSSGRFHSDDDVQQE 79

Query: 60  DGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFF 119
           D     T L K L  RH+                         P S +I +  +   +F 
Sbjct: 80  D--INNTNLSKELSVRHLLTLAVGGAIGTGLFVNTGAALSTGGPASLVIDWVIISTCLFT 137

Query: 120 TMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYW 178
            +  LGE++   P+  GF  Y+ R+ +P+  FAV   YL ++ +L P +L AA++ I+YW
Sbjct: 138 VINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW 197

Query: 179 VDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXX 238
            DK  +N   WV IF   I   N             LS  K+                  
Sbjct: 198 NDK--INSDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLSCGGG 255

Query: 239 PDHDRLGFRYWRHPGSFKEYSETITGDTG-RFVAFVSVFVYATYAYLGIELTGIVAAEAQ 297
           P    +G +YW  PG+F      +  D+G +F    SVFV A ++Y GIE+T + AAE++
Sbjct: 256 PHGGYIGGKYWNDPGAF------VGHDSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESK 309

Query: 298 NPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIIN 357
           NPR++IPKA K T + I I Y+  + L+G  V  +DP L+            P V+AI N
Sbjct: 310 NPRETIPKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAASS-PLVIAIEN 368

Query: 358 SGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALS 417
             I  LP ++NA +L+ V S  NS +Y  SR + ++A     PK   + ++ G P  A+ 
Sbjct: 369 GRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVDKRGRPINAIV 428

Query: 418 VSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTF 477
           +++ F LL+++  S   A++F +   +  +  I  W++I +++I F +A++ Q       
Sbjct: 429 LTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQERSLDEL 488

Query: 478 AYVAPFQPYGAWFSL--FFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCY 531
            +++     G W S+  F    + LI +F   +    +   + ++F  GY+  P+   CY
Sbjct: 489 PFIS---QTGVWGSIYGFVVLFLVLIASFWTSMFPIGSSGANAESFFEGYLSFPILIVCY 545

Query: 532 FGYK-FTYKTKVIDPLK-VDLYTFKAAID--QEEEDGKMADAEKAER 574
           FG+K +T   +++  L+ +DL T +  +D     ++ K+     A+R
Sbjct: 546 FGHKIYTRDWRLLVKLEDMDLDTGRKQVDLNLRRQEMKIEQETLAKR 592

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  222 bits (566), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 159/554 (28%), Positives = 256/554 (46%), Gaps = 28/554 (5%)

Query: 37  INDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXX 96
           ++++L R  SS  + D       + + +   LKK++K RH  M                 
Sbjct: 115 LDNELNRK-SSYITVDGIKQAPQEQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSK 173

Query: 97  XXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIP--LDGFTSYASRYCDPALGFAVGY 154
                 P   +I YA +G  V+  +   GE+A      + GF +Y     DPALGF+V +
Sbjct: 174 VLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAW 233

Query: 155 AYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXW 214
            +  ++  + P +L  A++ I+YW    KV+P V+V IF V+I+ IN            +
Sbjct: 234 LFCLQWLCVCPLELVTASMTIKYWT--VKVDPDVFVVIFYVLIIVINVFGAKGYAEADFF 291

Query: 215 LSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDT--GRFVAF 272
            +  K+                       +G +YWR PG+F+       GDT   RF   
Sbjct: 292 FNCCKILMIIGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFR-------GDTPIQRFKGI 344

Query: 273 VSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYD 332
           V+ FV A +A+   E   + A+E  NPRK+IP A K  +YRI+  +L S+ L+G  V Y 
Sbjct: 345 VATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYT 404

Query: 333 DPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYS 392
              L+            P+V+A+ + G+  +PH INA +L+ V S  NS  Y SSR L S
Sbjct: 405 SDQLLGAAGSATKAS--PYVIAVSSHGVRVVPHFINAVILLSVLSVANSAFYTSSRILMS 462

Query: 393 LAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILS 452
           LA    APK F   +R G P  A+ VS LF ++A+   S     +F + + +  +  + +
Sbjct: 463 LAKQGNAPKCFDYIDREGRPAVAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFT 522

Query: 453 WISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL---- 508
           WI+I +++I F RA++ QG       Y +    +G+ +++    ++ALI  F V +    
Sbjct: 523 WITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLM-MMLALIAQFWVAIAPIG 581

Query: 509 -NHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTK---VIDPLKVDLYTFKAAIDQEEEDG 564
              +   ++F   Y+ +P+    Y  +K  +K      I   KVDL + +   D  EE  
Sbjct: 582 GGGKLSAQSFFENYLAMPILIALYIFFK-VWKNDWSLFIPANKVDLVSHRNIFD--EELL 638

Query: 565 KMADAEKAERIKQN 578
           K  D E  ER++  
Sbjct: 639 KQEDEEYKERLRNG 652

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  221 bits (563), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 157/556 (28%), Positives = 251/556 (45%), Gaps = 34/556 (6%)

Query: 33  EEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXX 92
           E++  + DLE    S +S D++             +KKA+K+RHV M             
Sbjct: 56  EDKHADSDLEDGSKSITSDDDH-------------MKKAMKSRHVIMMTLGTGIGTGLLV 102

Query: 93  XXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL--DGFTSYASRYCDPALGF 150
                     P   ++ Y  V  + +F +   GEMA   P     F +YAS +     GF
Sbjct: 103 ANGKGLALAGPAPLVLGYGLVSFVTYFMIQAAGEMAVTYPTMPASFNTYASIFVSKPFGF 162

Query: 151 AVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXX 210
           A  + +  ++  + P +L  A++ I+YW D   +NP V++ IF V ++ I+         
Sbjct: 163 ATVWLFCIQWLTVLPLELITASMTIKYWNDT--INPDVFIVIFYVFLLFIHFFGVKAYGE 220

Query: 211 XXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFV 270
                +S K+                       +G +YW +PG+F   S        RF 
Sbjct: 221 TEFIFNSCKILMIAGFIILSIVINCGGAGRDGYIGNKYWINPGAFASESPA-----ARFK 275

Query: 271 AFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVA 330
               + V   ++Y G EL  +   E +NPRKS P A K ++YRI+I YL+++ L+G  V 
Sbjct: 276 GVAYILVTGYFSYGGTELFSLSVNEQKNPRKSTPAAAKQSIYRILIIYLLTMILIGFNVP 335

Query: 331 YDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSL 390
           +D   L+            P+V+A    G+  +PH INA +L+ V S  NS LY S R +
Sbjct: 336 HDSDQLMGAGGSATHAS--PYVLAASLHGVKVVPHFINAVILISVVSVANSALYASPRLM 393

Query: 391 YSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGI 450
            SLA    APK F   +R G P  AL +  LF ++ ++  S    + F +   +  +  +
Sbjct: 394 RSLAEQGYAPKWFNYVDREGRPLRALCICGLFGVIGFVACSPQEEQAFTWLAAIAGLSEL 453

Query: 451 LSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL-- 508
            +W SI I++I F  A++ QG       Y A    +G+ +S+FF  L+  I  F V L  
Sbjct: 454 FTWSSIFISHIRFRMAMKVQGKSLEELGYRATTGIWGSVYSVFFNMLV-FIAQFWVALSP 512

Query: 509 ---NHQFDYKNFITGYIGLPVFFFCYFGYK-FTYKTKVIDPL-KVDLYTFKAAIDQEEED 563
              N ++D + F   Y+  P++   YFGY  ++     + PL K+DL   +   D E   
Sbjct: 513 PKSNGKYDAEGFFESYLAAPLWLVFYFGYMIYSRDFTFLTPLDKIDLDFHRRIYDPELL- 571

Query: 564 GKMADAEKAERIKQNG 579
            +  DAE  ER++ +G
Sbjct: 572 -RQEDAETKERLRNSG 586

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  221 bits (562), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 160/549 (29%), Positives = 246/549 (44%), Gaps = 35/549 (6%)

Query: 40  DLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXX 99
           DLE   +S  S D               LKKA+K+RHV M                    
Sbjct: 63  DLEDGTNSIQSDDN--------------LKKAMKSRHVIMMSLGTGIGTGLLVANAKGLY 108

Query: 100 XXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL--DGFTSYASRYCDPALGFAVGYAYL 157
              P S +I Y  V  + +F +   GEMA   P    GF +YAS +     GFA  + + 
Sbjct: 109 LAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFC 168

Query: 158 FKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSS 217
            ++  + P +L  A++ I+YW DK  +N  V+V I  V ++ I+              +S
Sbjct: 169 IQWLTVLPLELITASMTIKYWNDK--INADVFVVILYVFLLFIHFFGVRAYGEAEFIFNS 226

Query: 218 FKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFV 277
            K+                       +G +YWR PG+F            RF     V V
Sbjct: 227 CKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFAS-----DNAASRFKGVAFVLV 281

Query: 278 YATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLI 337
            A ++Y G+EL  +   E +NPR+S P A K ++YRI+I YL+++ L+G  V ++   L+
Sbjct: 282 TAYFSYGGVELFALSVNEQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLM 341

Query: 338 XXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDN 397
                       P+V+A+   G+  +PHIINA +L+ V S  NS LY S R L SLA   
Sbjct: 342 GAGGSATHAS--PYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQG 399

Query: 398 KAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISIL 457
            APK F   +R G P  AL +  +F ++A+   S     IF +   +  +  + +W SIL
Sbjct: 400 YAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSIL 459

Query: 458 ITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQ-----F 512
           ++++ F  A++AQG   +   Y++    +G+ +  FF  L+  I  F V L+       +
Sbjct: 460 LSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLV-FIAQFWVALSPPGSKGVY 518

Query: 513 DYKNFITGYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAIDQEEEDGKMADAE 570
             + F   Y+  PV+ F Y GY    +  T + D  K+DL   +   D E    +  D E
Sbjct: 519 SAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELL--RQEDEE 576

Query: 571 KAERIKQNG 579
             ERI+  G
Sbjct: 577 TKERIRNGG 585

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  221 bits (562), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 146/518 (28%), Positives = 242/518 (46%), Gaps = 18/518 (3%)

Query: 66  TRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLG 125
           T L K L  RH+                         P S +I +  +   +F  +  LG
Sbjct: 84  TNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINSLG 143

Query: 126 EMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKV 184
           E++   P+  GF  Y+ R+ +P+  FAV   YL ++ +L P +L AA++ I+YW DK  +
Sbjct: 144 ELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDK--I 201

Query: 185 NPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRL 244
           N   WV IF   I   N             LS  K+                  P    +
Sbjct: 202 NSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGYI 261

Query: 245 GFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIP 304
           G +YW  PG+F  +S        +F    SVFV A ++Y GIE+T + AAE++NPR++IP
Sbjct: 262 GGKYWHDPGAFVGHSSGT-----QFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIP 316

Query: 305 KAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALP 364
           KA K T + I   Y+  + L+G  V  +DP L+            P V+AI N GI  LP
Sbjct: 317 KAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASS-PLVIAIENGGIKGLP 375

Query: 365 HIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCL 424
            ++NA +L+ V S  NS +Y  SR + ++A     PK   + ++ G P  A+ +++ F L
Sbjct: 376 SLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGL 435

Query: 425 LAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQ 484
           L+++  S   A++F +   +  +  I  W++I +++I F +A++ Q        +++   
Sbjct: 436 LSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQTG 495

Query: 485 PYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCYFGYKFTYK- 539
             G+W+  F    + LI +F   L    +   + ++F  GY+  P+   CYFG+K   + 
Sbjct: 496 VKGSWYG-FIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILIVCYFGHKIYTRN 554

Query: 540 -TKVIDPLKVDLYTFKAAID--QEEEDGKMADAEKAER 574
            T ++    +DL T +  +D     E+ K+     A+R
Sbjct: 555 WTLMVKLEDIDLDTGRKQVDLALRREEMKVERETLAKR 592

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  221 bits (563), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 151/547 (27%), Positives = 252/547 (46%), Gaps = 32/547 (5%)

Query: 23  PKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXX 82
           P+    L ++   + ++ +E++      +DE D+        G +LKK ++ RHV +   
Sbjct: 84  PQPHTNLDMELVGVTSETIEQH-----KKDEGDT--------GDKLKKTIQPRHVILISL 130

Query: 83  XXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMA-TYIPL-DGFTSYA 140
                               P   +I Y  +G L++  +   GEMA  Y+ L  GF +Y 
Sbjct: 131 GTGIGTGLLVGNGATLAQAGPAGLVIGYGIMGSLIYCIIQACGEMAVNYLTLVGGFNAYP 190

Query: 141 SRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSI 200
           +   DP   FA  + Y  ++  + P +L  A++ I+YW    KV+P V+V IF V I+ I
Sbjct: 191 TFLIDPGFSFATAWVYCLQWLCVCPLELVTASMTIKYWT--TKVDPDVFVIIFYVFILGI 248

Query: 201 NXXXXXXXXXXXXWL-SSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYS 259
           N            ++ +S K+                       +G RYW  PG+F+   
Sbjct: 249 NILGGARGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGTDGYIGGRYWHDPGAFRGER 308

Query: 260 ETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYL 319
                   RF   V+  V A +++   E   + A+E  NPR++IP A K  +YR +  YL
Sbjct: 309 AV-----DRFKGVVATLVTAAFSFGQSEFIAVTASEQSNPRRAIPSAAKKIIYRALCIYL 363

Query: 320 ISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSAC 379
            SI LLG  V Y+   L+            P+V+A+ N G+  +PH INA +++ V S  
Sbjct: 364 ASIILLGFLVPYNSSQLLGAQSNGIKAS--PYVLAVANHGVRVVPHFINAVIIISVLSVS 421

Query: 380 NSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFN 439
           NS  Y S R L +L+    APKIF+  +R G P   + V+ LF ++A+   S    ++F 
Sbjct: 422 NSAFYSSPRMLLTLSQQGFAPKIFSYVDRAGRPTMGIIVASLFAVIAFCATSPKEDQVFT 481

Query: 440 YFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIA 499
           + + V  +  I +W+SI ++++ F RA+  QG       +++    YG+ +S F   LI 
Sbjct: 482 WLLAVSGLSQIFTWMSICLSHLRFRRAMTVQGRSLGECGFLSQVGIYGSAYSFFVLALI- 540

Query: 500 LIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCYFGYK-FTYKTKV-IDPLKVDLYTF 553
           L+  F V L    + + D  +F   Y+  P++   Y GYK +T   ++ I    +DL   
Sbjct: 541 LVGQFWVALKPVGSKKVDANSFFENYLAAPIWIALYIGYKCYTKDWRLYIKSQDIDLVAH 600

Query: 554 KAAIDQE 560
           +   D++
Sbjct: 601 RQIYDED 607

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  221 bits (562), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 148/532 (27%), Positives = 250/532 (46%), Gaps = 20/532 (3%)

Query: 64  EGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMAC 123
           E + LK+ +K RHV +                       P   +I Y+ +G  ++  +  
Sbjct: 113 ENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCIIQA 172

Query: 124 LGEMA---TYIPLDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVD 180
            GE+A   + +P + F  Y +   D A GFAV + Y  ++  + P +L  A++ I+YW  
Sbjct: 173 CGELAVCYSSLPSN-FNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT 231

Query: 181 KEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPD 240
              VNP ++V+IF V+I+ IN            + +S KV                    
Sbjct: 232 S--VNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGGAGT 289

Query: 241 HDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPR 300
              +G +YW  PG+F             F   ++ F  A +A+   E   + AAE  NPR
Sbjct: 290 SGYIGAKYWHSPGAFNG-----NRPIDHFKGVMATFTTAAFAFGASEFISLTAAEQSNPR 344

Query: 301 KSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGI 360
           K+IPKA K+ +YRI+  +L SI L+G  V Y+ P L+            P+VVA+ + G+
Sbjct: 345 KAIPKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATKAS--PYVVAVASHGV 402

Query: 361 NALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSV 420
             +PH INA +L+ V S  NS  Y SSR L SLA    APK+F   ++ G P  A+  S 
Sbjct: 403 RVVPHFINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVCST 462

Query: 421 LFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYV 480
           LF  +A+   S    ++F + + +  +  + +W++I I+++ F RA++ QG       + 
Sbjct: 463 LFMTIAFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIGFK 522

Query: 481 APFQPYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCYFGYKF 536
           +    YG+ ++     ++ALI  F V L     +  D +NF   Y+ +P+    YFGYK 
Sbjct: 523 SQVGIYGSLYAATM-LILALIAQFWVALAPIGGNGLDARNFFQNYLAMPILLVLYFGYKI 581

Query: 537 TYKTKV--IDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFY 586
             +     I   ++DL + +   D++    ++A+ E+ ++    G+  + F+
Sbjct: 582 RKRDWKFWIPAHRIDLVSHRKVFDEDILKQEVAEIEQEKKNLSTGRKIQEFF 633

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  220 bits (561), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 160/568 (28%), Positives = 260/568 (45%), Gaps = 34/568 (5%)

Query: 30  PIQEEELIN------DDLERNISSASSQDENDSYNIDGK---TEGTRLKKALKARHVSMX 80
           P + E+LI+         E +I+     +EN S   DG    T  ++LKK++K+RHV M 
Sbjct: 44  PSKSEKLIHRLANSFKRAEGSITKTRQINENTSDLEDGIESITSDSKLKKSMKSRHVVMM 103

Query: 81  XXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL--DGFTS 138
                                 P + +I Y  V  + +F +   GEMA   P     F +
Sbjct: 104 SLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPANFNA 163

Query: 139 YASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIV 198
           Y+S +     GFA  + Y F++  + P +L  A++ IQYW DK  +NP V++ IF + ++
Sbjct: 164 YSSIFISKPFGFATVWLYCFQWLTVLPLELITASMTIQYWNDK--LNPDVYILIFYIFLL 221

Query: 199 SINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEY 258
            I+              +  K+                   D   +G  YW +PG+F   
Sbjct: 222 FIHVFGVKAYGETEFIFNCCKILMIAGFIILSVVINCGGAGDDGYIGGAYWHNPGAF--- 278

Query: 259 SETITGDT--GRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVI 316
                GDT   RF     + V   +++ G+EL  +   E  NPRKS P A K ++YRIVI
Sbjct: 279 ----AGDTSIARFKNVCYILVTGYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVI 334

Query: 317 FYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVF 376
            YL+++ L+G  V Y+D  L+            P+V+A    G+  +PHIINA +L+ V 
Sbjct: 335 IYLLTMILIGFNVPYNDDQLMGAGGSATHAS--PYVLAASIHGVKIVPHIINAVILISVV 392

Query: 377 SACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAK 436
           S  NS LY   R + SL+    APK     +R G P  AL V  +F ++A++  SS    
Sbjct: 393 SVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLRALIVCCIFGVIAFVAASSKEEI 452

Query: 437 IFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCC 496
           +F +   +  +  + +W SI+++++ F +A++ QG       Y A    +G+ +  FF  
Sbjct: 453 VFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSVYGFFFNI 512

Query: 497 LIALIKNFTVFL-----NHQFDYKNFITGYIGLPVFFFCYFGYK-FTYKTKVIDPL-KVD 549
           L+  I  F V L     + +   ++F   Y+  P++   +FGY  +     +++PL K+D
Sbjct: 513 LV-FIAQFWVALAPLGNDGRCSVESFFESYLAAPIWLTFFFGYMIYNRDFTLLNPLDKID 571

Query: 550 LYTFKAAIDQEEEDGKMADAEKAERIKQ 577
           L   +   D E    +  D E  E+ K 
Sbjct: 572 LDFHRRIYDPELI--RQEDQENEEKTKN 597

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  219 bits (559), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 156/544 (28%), Positives = 251/544 (46%), Gaps = 29/544 (5%)

Query: 39  DDLERNISSASSQDENDSYNIDGKTEG----TRLKKALKARHVSMXXXXXXXXXXXXXXX 94
           D  +R     +  D+ND   ++  T      + LKK++K+RHV M               
Sbjct: 71  DSFKRADGQRAGFDDND---LESGTRSFISESHLKKSMKSRHVVMMTLGTGIGTGLLVAN 127

Query: 95  XXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMA-TYIPLDG-FTSYASRYCDPALGFAV 152
                   P   ++AY  V  + +F +   GEMA TY  L G F SY S +     GFA 
Sbjct: 128 ASGLHASGPAPLVLAYGLVSFVTYFMIQAAGEMAVTYPTLPGNFNSYMSLFVSKPFGFAT 187

Query: 153 GYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXX 212
            + +L ++  + P +L  ++L I+YW DK  +N  V+V IF V ++ I+           
Sbjct: 188 VWLFLLQWLTVLPLELITSSLTIKYWNDK--INSDVFVVIFYVFLLFIHFFGVQAYGETE 245

Query: 213 XWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAF 272
              +S K+                       +G +YW  PG+F  ++     + GRF   
Sbjct: 246 FIFNSCKILMIAGFIIFSIVVNCGGAGHDGYIGGKYWHDPGAFTSHT-----NIGRFKGI 300

Query: 273 VSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYD 332
             + V A ++Y G EL  +   E +NPRKS P+A K ++YRIV+ YL+++ L+G  V +D
Sbjct: 301 CFILVTAYFSYGGTELYVLSVNEQENPRKSTPQAAKQSIYRIVVIYLLTMILIGFNVPHD 360

Query: 333 DPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYS 392
           +  L+            P+V+A    G+  +PH INA +L+ V S  NS LY S R L S
Sbjct: 361 NDQLMGSHGSATHAS--PYVLAASIHGVRIVPHFINAVILISVISVANSSLYASPRLLCS 418

Query: 393 LAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILS 452
           LA    APK     +R G P  AL+   LF ++ +   S+   ++F +   +  +  + +
Sbjct: 419 LAQQGYAPKFLTYIDRQGRPLTALATCSLFGVIGFAAASNQEEQVFTWLAAIAGLSELFT 478

Query: 453 WISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL---N 509
           W  I+++++ F +A++ QG D +   Y A    +G+ + +FF  L+     F V L    
Sbjct: 479 WSGIMLSHVRFRQAMKVQGRDLNELGYKAVSGVWGSVYGVFFNILV-FFAQFWVALAPPG 537

Query: 510 HQFDYKNFITGYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAID-----QEEE 562
            +    +F   Y+  P+FF  YFGY    K  T +I    +DL   +   D     QE E
Sbjct: 538 SKPTALSFFESYLAFPIFFTFYFGYMLWNKDFTFLIPLESIDLDFHRRVYDPEFIRQERE 597

Query: 563 DGKM 566
           + K+
Sbjct: 598 EKKI 601

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  218 bits (555), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 160/555 (28%), Positives = 251/555 (45%), Gaps = 26/555 (4%)

Query: 32  QEEELINDDLERNISSASSQD-ENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXX 90
           Q E+L  D LE  I+    Q  E DS N      G  +K+ALK RH+S+           
Sbjct: 9   QREDL--DKLEPKIAEVELQRLETDSLNEFDPHSG--VKRALKNRHISLLALGGIIGPGC 64

Query: 91  XXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALG 149
                       P++ L+ +  +GL+ F  M  +GE+ T  P  G F + A R+    L 
Sbjct: 65  LIGAGNALNKGGPLALLLGFGIIGLVCFSIMESIGELVTLYPSGGGFITLARRFHSEGLS 124

Query: 150 FAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXX 209
              GYAY+  +F +  N+    + ++Q+W  +  +    +  IF    +           
Sbjct: 125 AVSGYAYIVVFFAVLANEYNTISSILQFWGPQVPIYG--YTLIFWFFFLVFQLIGVGAFG 182

Query: 210 XXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRF 269
               WL+ FK+                  P    +GF+YW++PG+              F
Sbjct: 183 ECEYWLAWFKILGLVAFYIFSIVYMSGGIPGKPPIGFQYWKNPGALSH----------GF 232

Query: 270 VAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCV 329
                VFV+ +  Y G E   + A E++NPRK++P A++ T +RI+I YL   F  G+ V
Sbjct: 233 RGIAVVFVFCSTFYSGTESVALAATESRNPRKAVPLAVRQTFWRILIVYLGISFFYGVTV 292

Query: 330 AYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRS 389
            Y+DP L             P  +A+  +G     H++NA +L+   SA NS LY+ SR+
Sbjct: 293 PYNDPTL----GAQTKSLKSPISIALSRAGWAGGVHLVNAFILMTCISAINSSLYIGSRT 348

Query: 390 LYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFG 449
           L  LA +  AP+I A T++ G+P  AL V     L++ M VS  ++  +NY VN+  +  
Sbjct: 349 LSHLAHEGLAPRILAWTDKRGVPVPALIVFNALGLISLMNVSVGASNAYNYIVNLSGVGV 408

Query: 450 ILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLN 509
            + W +I IT++ F +A  AQG   S   Y A F P+   FSL     +ALI+ +T  + 
Sbjct: 409 FIVWSAISITHLRFRKAWVAQGRSLSELPYRALFYPWTTIFSLAANIFLALIQGWTSLV- 467

Query: 510 HQFDYKNFITGYIGLPVFFFCYFGYKF--TYKTKVIDPLKVDLYTFKAAIDQEEEDGKMA 567
             F  K+F+  YI LP     Y G  F      K ++   ++L   +     E+ D +  
Sbjct: 468 -PFVAKDFVDAYILLPAAGLLYVGINFWKNRNFKTVNIHGINLEEGQRRDLDEDSDDETG 526

Query: 568 DAEKAERIKQNGKNF 582
            A K+ R+K    +F
Sbjct: 527 TAPKSTRMKAKLSSF 541

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  219 bits (558), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 160/572 (27%), Positives = 257/572 (44%), Gaps = 34/572 (5%)

Query: 11  TSDQYEEYFEQLP----KKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGT 66
           +S Q   +    P    +K    PI++    N D+    SS + +D N S N D      
Sbjct: 33  SSSQVHSFTSNTPSPFNEKSKDSPIED----NIDITSQ-SSVTKEDINKSLNKD------ 81

Query: 67  RLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGE 126
                L  RH+                         P S +I +  +   +F  +  LGE
Sbjct: 82  -----LSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINSLGE 136

Query: 127 MATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVN 185
           +A   P+  GF  Y +R+ DP+  FAV   YL ++ +L P +L AA++ I+YW     +N
Sbjct: 137 LAAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW--NSTIN 194

Query: 186 PGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLG 245
              WV IF  VI   N             LS  K+                  P    LG
Sbjct: 195 SDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPKGGYLG 254

Query: 246 FRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPK 305
            +YW +PG+F  ++        +F    SVFV A ++Y GIE+T + AAE+++PRK+IPK
Sbjct: 255 GKYWHNPGAFVGHTSGT-----KFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRKTIPK 309

Query: 306 AIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPH 365
           A K T + I   Y+  + L+G  V YDDP L+            P V+AI N GI  L  
Sbjct: 310 AAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAAS-PLVIAIENGGIKGLDS 368

Query: 366 IINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLL 425
           ++NA +L+ + S  NS +Y  SR + S+A     PK   K ++ G P  A  V++ F LL
Sbjct: 369 LMNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTLFFGLL 428

Query: 426 AYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQP 485
           +++  S    ++F +   +  +  I  W++I I++I F +A+  Q        Y++    
Sbjct: 429 SFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPYLSQTGV 488

Query: 486 YGAWFSLFFCCLIALIKNFTVFL---NHQFDYKNFITGYIGLPVFFFCYFGYKFTYK--T 540
           +G+ + +    L+ +   +T          D ++F  GY+ LP+   CY G+K  +K  +
Sbjct: 489 WGSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLPILIVCYIGHKLYFKNWS 548

Query: 541 KVIDPLKVDLYTFKAAIDQEEEDGKMADAEKA 572
            V+   ++DL T + A+D      ++   E A
Sbjct: 549 WVVTLEEMDLDTGRKALDPHLHRAEVIAEEAA 580

>Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON}
           (44303..46144) [1842 nt, 614 aa]
          Length = 613

 Score =  219 bits (559), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 165/588 (28%), Positives = 263/588 (44%), Gaps = 31/588 (5%)

Query: 2   TIRQIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDG 61
           T    PSN  +D   + F  +   E +  ++  E+      R    +  + E+   +IDG
Sbjct: 25  TGSNFPSNQRNDSGFKSFNDIDTSE-RTSVESSEVYRSGRIRRWIDSYKRAEHPREHIDG 83

Query: 62  -----KTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLL 116
                  +G  LKK +K RHV M                       P   +I Y  V  +
Sbjct: 84  FEDGESKDGIHLKKQMKTRHVVMMSLGTGIGTGLLIANAKGLHFAGPAPLVIGYGMVSFV 143

Query: 117 VFFTMACLGEMATYIP-LDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALV 174
            +F +   GE+A   P L G F SY         GFA  +    ++  + P +  AA+L 
Sbjct: 144 TYFMIQAAGELAVAYPTLPGNFNSYFGILISKPFGFATVWLAAVQWLTVLPLEFIAASLT 203

Query: 175 IQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXX 234
           I+YW D+  ++  V+V IF V ++ I+              +  KV              
Sbjct: 204 IKYWNDR--ISGDVFVVIFYVFLLFIHFVGVRAYGETEFIFNLCKVLMIIGFIILSIVIN 261

Query: 235 XXXXPDHDRLGFRYWRHPGSFKEYSETITGDTG--RFVAFVSVFVYATYAYLGIELTGIV 292
                +   +G +YW  PG+F        G+T   RF     + V   ++Y G EL  + 
Sbjct: 262 AGGAGNDGYIGGKYWNDPGAF-------AGETAGSRFKGVCYILVTGYFSYGGTELFVLS 314

Query: 293 AAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFV 352
             E +NPRKS P+A K ++YRIVI YL+++ L+G  V Y+DP L+            P+V
Sbjct: 315 VNEQENPRKSTPQAAKHSIYRIVIIYLLTMILIGFNVPYNDPRLMGADDASGSHAS-PYV 373

Query: 353 VAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIP 412
           +A    G+  +PH INA VL+ + S  NS LY + R + SLA    APKI A  +R G P
Sbjct: 374 LAASIHGVKIVPHFINAVVLIALISVGNSALYAAPRMMVSLAEQGFAPKIMAYVDREGRP 433

Query: 413 YYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGV 472
             +L +  LF L+ +   SS   ++F +   +  +  + +W +  I++I F  A++ QG 
Sbjct: 434 LVSLGICALFGLIGFAASSSKEEQVFTWLAAIAGLSELFTWSAFFISHIRFRWAMKLQGK 493

Query: 473 DKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFF 528
           D     ++A    YG+++ LFF  L+     F V L    + +   ++F   Y+  P++ 
Sbjct: 494 DIKEVGFLASTGLYGSFYGLFFNILV-FAAQFWVALSPIGSKKVGAESFFESYLAFPIWL 552

Query: 529 FCYFGYKFTYKT-KVIDPLK-VDLYTFKAAIDQEEEDGKMADAEKAER 574
           F YFGY    K    ++PL+ +DL   +   D EE    MA+  + E+
Sbjct: 553 FFYFGYMVWAKDFTFLNPLESIDLDFHRRIYDPEE----MAEINRQEK 596

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  219 bits (559), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 159/585 (27%), Positives = 259/585 (44%), Gaps = 44/585 (7%)

Query: 5   QIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTE 64
           +I S ++ D   E  ++  K+   L +QE +++ +         S+Q   +         
Sbjct: 63  EITSAASCDGSSENLDKDGKEVADLEVQENQVLTEK--------SNQKNKE--------- 105

Query: 65  GTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACL 124
              LK+ +K RHV +                       P   LI Y+ +G  ++  +   
Sbjct: 106 ---LKQTIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQAA 162

Query: 125 GEMA-TYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKE 182
           GE+A +Y  L G F  Y S   DPA GF+V + Y  ++  + P +L  A++ I+YW    
Sbjct: 163 GELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWT--T 220

Query: 183 KVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHD 242
            VN  ++V IF V+I+ IN            + +  K+                   +  
Sbjct: 221 TVNADIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDG 280

Query: 243 RLGFRYWRHPGSFKEYSETITGDT--GRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPR 300
            +G RYW  PG+F        GD     F   ++  V A +A+   E   + AAE  NPR
Sbjct: 281 YIGDRYWHTPGAF-------AGDRPIDHFKGIMATMVTAAFAFGATEFIALTAAEQSNPR 333

Query: 301 KSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGI 360
           K+IP A K  +YRI+  +L SI L+G  V YD   L+            P+V+A+   G+
Sbjct: 334 KAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKAS--PYVLAVSTHGV 391

Query: 361 NALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSV 420
             +PH INA +L+ V S  NS  Y SSR LYSLA    APK F   +R G P+ A+  + 
Sbjct: 392 KVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAMVCAG 451

Query: 421 LFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYV 480
           +F ++++   S    ++F + + +  +  + +W +I +++I F +A+  Q        + 
Sbjct: 452 VFAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGEIGFK 511

Query: 481 APFQPYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCYFGYKF 536
           A    +G+++  F   +I LI  F V +      + D + F   Y+ +P+    Y GYK 
Sbjct: 512 AQTGVWGSYYVCFMLVMI-LIAQFWVAIAPIGEGKLDAQGFFENYLAMPILILFYVGYKI 570

Query: 537 TYK--TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNG 579
             K  +  I    +DL   +   D  EE  K  D E  E++K  G
Sbjct: 571 WKKDWSLFIRANNIDLDKHRQIFD--EELLKQEDEEYREKLKNGG 613

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  219 bits (557), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 155/540 (28%), Positives = 256/540 (47%), Gaps = 21/540 (3%)

Query: 46  SSASSQDENDSYNIDGKTEG-TRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPV 104
           S + ++DE  S  +    +G  ++ K L  RH+                         P 
Sbjct: 73  SHSLTRDEAGSGVMKEDVDGHPQMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPA 132

Query: 105 STLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFIL 163
           S +I +  +   +F  +  LGE+A   P+  GF  Y +R+ DP+ GFAV   YL ++ +L
Sbjct: 133 SLVIDWVIISTCLFTVVNSLGELAAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQWLVL 192

Query: 164 PPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXX 223
            P +L AA++ I+YW DK  +N   WV IF   I   N             LS  K+   
Sbjct: 193 LPLELVAASITIRYWNDK--INSDAWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAI 250

Query: 224 XXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSF-KEYSETITGDTGRFVAFVSVFVYATYA 282
                          P    +G +YW  PG+F  E S T      +F    SVFV A ++
Sbjct: 251 VGFTILGIVLSCGGGPKGGYIGGKYWHDPGAFVGETSGT------KFKGLCSVFVTAAFS 304

Query: 283 YLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXX 342
           Y G+ELT + AAE+ NPR++IPKA K T + I + Y+  + L+G  V Y++P L+     
Sbjct: 305 YSGMELTAVSAAESLNPRETIPKAAKRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSS 364

Query: 343 XXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKI 402
                  P V+AI N GI  LP ++NA +L+ + S  NS +Y  SR + S+A     P+ 
Sbjct: 365 VDAASS-PLVIAIENGGIRGLPSLMNAIILIAIVSVANSAVYACSRCMVSMARIRNLPRF 423

Query: 403 FAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYIC 462
             + +R G P  A  +++ F LL+++  S    ++F +   +  +  I +W++I +++I 
Sbjct: 424 LGRVDRKGRPLNATLLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFAWMAINLSHIR 483

Query: 463 FDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFI 518
           F +A+  QG+      Y++     G+W+ +    L+ L+ +F   L        D  +F 
Sbjct: 484 FRQAMAHQGISLDELPYISMTGVSGSWYGVIVLFLV-LVASFWTSLFPLGGKGADATSFF 542

Query: 519 TGYIGLPVFFFCYFGYKFTYKTK--VIDPLKVDLYTFKAAIDQE--EEDGKMADAEKAER 574
            GY+  P+   CY G+K   + K  +ID   +DL + +  +D E   E+ ++   + A+R
Sbjct: 543 EGYLSFPILIVCYVGHKLYIRKKRLLIDVADMDLVSDRKVVDVEVCREEMRIEKEQLAKR 602

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  218 bits (556), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 155/526 (29%), Positives = 251/526 (47%), Gaps = 38/526 (7%)

Query: 60  DGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFF 119
           DG  + + LKK LKARH+ M                       P++ +I +A  G  +  
Sbjct: 78  DGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAIAGSQIIG 137

Query: 120 TMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYW 178
           T+  LGE+    P+ G F +Y++R+ DP++ F V   Y+ ++F + P ++ ++A+ +QYW
Sbjct: 138 TIHGLGEITVRFPVVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEIISSAMTVQYW 197

Query: 179 VDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXX 238
              E ++P VWV IF V IVSIN              S+ KV                  
Sbjct: 198 --NESIDPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFILLCIILIAGGG 255

Query: 239 PDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQN 298
           PDH  +G RYW +PG               F   +SV V A+Y+  G E+T + + E  +
Sbjct: 256 PDHVYVGSRYWHNPGCLAN----------GFPGVLSVMVVASYSLGGTEMTCLASGET-D 304

Query: 299 PRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINS 358
           P K +P AIK   +RI+ F+L+S+ L+G  V Y +  L+            PFV+AI   
Sbjct: 305 P-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSSVDNS----PFVIAIKIH 359

Query: 359 GINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSV 418
            I  LP I+NA +L+ + S  NS ++ SSR+L S+A  +  P  F   +R G P   +  
Sbjct: 360 HIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLVGIIT 419

Query: 419 SVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFA 478
           + LF LLA++  S + +++F++ + +  +   + W+SI +++I F  A++AQG   +   
Sbjct: 420 NSLFGLLAFLVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSLNELE 479

Query: 479 YVAPFQPYGAWFSLFFCCLIALIKNFTVFL-------NHQFDYKNFITGYIGLPVFFFCY 531
           +V+    +G+ +S    CLI L+  F + L       N +   K F   Y+   +    +
Sbjct: 480 FVSAVGIWGSVYSAIINCLI-LVAQFYISLWPIGGWKNSEDRAKKFFQSYLCALIMVCIW 538

Query: 532 FGYKFTY-----KTKVIDPL-KVDLYTFKAAID-----QEEEDGKM 566
            G+K  Y     K     PL ++DL   +  ID     QE  + KM
Sbjct: 539 IGHKIYYWRQTGKIWAFTPLAEIDLDEGRKNIDLDVLKQEIHERKM 584

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  218 bits (555), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 161/551 (29%), Positives = 260/551 (47%), Gaps = 41/551 (7%)

Query: 55  DSYN--IDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAF 112
           DS+   +DG  + + LK+ LK RH+ M                       P+  +I +A 
Sbjct: 63  DSFKSPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAI 122

Query: 113 VGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAA 171
            G  +  T+  LGE+    P+ G F +Y +R+ DP++ F V   Y+ ++F + P ++ AA
Sbjct: 123 AGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAA 182

Query: 172 ALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXX 231
           A+ +QYW     ++P +WV IF  VIVSIN              S+ K            
Sbjct: 183 AMTVQYW--NSSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCV 240

Query: 232 XXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGI 291
                  PDH+ +G +YW  PG               F   +SV V A+Y+  GIE+T +
Sbjct: 241 VLICGGGPDHEFIGAKYWHDPGCLAN----------GFPGVLSVLVVASYSLGGIEMTCL 290

Query: 292 VAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPF 351
            + E  +P K +P AIK   +RI+ F+LIS+ L+G  V Y +  L+            PF
Sbjct: 291 ASGET-DP-KGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSSVDNS----PF 344

Query: 352 VVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGI 411
           V+AI    I ALP I+NA +L+ V S  NS ++ SSR+L S+A     P  F   +R G 
Sbjct: 345 VIAIKLHHIKALPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGR 404

Query: 412 PYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQG 471
           P   +  + LF LLA++  S + +++FN+ + +  +   + W+SI +++I F  A++AQG
Sbjct: 405 PLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQG 464

Query: 472 VDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL-------NHQFDYKNFITGYIGL 524
                  +V+    +G+ +S    CLI LI  F   L       + +   K F   Y+  
Sbjct: 465 KSLDELEFVSAVGIWGSAYSALINCLI-LIAQFYCSLWPIGGWTSGKERAKIFFQNYLCA 523

Query: 525 PVFFFCYFGYKFTYKTKV-----IDPLK-VDLYTFKAAIDQEEEDGKMADAEKAERIKQN 578
            +  F +  +K  YK +      +  LK +DL T     D+++ D ++   E AE+ K  
Sbjct: 524 LIMLFIFIVHKIYYKCQTGKWWGVKALKDIDLET-----DRKDIDIEIVKQEIAEK-KMY 577

Query: 579 GKNFEWFYDKF 589
             +  W+  +F
Sbjct: 578 LDSRPWYVRQF 588

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  219 bits (559), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 151/522 (28%), Positives = 242/522 (46%), Gaps = 25/522 (4%)

Query: 68  LKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEM 127
           LKK++K RH  M                       P   +I YA +G  V+  +   GE+
Sbjct: 145 LKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGEL 204

Query: 128 ATYIP--LDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVN 185
           A      + GF +Y S   DPA+GF+V + +  ++  + P +L  A++ I+YW    KVN
Sbjct: 205 AVIYSDLIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWT--VKVN 262

Query: 186 PGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLG 245
             V+V IF V+I+ IN            + +  K+                       +G
Sbjct: 263 ADVFVIIFYVLILVINIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGYIG 322

Query: 246 FRYWRHPGSFKEYSETITGDTG--RFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSI 303
            RYWR PG+F+       GDT   RF   V+ FV A +A+   E   + A+E  NPRK+I
Sbjct: 323 SRYWRDPGAFR-------GDTSIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAI 375

Query: 304 PKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINAL 363
           P A K  +YRI+  +L S+ L+G  V Y    L+            P+V+A+ + G+  +
Sbjct: 376 PSAAKKMIYRILFVFLASLALVGFLVPYTSDQLLGAAGSATKAS--PYVIAVSSHGVRVV 433

Query: 364 PHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFC 423
           PH INA +L+ V S  NS  Y SSR L SLA    APK F   +R G P  A+ VS +F 
Sbjct: 434 PHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFG 493

Query: 424 LLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPF 483
           ++A+   S     +F + + +  +  + +WI+I +++I F + ++ QG       Y +  
Sbjct: 494 VIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGYKSQV 553

Query: 484 QPYGAWFSLFFCCLIALIKNFTVFL-----NHQFDYKNFITGYIGLPVFFFCYFGYKFTY 538
             +G+ +++    L ALI  F V +     + +   ++F   Y+ +P+    Y  YK   
Sbjct: 554 GVWGSAYAVVLMVL-ALIGQFWVAISPIGGDKKLSAQSFFENYLAMPILIALYIFYKVWK 612

Query: 539 K--TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQN 578
           +  +  I   K+DL + +   D  EE  K  D E  +R++  
Sbjct: 613 RDWSLFIPADKIDLVSHRNIFD--EELLKQEDEEYKDRLRNG 652

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  218 bits (556), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 172/611 (28%), Positives = 269/611 (44%), Gaps = 50/611 (8%)

Query: 2   TIRQIPSNST-----------SDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASS 50
            ++Q  SNST           + ++  + +   K E   P          L+ ++ +  S
Sbjct: 39  NVKQGSSNSTYSLESDHHAASNTRFRRFIDSFKKAEGPQP--------GSLDHDVLAGDS 90

Query: 51  QDENDSYNIDGKTEGTR-LKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIA 109
             E        K +  R LKK +K RHV M                       P   +I 
Sbjct: 91  DIEGKPRTEPEKDDDARELKKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGLVIG 150

Query: 110 YAFVGLLVFFTMACLGEMAT-YIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQ 167
           YA +G  ++  +   GE+A  Y  L  GF +Y S   DPA GFAV + Y  ++  + P +
Sbjct: 151 YAIMGSCIYCIIQATGELAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLE 210

Query: 168 LTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWL-SSFKVXXXXXX 226
           L  A++ I+YW    KV+P V+V IF  +I+ IN            +  +SFK+      
Sbjct: 211 LVTASMTIKYWT--TKVDPDVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTGF 268

Query: 227 XXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGD--TGRFVAFVSVFVYATYAYL 284
                        +   +G R W +PGSF+       GD    RF   VS  V A +A+ 
Sbjct: 269 FILGIVVICGGAGNDGYIGTRLWHNPGSFR-------GDKPVDRFKGVVSTLVNAAFAFG 321

Query: 285 GIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXX 344
             E  G+ A+E  NPRK+IP A K  +YRI+  YL S+ ++G  V YD   L+       
Sbjct: 322 MSEFLGVTASEQSNPRKAIPSAAKKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGAAT 381

Query: 345 XXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFA 404
                P+V+AI   G+  +PH INA +L+ V S  NS  Y SSR L SL+    AP    
Sbjct: 382 KAS--PYVLAISLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLN 439

Query: 405 KTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFD 464
             +R G P  A  VS L  ++A+   S    ++F + + +  +  + +W SI ++++ F 
Sbjct: 440 YVDRNGRPLKAYCVSALVGVIAFCATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFR 499

Query: 465 RAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL---NHQFDYKNFITGY 521
           RA+R QG       + +    YG+ +S     LI + + +T  +     + D + F   Y
Sbjct: 500 RAMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFENY 559

Query: 522 IGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAIDQE---EEDGKMADAEKAERIK 576
           + +P+F   YFG+K   K     I    +DL + +   D+E   +ED      E+  R  
Sbjct: 560 LAMPIFIVLYFGFKIWKKDWRLFIRAEDIDLVSHREIFDEELLKQED------EEYRRKL 613

Query: 577 QNGKNFEWFYD 587
           ++G  +   YD
Sbjct: 614 RDGPMWRRVYD 624

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  219 bits (557), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 156/541 (28%), Positives = 250/541 (46%), Gaps = 26/541 (4%)

Query: 32  QEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXX 91
           +E + +  +L   +S  S+  +     I  K E   L+K+++ RHV M            
Sbjct: 91  EETKHMETELTTTLSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLATGVGTGLL 150

Query: 92  XXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMA-TYIPLDG-FTSYASRYCDPALG 149
                      P   +I YA +G  ++  +   GEMA +Y  L G F +Y +   D   G
Sbjct: 151 VGNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFG 210

Query: 150 FAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXX 209
           FAV + Y  ++  + P +L  A++ I YW    KVN  ++V IF V+I+ IN        
Sbjct: 211 FAVAWVYCIQWLCVMPLELVTASMTIDYWT--TKVNNDIFVVIFYVLIILINVFGAKGYA 268

Query: 210 XXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTG-- 267
               + ++ KV                       +G +YW  PG+F+       GD    
Sbjct: 269 EADFFFNTCKVLMITGFFILAIIINAGGAGTSGYIGAKYWHDPGAFR-------GDRSID 321

Query: 268 RFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGM 327
           RF   ++ F  A +A+   E   I A+E  NPR++IP A K+ +YRI+  +L SI L+G 
Sbjct: 322 RFKDVMATFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGF 381

Query: 328 CVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSS 387
            V YD   L+            P+V+AI + G+  +PH INA +L+ V S  NS  Y S 
Sbjct: 382 LVPYDSSELMGSGSGGTKAS--PYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSC 439

Query: 388 RSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSI 447
           R L+SL+    AP+ F   +R G P  A+ +S+LF ++A+   SS   ++F + + +  +
Sbjct: 440 RILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGL 499

Query: 448 FGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCL--IALIKNFT 505
             I +W++I +++I F RA+  QG   S   + +     G W S++   +  +ALI  F 
Sbjct: 500 SQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQL---GVWGSVYAATMLFLALIAEFW 556

Query: 506 VFL----NHQFDYKNFITGYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAIDQ 559
           V +        D K+F   Y+ +P+    YFGYK   +     I    +DL T +   D 
Sbjct: 557 VSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDA 616

Query: 560 E 560
           E
Sbjct: 617 E 617

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  218 bits (555), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 162/582 (27%), Positives = 269/582 (46%), Gaps = 27/582 (4%)

Query: 9   NSTSDQYEEYFEQLPKKEFKLPIQEE---ELINDDLERNISSASSQDENDSYNIDGKTEG 65
           ++ S Q + ++ +L   +FK   + E    + + D+E +        + +    D     
Sbjct: 48  DARSPQKDVWYTRL-LNDFKRADEGETTRSVADSDMEVDGKRYKEMTDVERAVCDAARNS 106

Query: 66  TRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLG 125
           ++L K L  RH+                         P S LIA+  +   +F  +  LG
Sbjct: 107 SQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSILIAWTLISTCLFTIVNSLG 166

Query: 126 EMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKV 184
           E+A+  P+  GF  Y +R+ +P+ GFAV  +YL ++ +L P +L AA++ I+YW    K+
Sbjct: 167 ELASAFPVVGGFNVYITRFVEPSFGFAVNISYLAQWAVLLPLELAAASITIKYW--NNKI 224

Query: 185 NPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRL 244
           N   WV IF V I   N             LS  K+                  P    +
Sbjct: 225 NSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFAILGTVLICGGGPVGGFI 284

Query: 245 GFRYWRHPGSFKEYSETITGDT--GRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKS 302
           G +YW  PG+F        GDT   +F    SVFV A ++Y G EL G+ AAE+ NPR +
Sbjct: 285 GAKYWHDPGAF-------VGDTPGAQFKGLCSVFVTAAFSYSGTELVGVSAAESINPRYT 337

Query: 303 IPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINA 362
           IP+A K + + I   YL+ + + G  V  +DP L+            P V+AI N GI  
Sbjct: 338 IPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGMSSVDVAAS-PLVIAIENGGIRG 396

Query: 363 LPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLF 422
           +P ++NA +L+ + S  NS +Y  SR + S+A     PK+F   +R G P  A+  +++F
Sbjct: 397 VPSLMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVFNYIDRKGRPLVAILATLVF 456

Query: 423 CLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAP 482
            LL+++  S     IF +   +  +  +  W +I I++I F RA+ AQ        Y++ 
Sbjct: 457 GLLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRFRRAMCAQQRSLDELPYLSL 516

Query: 483 FQPYGAWFS---LFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYK 539
               G+W+    L F  +++   +     +     ++F  GY+  P+F  CY  +K  YK
Sbjct: 517 TGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGPSAESFFEGYLSFPIFLICYISHKL-YK 575

Query: 540 TK---VIDPLKVDLYTFKAAIDQEE-EDGKMADAEKAERIKQ 577
                 I   ++D+ + + A+D EE ++ K+   E+AE  K+
Sbjct: 576 RDWRLFIPAGQIDVDSGRRALDIEELKEQKL--REQAETAKK 615

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  218 bits (554), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 152/562 (27%), Positives = 251/562 (44%), Gaps = 21/562 (3%)

Query: 7   PSNSTSDQYEEYFEQLPKKE---FKLPIQEEELINDDLERNISSASSQDENDSYNIDGKT 63
           P+     +   +  +L  K    F L  ++   IN       SS   +   D+   D   
Sbjct: 24  PAFENEKESTTFVTELTSKTDSAFPLSSKDSPGINQTTNDITSSDRFRRNEDTEQED--I 81

Query: 64  EGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMAC 123
             T L K L  RH+                         P S +I +  +   +F  +  
Sbjct: 82  NNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINS 141

Query: 124 LGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKE 182
           LGE++   P+  GF  Y+ R+ +P+  FAV   YL ++ +L P +L AA++ I+YW DK 
Sbjct: 142 LGELSAAFPVVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDK- 200

Query: 183 KVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHD 242
            +N   WV IF   I   N             LS  K+                  P   
Sbjct: 201 -INSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGG 259

Query: 243 RLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKS 302
            +G +YW  PG+F  +S        +F    SVFV A ++Y GIE+T + AAE++NPR++
Sbjct: 260 YIGGKYWHDPGAFVGHSSGT-----QFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 303 IPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINA 362
           IPKA K T + I   Y+  + L+G  V  +DP L+            P V+AI N GI  
Sbjct: 315 IPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASS-PLVIAIENGGIKG 373

Query: 363 LPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLF 422
           LP ++NA +L+ V S  NS +Y  SR + ++A     PK   + ++ G P  A+ +++ F
Sbjct: 374 LPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFF 433

Query: 423 CLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAP 482
            LL+++  S   A++F +   +  +  I  W++I +++I F +A++ Q        +++ 
Sbjct: 434 GLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQ 493

Query: 483 FQPYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCYFGYKFTY 538
               G+W+  F    + LI +F   L          ++F  GY+  P+   CY G+K   
Sbjct: 494 TGVKGSWYG-FIVLFLVLIASFWTSLFPLGGSGASAESFFEGYLSFPILIVCYVGHKLYT 552

Query: 539 K--TKVIDPLKVDLYTFKAAID 558
           +  T ++    +DL T +  +D
Sbjct: 553 RNWTLMVKLEDMDLDTGRKQVD 574

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  218 bits (555), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 156/592 (26%), Positives = 260/592 (43%), Gaps = 38/592 (6%)

Query: 5   QIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDEN--------DS 56
           + P+ S+S   E   E    +EF          ++DLE   S+   +D+         DS
Sbjct: 89  ETPNASSSTADENAVENYSMQEF----------DNDLENKKSNLHIRDDELDYATVNVDS 138

Query: 57  YNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLL 116
             ++ + E  +LK+ +K RHV M                       P   +I Y  +G  
Sbjct: 139 QPVEQQDENAQLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYGIMGTC 198

Query: 117 VFFTMACLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALV 174
           ++  +   GE+A  Y  ++G F ++ S   DP   FAV + Y  ++  + P +L  +++ 
Sbjct: 199 LYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMT 258

Query: 175 IQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXX 234
           I+YW    KV+P V+V IF V+I+ IN            + +  KV              
Sbjct: 259 IKYWT--TKVDPDVFVVIFYVLILLINFFGAKGYAEAEFFFNCCKVMMMIGFFIMAICIN 316

Query: 235 XXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAA 294
                    +G +YW  PG+F+  ++       RF   +  FV A +A+   E   + AA
Sbjct: 317 TGAAGTDGYIGAKYWNDPGAFRGQTKI-----ERFKGVMDTFVTAAFAFGATEFIALTAA 371

Query: 295 EAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVA 354
           E  NPRK+IP A K   YRI++ +L SI L+G  V Y+   L+            P+V+A
Sbjct: 372 EQSNPRKAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLMGSSSGGNSAS--PYVLA 429

Query: 355 IINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYY 414
               G++ + H INA +L+ V S  NS  Y SSR L  LA    APK F   +R G P  
Sbjct: 430 ASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLR 489

Query: 415 ALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDK 474
           ++  + +  ++A+   S     +F + + +  +  I +W +I +++I F R ++ QG   
Sbjct: 490 SMLCAAIIAVIAFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSL 549

Query: 475 STFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFC 530
               + A     G++++      +AL+  F V L     H  D +NF   Y+ +P+    
Sbjct: 550 GELGFRAQTGVLGSYYAAIM-LFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLAL 608

Query: 531 YFGYKFTYK--TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGK 580
           Y G+K   +     I    +DL + +   D  EE  +  D E  E+++   K
Sbjct: 609 YVGFKLWRRDFRLFIRAKNIDLISHRIIFD--EELLRQEDEEYKEKLRNGPK 658

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  216 bits (551), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 160/591 (27%), Positives = 269/591 (45%), Gaps = 40/591 (6%)

Query: 2   TIRQIPSNSTSDQYEEYFEQL------PKKEFKLPIQE-EELINDDLERNISSASSQDEN 54
            + ++  +  SDQ  +Y++         K  F+  +    EL  +D++ N+++A      
Sbjct: 24  AVEELSPDVESDQNHDYYKDKVHVNDPNKSRFQNFVDGFRELRMEDVDPNLTAAERAAI- 82

Query: 55  DSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVG 114
                   T  + LK+ LK RH+ M                       P + +IA+   G
Sbjct: 83  -------ATASSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTG 135

Query: 115 LLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAAL 173
            +V+  +  LGE+A  +P+ G + SY SR+ +P+ GFA+ Y YL    I  P +L AA++
Sbjct: 136 SMVYSVVQALGELAVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASI 195

Query: 174 VIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXX 233
            + YW D +      +V +F +VIV IN              S  KV             
Sbjct: 196 TVNYW-DVDSKYADAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVL 254

Query: 234 XXXXXP-DHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIV 292
                P D   +G RYW +PG F             F  F ++FV + +++ G E+  + 
Sbjct: 255 VCGGGPSDEGYIGARYWYNPGGFAH----------GFKGFAAIFVTSAFSFAGSEMFALA 304

Query: 293 AAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFV 352
           AAE +NPRK +P+A K   +RI +FY+IS+ L+G  V Y D  L             PFV
Sbjct: 305 AAETENPRKDLPRAAKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASAS--PFV 362

Query: 353 VAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIP 412
           +AI  +GI  LP ++N  +L+ V S  N  +Y +SR++ SLA     P+ F   +R G P
Sbjct: 363 IAIARAGIKGLPSVVNVVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRP 422

Query: 413 YYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGV 472
              + +  +F LL+++  SS   ++F++ + +  +     W SI + ++ F RA+  QG 
Sbjct: 423 LVGILLCAIFGLLSFLSASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGR 482

Query: 473 DKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVF-----LNHQFDYKNFITGYIGLPVF 527
                +Y A     G W SL+   LI ++  F  +     +    +  +F + Y+ LPV 
Sbjct: 483 STDELSYKA---QTGIWGSLYGIGLIFIVLCFQFWVALFPIGGSPNANHFFSAYLSLPVV 539

Query: 528 FFCYFGYKFTYK--TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIK 576
            F Y  +K   +  T +I    +D+ T +  +D E    ++ + ++  R K
Sbjct: 540 IFFYTCHKLYTRSWTFLIKSSDIDIDTGRREMDLELLKQEIQEEQQYIRSK 590

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  216 bits (549), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 153/501 (30%), Positives = 231/501 (46%), Gaps = 36/501 (7%)

Query: 48  ASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTL 107
           +++ DEND            L KA+++RH+ M                       P+  +
Sbjct: 76  STAGDEND------------LNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLI 123

Query: 108 IAYAFVGLLVFFTMACLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPP 165
           I Y    L+VF  +   GE+   Y  + G FT Y +   DPA GFA+ + Y  ++ I+ P
Sbjct: 124 IGYIVSSLMVFLIIQAAGELGIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVLP 183

Query: 166 NQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXX 225
            QL  AA+ IQ+W     VN  V+V    VV+V IN            + +  K+     
Sbjct: 184 LQLVTAAMTIQFW--NVGVNLDVFVLASFVVVVLINLGGARGYVEAEFFCNLCKIVMLTG 241

Query: 226 XXXXXXXXXXXXXPDHDR--LGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAY 283
                        P+     +G +YWR+PG F             F    SVF YA ++Y
Sbjct: 242 FVILGIIITAGGIPNGPDGYIGGKYWRNPGLFAN----------GFKGVCSVFCYAAFSY 291

Query: 284 LGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXX 343
            G+E   + AAE +NP KSIP A K  MYRI+  YL+S+ ++   V Y  P L+      
Sbjct: 292 GGVETLVLSAAEQKNPLKSIPSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSGSG 351

Query: 344 XXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIF 403
                 PFV+AI + G++ +PH+INA +L+ V S  NS LYV+ R L SLA    APK  
Sbjct: 352 SHSS--PFVIAIASHGVSVVPHLINAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFL 409

Query: 404 AKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICF 463
              ++ G P     V VLF ++ ++  S     +F + +++  +  I  WISI +++I F
Sbjct: 410 NYIDKRGRPTTCTLVVVLFGMIGFVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRF 469

Query: 464 DRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL-----NHQFDYKNFI 518
             A+R QG   +  AY A    +G++ ++    L  L+  F V +     + + D  NF 
Sbjct: 470 RDAMRVQGHPLTEIAYKAQTGYWGSYVAIAL-ALFVLVCQFWVAIAPVGAHGKLDATNFF 528

Query: 519 TGYIGLPVFFFCYFGYKFTYK 539
             Y+  PV    Y G+K  YK
Sbjct: 529 QNYLAFPVVLCAYLGFKVYYK 549

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  216 bits (550), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 167/594 (28%), Positives = 275/594 (46%), Gaps = 55/594 (9%)

Query: 9   NSTSDQYEEYFEQLPKKEFKLPIQEEELI------------NDDLE---RNISSASSQDE 53
           +S  D  EE  E+  K EF +  + ++L             +DD +   RNI     Q  
Sbjct: 7   SSVKDSSEELKERRSKVEF-VEYKSKQLTSSSSHNSKSSHHDDDGQYNNRNIF----QRC 61

Query: 54  NDSYN--IDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYA 111
            DS+   +DG  + + LK+ LK RH+ M                       P+  ++ + 
Sbjct: 62  VDSFKPPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWT 121

Query: 112 FVGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTA 170
             G  +  T+  LGE+    P+ G F +Y +R+ DP++ F V   Y+ ++F + P ++ A
Sbjct: 122 IAGSQIIGTVHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIA 181

Query: 171 AALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXX 230
           AA+ +QYW     ++P +WV IF  VIVSIN              S+ K           
Sbjct: 182 AAMTVQYW--NSSIDPVIWVAIFYAVIVSINLFGARGFGEAEFAFSTVKAITVGGFIILC 239

Query: 231 XXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTG 290
                   PDH+ +G +YW  PG               F   +SV V A+Y+  GIE+T 
Sbjct: 240 IVLICGGGPDHEFIGAKYWHDPGCLAH----------GFPGVLSVLVVASYSLGGIEMTC 289

Query: 291 IVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXP 350
           + + E  +P K +P AIK   +RI+ F+L+S+ L+G  V Y +  L+            P
Sbjct: 290 LASGET-DP-KGLPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSSVDNS----P 343

Query: 351 FVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWG 410
           FV+AI    I  LP I+NA +L+ V S  NS ++ SSR+L S+A     P  F   +R G
Sbjct: 344 FVIAIKLHHIKVLPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAG 403

Query: 411 IPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQ 470
            P   +  + LF LLA++  S + +++FN+ + +  +   + W+SI ++++ F  A++AQ
Sbjct: 404 RPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHVRFRLAMKAQ 463

Query: 471 GVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL-------NHQFDYKNFITGYIG 523
           G       +V+    +G+ +S    CLI LI  F   L       + +   K F   Y+ 
Sbjct: 464 GKSLDELEFVSAVGIWGSVYSALINCLI-LIAQFYCSLWPIGGWTSSKERAKIFFQNYLC 522

Query: 524 LPVFFFCYFGYKFTYKTKV-----IDPLK-VDLYTFKAAIDQEEEDGKMADAEK 571
             +  F +  +K  Y+ ++     +  LK +DL T +  ID E    ++A+ +K
Sbjct: 523 ALIMVFIFVIHKIYYRCQMGKWWGVKELKDIDLETDRKDIDIEIVKQEIAEKKK 576

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  216 bits (550), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 162/586 (27%), Positives = 271/586 (46%), Gaps = 39/586 (6%)

Query: 9   NSTSDQYEEYFEQLPKKEFKLPIQEEELIND--DLERN-ISSASSQDENDSYNIDGKTEG 65
           N  ++ + +  E L  K+F    ++ +  N+  ++E+N I++  S   ND  N       
Sbjct: 27  NQINESHSKLIENL--KDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLN------- 77

Query: 66  TRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLG 125
            +L+K ++ RHV M                       P   LI Y  +   ++  +   G
Sbjct: 78  NQLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQACG 137

Query: 126 EMA-TYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEK 183
           EMA  Y+ L  GF +Y S   D A  FAV + Y  ++  + P +L  A++ I+YW   EK
Sbjct: 138 EMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NEK 195

Query: 184 VNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSF-KVXXXXXXXXXXXXXXXXXXPDHD 242
           V+P V+VTIF ++I++IN            +  +  K+                      
Sbjct: 196 VDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTSG 255

Query: 243 RLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKS 302
            +G  YW +PG+F+ ++        RF   VS  V A +++   E   I A+E  NPRK+
Sbjct: 256 YIGVSYWNNPGAFRGHTPGT-----RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKA 310

Query: 303 IPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINA 362
           IP A K  +YR +  Y+ SI ++G  V Y+ P L+            P+V+A+ + GI  
Sbjct: 311 IPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKAS--PYVIAVASHGIRI 368

Query: 363 LPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLF 422
            PH INA +L+ V S  NS  Y SSR L +LA    APKIF   +R G P + +  + L 
Sbjct: 369 APHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLL 428

Query: 423 CLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAP 482
             +A+   S    ++F++ + +  +  + +W +I +++I F RA++ QG   +   Y + 
Sbjct: 429 ATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQ 488

Query: 483 FQPYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCYFGYKFTY 538
              +G+ ++     LI LI  F V L    ++  +  NF   Y+ +P+    YFGYK T+
Sbjct: 489 VGVWGSIYAATVMFLI-LIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYK-TW 546

Query: 539 KTK---VIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKN 581
           K      I    +DL + +   D++         ++  + K+N KN
Sbjct: 547 KKDWNLFIRAKDIDLISHRHIYDED------VLKQEKNQYKENLKN 586

>AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR132C (AGP2)
          Length = 566

 Score =  215 bits (547), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 157/556 (28%), Positives = 262/556 (47%), Gaps = 23/556 (4%)

Query: 25  KEFKLPIQEEELINDD----LERNISSASSQ------DENDSYNIDGKTEGTRLKKALKA 74
           +E +  + +  L NDD    + R  S   S+      DE  S    GK   T  K  L+ 
Sbjct: 2   QECRPLLMKSTLPNDDRGVAIRRKDSWVPSEHSSEVGDEASSAGFAGKYHSTYRK--LEN 59

Query: 75  RHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLD 134
           RHV +                        VS L+ +A   + +        EM  Y+PL+
Sbjct: 60  RHVQLIGISGVIGTALFVSIGKALYRGGSVSLLLGFALWCVPILCITVSTAEMVCYLPLN 119

Query: 135 G-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIF 193
             F   ASR  + +L    G+ + F   +  P ++ A   +I YW D       + V + 
Sbjct: 120 SPFLRLASRCVNDSLTVMAGWNFWFLECVQIPFEIVAVNSIIHYWRDDYSAAITLVVQVM 179

Query: 194 LVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPG 253
           L +++S+             WL+SFKV                  P  DR GFRY     
Sbjct: 180 LYLLISL--FAVRYYGEIEFWLASFKVLLAVGLFCFTFVTMVGGNPKRDRYGFRYIGE-A 236

Query: 254 SFKEYS---ETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLT 310
            FK+YS   E I+   G F  F++  + A++   G +   ++A E + PRK +P A K  
Sbjct: 237 PFKQYSPTMEPISSSAGYFQGFLACLIQASFTIAGPDYVSMIAGETKLPRKVLPVAFKQV 296

Query: 311 MYRIVIFYLISIFLLGMCVAYDDP-LLIXXXXXXXXXXXXPFVVAIINSGINALPHIINA 369
             R+ + +L     +G+  + +DP L              P+V+A+ + GI  LP I+NA
Sbjct: 297 FIRLTVLFLGGCLCVGIVCSANDPDLTAAINASRPGAGSSPYVIAMNHLGIKILPDIVNA 356

Query: 370 CVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMC 429
            ++   FSA N+  Y SSRSLY LA+D  AP IF + NR+G+P YA+SVSV++ +L+ + 
Sbjct: 357 ALVTAAFSAGNAYTYCSSRSLYGLALDGYAPAIFKRCNRFGVPIYAVSVSVMWSVLSLLQ 416

Query: 430 VSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAW 489
           ++S SA + N+ +++++   ++++  + + Y+ F RA  AQ  +    ++ + +QPY A+
Sbjct: 417 LNSNSAVVLNWLISLITASQLINFGVLCVVYLYFRRAYLAQQDNLPELSFKSWWQPYTAY 476

Query: 490 FSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTY---KTKVIDPL 546
             L    LI +++ +TVF +  ++ K+F+  Y+ + +    Y GY++ +   K  VI P 
Sbjct: 477 VGLTCVLLIVVVQGYTVFYSALWNVKDFLFCYLMVFIDIAIYLGYRYIWRRGKDAVIPPT 536

Query: 547 KVDLYTFKAAIDQEEE 562
           +VDL T    I+  E 
Sbjct: 537 EVDLTTGLLEIELHER 552

>TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.342
           YDR160W
          Length = 840

 Score =  220 bits (560), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 140/550 (25%), Positives = 254/550 (46%), Gaps = 58/550 (10%)

Query: 68  LKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEM 127
           +++ L+ RH+ M                       P  TL+ +A  G +VF ++    E+
Sbjct: 266 VQRKLRVRHIQMIGIGACISVGICLTSGKAFSIAGPFGTLLGFAISGSVVFASLLSFTEL 325

Query: 128 ATYIPLD-GFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYW--VDKEKV 184
           A+ IP+  GF+  ASR+ + A GFA+G+ Y F   I  P Q+ A+   + Y+  + + + 
Sbjct: 326 ASLIPVSSGFSGLASRFVEDAFGFALGWTYWFSSMIALPAQVVASTFFLSYYSSMKRSRG 385

Query: 185 NPGVWVTIFLVVIVSINXXXXXXXXXXXXWLS-SFKVXXXXXXXXXXXXXXXXXXPDHDR 243
           +   +VT+FL+  + IN                   +                    HD+
Sbjct: 386 STAGFVTLFLLYPIFINLLDVRIMGEVVYVTGLIKIIISVVVIISMLIFNAGHGGASHDQ 445

Query: 244 LGFRYWRHPGSFKEYS------------------ETITGDTGRFVAFVSVFVYATYAYLG 285
           +GFRYW    SF +++                    I G TGRF+A +SV + +T+AY G
Sbjct: 446 VGFRYWDSSKSFSQFTFGLFRPTFDLNDAGEGSTHGIEGATGRFLAVISVILISTFAYSG 505

Query: 286 IELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXX 345
           +E+T + + EA NPRK+IP AIK T+  ++I Y++S+  +G+ +   DP L+        
Sbjct: 506 VEMTFVASGEAVNPRKTIPSAIKRTLNIVIIIYMLSLISVGVNIYCGDPRLLSYFSGSAE 565

Query: 346 XX--------------------------------XXPFVVAIINSGINALPHIINACVLV 373
                                               P+V+A+ N G+     ++N  ++ 
Sbjct: 566 RRFITAMNDDSIRWQVSERCRSGLHYETGYQRNGSSPWVLALQNFGMCTYASVLNGIMIF 625

Query: 374 FVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSA 433
               A  S L+  SR+LY++A+  KAP I  +  + G+PY ++  +  F  ++Y+ V + 
Sbjct: 626 ITVGAEISSLFSGSRTLYAMAVQRKAPAILQRCTKAGVPYVSVLFTSAFGAISYLAVDTT 685

Query: 434 SAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQ----GVDKSTFAYVAPFQPYGAW 489
           + + F    N+ S    + W+ + ++++ F  A++ +      D  ++ Y +PFQPY + 
Sbjct: 686 AIENFGVLSNISSASTSIIWMGLNVSFLRFYYALKLRQDIISRDDRSYPYRSPFQPYLSM 745

Query: 490 FSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVD 549
           + LF CC+  +   +T FL+  ++ K+F + Y GL +F  CY GYK    +K+    ++D
Sbjct: 746 YGLFGCCMFVIFMGYTNFLHKYWNTKSFFSAYGGLMLFSACYLGYKIIGTSKIQRLDQLD 805

Query: 550 LYTFKAAIDQ 559
           + T +  +D+
Sbjct: 806 MDTGRREMDR 815

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  216 bits (549), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 170/602 (28%), Positives = 275/602 (45%), Gaps = 51/602 (8%)

Query: 8   SNSTSDQYEEYFEQLPKKEFKLPIQEEELINDD--LERNISSASSQDEN---------DS 56
           S ST D   +   +  K EF   I+ +    DD  +  +  S  S+ E          DS
Sbjct: 5   SLSTQDVSSDIKYKSSKNEFITIIESDNKNIDDNFIPHDTLSTISRKEKKPPIYRRIIDS 64

Query: 57  YNI--DGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVG 114
           +    DG      LKK+LK+RH+ M                       P++ +I +A  G
Sbjct: 65  FKPPEDGSFHTGNLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAVAG 124

Query: 115 LLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAAL 173
             +  T+  LGE+    P+ G F SY +R+ DP++ F V   Y+ ++F + P ++ A+A+
Sbjct: 125 SQIVGTIHGLGEITVRFPVVGAFASYTTRFLDPSISFVVSTIYVLQWFFVLPLEIIASAI 184

Query: 174 VIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXX 233
            +QYW D   ++P V+V IF  VIVSIN              S+ K+             
Sbjct: 185 TVQYWNDS--IDPVVFVAIFYCVIVSINLFGARGFGEAEFIFSTVKIITICGFIILCIVL 242

Query: 234 XXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVA 293
                PDH+ +G +YW +PGS              F   +SV V A+Y+  G E+T + +
Sbjct: 243 IAGGGPDHEYIGAKYWHNPGSLAH----------GFKGVLSVLVVASYSLGGTEMTCLAS 292

Query: 294 AEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVV 353
            E  +P K +P AIK   +RI+ F+L+S+ L+G  V Y +P L+            PFV+
Sbjct: 293 GET-DP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNPNLLGGSSVDNS----PFVI 346

Query: 354 AIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPY 413
           AI    I  LP I+NA +LV + S  NS ++ SSR+L S+A  +  P  F   +R G P 
Sbjct: 347 AIKIHNIKVLPSIVNAVILVSILSVGNSCIFASSRTLCSMAHQHLIPWWFGYIDRAGRPL 406

Query: 414 YALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVD 473
             + ++ LF LLA++  SS+  ++F++ + +  +   + W+SI I ++ F  A++AQ   
Sbjct: 407 TGIIINSLFGLLAFLVKSSSVTEVFDWLMAIAGLATCIVWLSINICHVRFRLAMKAQNRT 466

Query: 474 KSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL-------NHQFDYKNFITGYIGLPV 526
                +V+    +G+ +S     LI L+  F + L       +     K F   Y+   +
Sbjct: 467 LDELEFVSAVGIWGSVYSGIVNALI-LVAQFYIALWPIGGWTDSGTRAKKFFQNYLCALI 525

Query: 527 FFFCYFGYKFTYKTKV------IDPLKVDLYTFKAAID-----QEEEDGKMADAEKAERI 575
               + G+K  Y+         I    +DL T +  +D     QE  + KM  A K   +
Sbjct: 526 LIVLFIGHKIYYRVTTGHWWEYIALKDIDLDTDRKNVDIEIIKQEIHEKKMYLASKPWYV 585

Query: 576 KQ 577
           +Q
Sbjct: 586 RQ 587

>Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON}
           (39793..41601) [1809 nt, 603 aa]
          Length = 602

 Score =  215 bits (548), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 152/510 (29%), Positives = 239/510 (46%), Gaps = 23/510 (4%)

Query: 37  INDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXX 96
           +   +  +  S S +D++     + KTE  +L +++K+RH+ M                 
Sbjct: 62  VTSGITNSFESESLRDDSKPLENEEKTE-NQLNRSIKSRHLLMISLGTGIGTGLLVGNGQ 120

Query: 97  XXXXXXPVSTLIAYAFVGLLVFFTMACLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGY 154
                 P   +I Y    ++V+F +   GE+   Y  L G +  Y S   DPALGFA+  
Sbjct: 121 VLAKSGPAGLVIGYGVASIMVYFIVQAAGELGICYSGLTGNYIRYPSILVDPALGFAISI 180

Query: 155 AYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXW 214
            Y  ++  + P QL  AA+ I YW +   +NP ++V I LV++V  N             
Sbjct: 181 IYTLQWLTVMPLQLVTAAMTIGYWTN---INPNIFVAIVLVIVVLTNCFGAKGYVEAEFL 237

Query: 215 LSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVS 274
            + FKV                       +G  YW++PG+F             F    S
Sbjct: 238 CNIFKVLMMVGFVLLAILINTGAIGTDGYIGTIYWKNPGAFAN----------GFKGVCS 287

Query: 275 VFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDP 334
           VF YA ++Y GIE+  + AAE +NP K+IP A K T+YRI+  Y+++  L+G  V YD P
Sbjct: 288 VFCYAAFSYGGIEVLALTAAEQENPIKAIPSACKKTVYRILFLYMLTTILIGFLVPYDSP 347

Query: 335 LLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLA 394
            L+            PFV+AI + G+  +PH+INA +L+ + S  NS  Y S+R L SL+
Sbjct: 348 QLMGSTSGGGSHSS-PFVIAIASHGVKVVPHLINAVILISIVSVANSAFYSSTRLLLSLS 406

Query: 395 IDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWI 454
              K PKIF   ++ G P+Y +  + LF  + ++  S    ++F + + +  +  I  W+
Sbjct: 407 EQGKIPKIFNYVDKEGRPWYCILFASLFGSIGFVASSPYKEEVFTWLLAISGLSQIFLWM 466

Query: 455 SILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL-----N 509
           SI +++I F RA+  QG       Y AP   +G+W +L    L +LI  F V +     +
Sbjct: 467 SICLSHIRFRRAMIKQGKSLDEIGYKAPTGCWGSWIALSI-ALFSLISQFWVAIAPIGKD 525

Query: 510 HQFDYKNFITGYIGLPVFFFCYFGYKFTYK 539
            + D   F   Y+  P+    Y GYK  YK
Sbjct: 526 GKLDVLVFFQNYLAAPIVLIAYLGYKTYYK 555

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  216 bits (550), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 145/518 (27%), Positives = 243/518 (46%), Gaps = 18/518 (3%)

Query: 66  TRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLG 125
           T + K L  RH+                         P S +I +  V   +F  +  LG
Sbjct: 139 TDMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALFTVINSLG 198

Query: 126 EMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKV 184
           E+A   P+  GF+ Y  ++ DP+  FAV   YL ++ +L P +L AA++ I+YW     +
Sbjct: 199 ELAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRYW--NSSI 256

Query: 185 NPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRL 244
           N   WV+IF V I   N             LS  K+                  P H+ +
Sbjct: 257 NSDAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGPSHEYI 316

Query: 245 GFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIP 304
           G +YW  PG+F       T    +F    SVFV A +++ GIE+T + AAE++NPR++IP
Sbjct: 317 GGKYWHDPGAF-----VGTTSGSKFKGLCSVFVTAAFSFSGIEMTAVSAAESRNPRETIP 371

Query: 305 KAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALP 364
           KA K T + I   Y+  + L+G  V Y+DP L+            P V+AI N  I+ LP
Sbjct: 372 KAAKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASS-PLVIAIENGHIHGLP 430

Query: 365 HIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCL 424
            ++NA +L+ + S  NS +Y  SR + S++     PK+FAK +R G P  A+   + F L
Sbjct: 431 SLMNAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVLFFGL 490

Query: 425 LAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQ 484
           L+++  S   A++F +   +  +  I  W+ I + +I F + +  Q +      +++   
Sbjct: 491 LSFVAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDELPFLSQTG 550

Query: 485 PYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCYFGYKFTYKT 540
            +G+ + +    L+ L+ +F   L    + + +  +F  GY+  P+   CY  +K  +K 
Sbjct: 551 IWGSIYGIVILFLV-LVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIAHKVYFKN 609

Query: 541 KV--IDPLKVDLYTFKAAIDQE--EEDGKMADAEKAER 574
               I   K+DL++ +  +D E   E+ ++     A+R
Sbjct: 610 WRWYIPASKMDLHSGRKQVDLEVVREELRLEKEHLAQR 647

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  214 bits (546), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 157/571 (27%), Positives = 263/571 (46%), Gaps = 26/571 (4%)

Query: 21  QLPKKEFKLPIQEEELINDDLERNISS-ASSQDENDSYNIDGKT---EGTRLKKALKARH 76
           +L    F L   EE   +  + R + S   +QD  ++   DG     + + LKKA+K+RH
Sbjct: 25  ELESPSFNLDATEESR-SGLVHRFVDSFKRAQDSTENDLEDGTKPLGDASHLKKAMKSRH 83

Query: 77  VSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIP-LDG 135
           V M                       P S +I Y  V  + +F +   GEMA   P L G
Sbjct: 84  VIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQAAGEMAVAYPTLPG 143

Query: 136 -FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFL 194
            F SY S +     GFA  + +  ++  + P +L  A+L I+YW DK  +N  V++ IF 
Sbjct: 144 NFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYWNDK--INADVFIVIFY 201

Query: 195 VVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGS 254
           V ++ I+              +S KV                       +G +YWR PGS
Sbjct: 202 VFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGYIGAKYWRDPGS 261

Query: 255 FKEYSETITGDT-GRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYR 313
           F E      GD+  +F     + V A ++Y G EL  +   E +NPRKS P+A K ++YR
Sbjct: 262 FAE------GDSVEKFKGICYILVTAYFSYGGAELFSLSVNEQENPRKSTPQAAKQSIYR 315

Query: 314 IVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLV 373
           I+I YL+++ L+G  V +++  L+            P+V+A    G+  +PH INA +L+
Sbjct: 316 ILIIYLLTMILIGFNVPHNNDQLMGSGGSATHAS--PYVLAASIHGVKVVPHFINAVILI 373

Query: 374 FVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSA 433
            V S  NS LY S R + SLA    APK     +R G P  AL +  +F ++ ++  SS 
Sbjct: 374 SVISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVIGFVSASSK 433

Query: 434 SAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLF 493
             ++F +   +  +  + +W  I+++++ F + ++  G  +    + A    +G+ + + 
Sbjct: 434 EEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAVTGIWGSMYGIS 493

Query: 494 FCCLIALIKNFTVF----LNHQFDYKNFITGYIGLPVFFFCYFGYKFTYK--TKVIDPLK 547
           F  L+ + + +       L+ + D ++F   Y+  P++ F YFGY    +  T ++   K
Sbjct: 494 FNMLVFIAQFWVALAPPSLHGKVDAESFFQSYLAAPIWLFFYFGYMLYKRDFTFLVPLDK 553

Query: 548 VDLYTFKAAIDQEEEDGKMADAEKAERIKQN 578
           +DL   +   D E    +  D E  E+IK +
Sbjct: 554 IDLNFHRRIYDPELI--RQEDEENKEKIKNS 582

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  214 bits (546), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 159/532 (29%), Positives = 254/532 (47%), Gaps = 25/532 (4%)

Query: 59  IDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVF 118
           I+  ++   LK+ ++ RHV M                       P S +I YA V  +++
Sbjct: 72  IESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLY 131

Query: 119 FTMACLGEMAT-YIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQ 176
             +    E+A  Y  L  GF +Y S   D A GF+V + Y  ++  + P +L  A++ I+
Sbjct: 132 CVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIK 191

Query: 177 YWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXX 236
           YW   + +NP  +VTIF VV+V+IN            + +  KV                
Sbjct: 192 YW--NQTINPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCG 249

Query: 237 XXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEA 296
              +   LG RYW  PG+F+  S++I     RF   V+V V A +AY G E + + AAE 
Sbjct: 250 GAGNDGYLGARYWHDPGAFRG-SDSIN----RFKGIVAVLVNAAFAYGGAEFSVLTAAEQ 304

Query: 297 QNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAII 356
           QNP+KSI  A K  +YRI+  Y+++  LLG  V ++   L+            PFV+A+ 
Sbjct: 305 QNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHAS--PFVIAVA 362

Query: 357 NSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYAL 416
           + G+  +PH INA +L+ V S  NS LY SSR L SL+    AP+     +R G P   L
Sbjct: 363 SHGVRVVPHFINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCL 422

Query: 417 SVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKST 476
            VS +F LL+++  S     +F + + +  +  + +W SI ++++   RA+  QG     
Sbjct: 423 LVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADE 482

Query: 477 FAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCYF 532
             YVA    +GA++++     I L+  F V +    +++ D  NF   Y+ +P+  F Y 
Sbjct: 483 LGYVAWTGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYL 541

Query: 533 GYK-FTYKTKVIDP-LKVDLYTFKAAIDQE-------EEDGKMADAEKAERI 575
           GYK +T   +++ P  +VDL   +   D E       EE  ++  A    R+
Sbjct: 542 GYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRL 593

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  215 bits (547), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 146/540 (27%), Positives = 241/540 (44%), Gaps = 32/540 (5%)

Query: 11  TSDQYEEYFEQ-LPKKEFKLPIQEEELIN--DDLERNISSASSQDENDSYNIDGKTEGTR 67
           T  Q EE  +Q  P+K  + P    E     D  +R + S    D+N         E   
Sbjct: 37  TEKQNEEPEQQGSPQKTDRKPKLRNEFRKFFDSFKRQLPS----DQNSELE---SQEKNN 89

Query: 68  LKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEM 127
           L+K++K+RH+ M                       P   ++ Y    ++++  +   GE+
Sbjct: 90  LRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQAAGEL 149

Query: 128 A-TYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVN 185
              Y  L G +T Y+S   DP+LGFAV   Y  ++  + P QL  AA+ ++YW +   VN
Sbjct: 150 GLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTN---VN 206

Query: 186 PGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLG 245
             ++V +  + ++ IN              +  K+                   D   +G
Sbjct: 207 ADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIVINCGGAGDRRYIG 266

Query: 246 FRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPK 305
             YW +PG F             F    +VF YA ++Y GIE+  + AAE +NP +SIP 
Sbjct: 267 TEYWHNPGPFAH----------GFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTESIPN 316

Query: 306 AIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPH 365
           A K  +YRI++ Y+++  L+G  V Y+   L+            PFV+A+ + G+  +PH
Sbjct: 317 ACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHAS-PFVIAVSSHGVKVVPH 375

Query: 366 IINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLL 425
            INA +L+ V S  NS LY   R L SLA     PK  A  +R G P     VS+ F  +
Sbjct: 376 FINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFLVSLAFGCI 435

Query: 426 AYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQP 485
            ++  S+A  ++F + + + S+  +  W+S+ +++I F  A+  QG       Y A    
Sbjct: 436 GFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSMDEVGYKAQTGY 495

Query: 486 YGAWFSLFFCCLIALIKNFTVFL-----NHQFDYKNFITGYIGLPVFFFCYFGYKFTYKT 540
           +G+W ++       L+  F V +     + + D K F   Y+ +P+    YFG+K  +K+
Sbjct: 496 WGSWIAVLIAVFF-LVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVLLAYFGHKMYFKS 554

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  214 bits (545), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 156/551 (28%), Positives = 252/551 (45%), Gaps = 28/551 (5%)

Query: 39  DDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXX 98
           D    N S A    E+ S   D   E +R  K L  RH+                     
Sbjct: 43  DAASGNESWALENVESTSGTSDA--EDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSAL 100

Query: 99  XXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYL 157
               P S +I +  +   +F  +  LGE+++  P+  GF  Y SR+ +P+ GFAV   YL
Sbjct: 101 TTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYL 160

Query: 158 FKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSS 217
            ++ +L P +L AA+L I+YW     +N   WV IF  +I   N             LS 
Sbjct: 161 AQWAVLLPLELVAASLTIRYW--NSTINSDAWVAIFYTIIFLANLLDVKSFGETEFVLSM 218

Query: 218 FKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTG--RFVAFVSV 275
            K+                  P+   +G +YW +PG+F        G+T   RF    SV
Sbjct: 219 VKILAIIGFTILGIVLTCGGGPEGGYIGGKYWSNPGAF-------VGNTSSQRFHGLCSV 271

Query: 276 FVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPL 335
           FV A ++Y G EL  + AAE+ NPR ++PKA K T + I + Y++ + L+G  V  DDP 
Sbjct: 272 FVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVPSDDPR 331

Query: 336 LIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAI 395
           L+            P V+AI N GI  LP ++NA +L+ V S  NS +Y  SR + S+A 
Sbjct: 332 LLHGSSSVDVAAS-PLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMAR 390

Query: 396 DNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWIS 455
               PK F+  +R G P YA+  +++F LL+++  S+    +F +   +  +  +  W +
Sbjct: 391 IGNLPKTFSYVDRKGRPLYAILATLIFGLLSFIAASNKQETVFTWLSALSGLSTLFCWFA 450

Query: 456 ILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQF--- 512
           I +++I F   ++ +G       +V+     G W S ++ C+I  +     F    F   
Sbjct: 451 INVSHIRFRYTMKQRGRSLDELPFVS---MTGVWGS-YYGCVIIFVVLVVCFWTALFPST 506

Query: 513 ----DYKNFITGYIGLPVFFFCYFGYKFTYKT-KVIDP-LKVDLYTFKAAIDQEEEDGKM 566
                 ++F   Y+  P+   CY G+K   K+ +++ P  ++D+ + + A+D E    + 
Sbjct: 507 EGVASAESFFETYLSFPILLVCYIGHKLYTKSWRLLTPTTEIDIDSGRRAVDIEVLKDEK 566

Query: 567 ADAEKAERIKQ 577
              E+A R K 
Sbjct: 567 RMEEQAMREKS 577

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  214 bits (545), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 159/588 (27%), Positives = 273/588 (46%), Gaps = 41/588 (6%)

Query: 4   RQIPSNSTSDQYEEYFEQLPK------KEFKLPIQEEELINDDLERNISSASSQDENDSY 57
           + I ++S ++ Y++Y  +           F    +E +L  DD++ N+SS          
Sbjct: 24  QDIETSSENEGYDKYERESKSSSKSWIHNFVDGFREYKL--DDVDPNLSSTERAAI---- 77

Query: 58  NIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLV 117
                T  + LK+ LK RH+ M                       P + ++A+   G +V
Sbjct: 78  ----ATARSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMV 133

Query: 118 FFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQ 176
           +  +  +GE+   +P+ G + SY SR+ DP+ GFA+ Y YL    +  P ++ AA++ + 
Sbjct: 134 YSVVQAIGELCVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVD 193

Query: 177 YWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXX 236
           YW    K   G +V +F V ++ IN              S  KV                
Sbjct: 194 YWNVDHKYADG-FVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCG 252

Query: 237 XXPDHDR-LGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAE 295
              ++   +G +YW +PG F             F  F ++FV + +++ G E+  + AAE
Sbjct: 253 GGSNNTGYIGTKYWHNPGGFAH----------GFKGFAAIFVTSAFSFSGSEMFALGAAE 302

Query: 296 AQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAI 355
           ++NPR+ +PKA K   +RI +FYLIS+ L+G  V Y +  L             PFV+AI
Sbjct: 303 SKNPRRDLPKAAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASAS--PFVIAI 360

Query: 356 INSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYA 415
             +GI+ LP +IN  +LV V S  N+ ++ SSR+  SLA     PK FA  +R G P   
Sbjct: 361 KEAGISGLPSVINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAG 420

Query: 416 LSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKS 475
           L +S++F LL+++  S     +F + + V  +    +W SI + ++ F + +RAQG    
Sbjct: 421 LILSMVFGLLSFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTD 480

Query: 476 TFAYVAPFQPYGAWFSLFFCCLIALIKNFTVF-----LNHQFDYKNFITGYIGLPVFFFC 530
             A+ A     G W S++   LI+++  F  +     L+      +F   Y+ LPV    
Sbjct: 481 ELAFKA---QTGIWGSIYGITLISVVLCFQFWVALFPLSKSPSAYHFFEQYLSLPVVIVF 537

Query: 531 YFGYK-FTYKTKVIDPLK-VDLYTFKAAIDQEEEDGKMADAEKAERIK 576
           Y G+K ++   +++ P K +DL T +  +D E    ++ +  ++ R +
Sbjct: 538 YMGHKVYSRNWRLVIPAKELDLDTGRREVDLELLKQEIKEENESIRSR 585

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  214 bits (545), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 154/532 (28%), Positives = 248/532 (46%), Gaps = 35/532 (6%)

Query: 55  DSYN--IDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAF 112
           DS+   +DG  + + LK+ LK RH+ M                       P+  ++ +  
Sbjct: 63  DSFKPPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTI 122

Query: 113 VGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAA 171
            G  +  T+  LGE+    P+ G F +Y +R+ DP++ F V   Y+ ++F + P ++ AA
Sbjct: 123 AGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAA 182

Query: 172 ALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXX 231
           A+ +QYW     ++P VWV IF V+IVSIN              S+ K            
Sbjct: 183 AMTVQYW--NSSIDPVVWVAIFYVIIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCI 240

Query: 232 XXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGI 291
                  PDH+ +G +YW  PG               F   +SV V A+Y+  GIE+T +
Sbjct: 241 VLIFGGGPDHEYVGAKYWYDPGCLAN----------GFPGILSVLVVASYSLGGIEMTCL 290

Query: 292 VAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPF 351
            + E  +P K +P AIK   +RI+ F+L+S+ L+G  V Y +  L+            PF
Sbjct: 291 ASGET-DP-KGLPSAIKQVFWRILFFFLVSLTLVGFLVPYTNQNLLGGSSVDNS----PF 344

Query: 352 VVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGI 411
           V+AI    I  LP I+N  +L+ V S  NS ++ SSR+L S+A     P  F   +R G 
Sbjct: 345 VIAIKLHHIKVLPSIVNVVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGR 404

Query: 412 PYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQG 471
           P   +  + LF LLA++  S +   +FN+ + +  +   + W+SI +++I F  A++AQG
Sbjct: 405 PLVGIMANSLFGLLAFLVKSGSMGDVFNWLMAIAGLATCIVWLSINVSHIRFRMAMKAQG 464

Query: 472 VDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKN-------FITGYIGL 524
                  +V+    +G+ +S    CLI L+  F   L     +KN       F   Y+  
Sbjct: 465 KKLDELEFVSAVGIWGSAYSALINCLI-LLAQFYCSLWPIGGWKNSSDRAKIFFQNYLCA 523

Query: 525 PVFFFCYFGYKFTYKTKV-----IDPLK-VDLYTFKAAIDQEEEDGKMADAE 570
            +  F +  +K  YK +      I  LK +DL T +  ID E    ++A+ +
Sbjct: 524 LIVLFIFIAHKIYYKCQTGQWWGIKALKDIDLETDRKNIDIEIVKQEIAEKK 575

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  214 bits (545), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 156/544 (28%), Positives = 248/544 (45%), Gaps = 25/544 (4%)

Query: 44  NISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXP 103
           N++  S+  E+ + +I  K+    +KK+LKARHV M                       P
Sbjct: 69  NLNEKSADLEDGTASIQSKS---YMKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGP 125

Query: 104 VSTLIAYAFVGLLVFFTMACLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYF 161
            S +I Y  V  +V+F +   GEMA TY  L G F +Y S +   + GFA  + +  ++ 
Sbjct: 126 ASLIIGYVIVSFIVYFMIQAAGEMAVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWI 185

Query: 162 ILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVX 221
            + P +L  ++L IQYW D   +N  ++V IF V ++ I+              +  K+ 
Sbjct: 186 TVLPLELITSSLTIQYWTD---LNGDIFVVIFYVFLLLIHFIGVKAYGETEFIFNLCKIL 242

Query: 222 XXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATY 281
                             +   +G +YW  PGSF E      G T RF     V V   +
Sbjct: 243 MISGFIIFSIVVNCGGAGNDGYIGGKYWHTPGSFAE-----GGPTSRFKGICYVLVAGYF 297

Query: 282 AYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXX 341
           +Y G EL  +   E   PRK+ P A K ++YRI++ YL+++ L+G  V ++   L+    
Sbjct: 298 SYGGTELYVLSVNEQAEPRKATPAAAKKSIYRILVIYLLTMILIGFNVPHNSDQLMGAGG 357

Query: 342 XXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPK 401
                   P+V+A    G+  +PHIINA +L+ V S  NS LY S R L SLA    APK
Sbjct: 358 SSTHAS--PYVLAASIHGVKVVPHIINAVILISVVSVANSSLYASPRLLASLAEQGYAPK 415

Query: 402 IFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYI 461
                +R G P  AL +  +F  +A++  S    ++F +   +  +  + +W  I+ +++
Sbjct: 416 ALTYIDREGRPLVALLLCAVFGCIAFVASSDKEEQVFTWLAAIAGLSEVFTWTGIMFSHV 475

Query: 462 CFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLN-----HQFDYKN 516
            F  A++ Q  D     Y A    YG+WF   F  L+ LI  F V L+          ++
Sbjct: 476 RFRLAMKVQNKDIDEVGYKATAGIYGSWFGSIFGVLV-LIAQFWVALSPPGSGGAVSAES 534

Query: 517 FITGYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAER 574
           F   Y+ +P++ F Y  Y    K  T + D  K+DL   +   D +    +  DAE  E+
Sbjct: 535 FFENYLAMPIWVFFYIVYSVYNKEWTILTDLSKIDLDAHRRIYDPDLI--RQEDAENKEK 592

Query: 575 IKQN 578
           +K +
Sbjct: 593 LKNS 596

>SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]
           {ON} similar to uniprot|Q03770 Saccharomyces cerevisiae
           YDR160W SSY1 Component of the SPS plasma membrane amino
           acid sensor system (Ssy1p-Ptr3p-Ssy5p) which senses
           external amino acid concentration and transmits
           intracellular signals that result in regulation of
           expression of amino acid permease genes
          Length = 850

 Score =  218 bits (555), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 162/579 (27%), Positives = 266/579 (45%), Gaps = 68/579 (11%)

Query: 61  GKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFT 120
           G  +   +++ L  RH+ M                       P  TL+ +     +V  T
Sbjct: 271 GHNDVYHVQRKLHVRHLQMIAIGASLGVGLFLTSGKAFTVAGPFGTLLGFLLCASIVLAT 330

Query: 121 MACLGEMATYIPLD-GFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYW- 178
           M    E++T IP+  GF+  ASR+ + A GFA+G++Y F + I  PNQ+ A+  ++ Y+ 
Sbjct: 331 MLSFTEISTLIPISSGFSGLASRFVEDAFGFALGWSYWFSFVIALPNQIVASTFMLSYYE 390

Query: 179 -VDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXX 237
            ++    +   +VT+FL+  + IN              + FK+                 
Sbjct: 391 HLNVPSGSTAGFVTLFLLFAIFINLLDVRILGEILYGSTFFKILITVMMMIAMIALNAGA 450

Query: 238 XPD-HDRLGFRYWRHPGSFKEYS------------------ETITGDTGRFVAFVSVFVY 278
               H R+GFRYW    S +  +                  + I G  GRF+A + V + 
Sbjct: 451 GAHRHSRVGFRYWDSSKSPEGLTYGLFRPTFDLGDKGSGSLDGIGGSKGRFLAVLVVMLI 510

Query: 279 ATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPL--- 335
           +++A+ G+EL  + + EA NPRK++P A K T   I+I YL SIFL+G+ +   DP    
Sbjct: 511 SSFAFSGVELAFVASGEAVNPRKTLPSATKRTFIIIIILYLFSIFLVGLNIYSGDPRLLR 570

Query: 336 ---------------------------LIXXXXXXXXXXXXPFVVAIINSGINALPHIIN 368
                                      L+            P+V+A+ + G+     ++N
Sbjct: 571 YYASPGKDVTIDDYGTKWQIETSCNKNLVVNLDGAINGSQSPWVLALQSFGLCTFSSVLN 630

Query: 369 ACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFC----L 424
             ++ F  SA  S LY SSR+LYS++I  KAP++F + ++ GIPY    VSVLFC    +
Sbjct: 631 GILIFFGPSAGCSSLYASSRTLYSMSIQGKAPELFRRCSKKGIPY----VSVLFCGAFGV 686

Query: 425 LAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQ----GVDKSTFAYV 480
            +Y+ VS  S + F    N+ S    + W+ + I+++ F  A++ +      D  +F Y 
Sbjct: 687 TSYLSVSKESVENFQALANISSASICIIWMGLNISFLRFYYALKKRPDIISRDDPSFPYR 746

Query: 481 APFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKT 540
           +PFQPY A++ L    ++ L   FT FL   ++ K F + Y GL  F  CY GYK T+ T
Sbjct: 747 SPFQPYLAFYGLLGSTILVLFMGFTTFLPGLWNTKVFFSAYGGLMFFTVCYLGYK-TFGT 805

Query: 541 KVIDPL-KVDLYTFKAAIDQE--EEDGKMADAEKAERIK 576
             I  L ++D+ + +  ID+   +E  + +D  K   I+
Sbjct: 806 SKIQRLDQLDMDSGRREIDRMIWDEHHEYSDTFKERAIR 844

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  213 bits (542), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 156/553 (28%), Positives = 248/553 (44%), Gaps = 27/553 (4%)

Query: 38  NDDLER-NISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXX 96
            D  +R  + +A   +  D+ N   KT+ T LK  +K RH++M                 
Sbjct: 38  TDSFKRAQVDTAVDLEGKDADNGLNKTQQT-LKHNIKTRHLTMISLGTGIGTGLLVASGK 96

Query: 97  XXXXXXPVSTLIAYAFVGLLVF-FTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGY 154
                 P   +I Y     +++    AC      Y  L G + +Y +   D   GFAV  
Sbjct: 97  ALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVAL 156

Query: 155 AYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXW 214
            Y  ++  + P +L  A++ ++YW     VNP V+V IF V ++ I+             
Sbjct: 157 VYGLQWATVLPLELVTASMTVKYWTSS--VNPDVFVAIFYVFLLFIHFFGSRGYAEAEFI 214

Query: 215 LSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTG--RFVAF 272
            +S KV                   +   +G +YW  PG+F        GD    RF   
Sbjct: 215 FNSLKVLLMAGFIIMAISLTAGAS-EQGYIGGQYWHDPGAFG-------GDRAIDRFKGI 266

Query: 273 VSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYD 332
            SV+V A +AY G E   + AAE  NPR+S+PKA K  +YR+V+ +L+ + L+G  V ++
Sbjct: 267 CSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHN 326

Query: 333 DPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYS 392
              L+            PFV+A    G+  +PHIIN  +L  V S  NS +Y + R L S
Sbjct: 327 SDQLLSAEGGSGSRAS-PFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLS 385

Query: 393 LAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILS 452
           LA     PKIF   +R G P   L    LF L+A++  S+    +F +   +  +  + +
Sbjct: 386 LAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFT 445

Query: 453 WISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL---- 508
           W +I ++++ F RA+R QG       Y A     G+++++FF  +I LI  F + +    
Sbjct: 446 WTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFF-NVIVLIAQFWIAIAPIP 504

Query: 509 -NHQFDYKNFITGYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAIDQEEEDGK 565
            + + D + F   Y+  PV    Y GYK   +    VI   +VDL + +   D  EE   
Sbjct: 505 KHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFD--EEVLL 562

Query: 566 MADAEKAERIKQN 578
             +AE+ ER++ +
Sbjct: 563 QEEAERKERLRNS 575

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  213 bits (543), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 142/519 (27%), Positives = 237/519 (45%), Gaps = 27/519 (5%)

Query: 62  KTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTM 121
           +T    L + LK RH+ M                       P   LI +     ++    
Sbjct: 77  RTAAAPLSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMC 136

Query: 122 ACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVD 180
             LGE+A   P+ G + +YA+R+ D + GFA  + Y+ +  ++ P ++ AA++ + YW D
Sbjct: 137 LSLGELAVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYW-D 195

Query: 181 KEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPD 240
            +      +V +F VVIVSIN              S  KV                  PD
Sbjct: 196 TDPKYKLAFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPD 255

Query: 241 HDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPR 300
           H+ +G +YW  PG F          + +F    SVFV A +++ G EL G+ AAE + PR
Sbjct: 256 HEVIGGKYWNDPGPF-----VGNAPSDKFKGVCSVFVTAAFSFAGSELIGLAAAETREPR 310

Query: 301 KSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGI 360
           KSIPKA K   +RI +FY++S+ ++G+ V  ++  L+            PFV+A+    I
Sbjct: 311 KSIPKAAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHS--PFVIAMDMHRI 368

Query: 361 NALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSV 420
             LP IIN  +L  V S  NS +Y SSR++ +LA     PKIF   +R G P +A+  + 
Sbjct: 369 RVLPSIINVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTS 428

Query: 421 LFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYV 480
           LF LL ++  +    +IF++ + +  +    +W++I + ++ F  A++AQG   +  ++ 
Sbjct: 429 LFGLLCFVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFT 488

Query: 481 APFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKN-------FITGYIGLPVFFFCYFG 533
           +P    G+ +++   C++ + + +        D  +       F   Y+   V    Y  
Sbjct: 489 SPTGFIGSCYAVGLICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMYLA 548

Query: 534 Y-------KFTYKTKVID----PLKVDLYTFKAAIDQEE 561
           +       KF  K K +D      ++DL  FK  + QE 
Sbjct: 549 HKIWSRNWKFFIKAKEMDIDTGRRELDLELFKEELAQER 587

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  213 bits (543), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 139/484 (28%), Positives = 223/484 (46%), Gaps = 23/484 (4%)

Query: 66  TRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLG 125
           T+L K +K RH+ M                       P   +I Y    ++++  +   G
Sbjct: 104 TQLNKTMKPRHIVMISLGTGIGTGLLVGNGQVLSKSGPAGLVIGYGVASIMIYCVVQAAG 163

Query: 126 EMA-TYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEK 183
           E+   Y  L G +T+Y +   DPA+GFAV   Y  ++  + P QL  AA+ I+YW     
Sbjct: 164 ELGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWLTVLPLQLVTAAMTIRYWTTN-- 221

Query: 184 VNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDR 243
           VNP ++V   LV++++IN            + +  K+                   D + 
Sbjct: 222 VNPDIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKLLMMAGFVILGIVINCGGAGDKEY 281

Query: 244 LGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSI 303
           +G +YW+ PG+F             F    +VF YA ++Y GIE+  + A E  NPRK+I
Sbjct: 282 IGVKYWQTPGAFAN----------GFKGVAAVFCYAAFSYGGIEVLVLTANEQANPRKAI 331

Query: 304 PKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINAL 363
           P A +  +YR++  Y+++  ++   V Y+ P L+            PFV+A+ + G+  +
Sbjct: 332 PDACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSNNDGSGSDASPFVIAVASHGVQVV 391

Query: 364 PHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFC 423
           PHIINA +L+ V S  NS LY   R L SL+    APK F   +R G P   + VSV   
Sbjct: 392 PHIINAAILISVISVANSSLYSGPRLLLSLSQQGYAPKCFNYIDRRGRPIICVLVSVAMG 451

Query: 424 LLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQ--GVD-KSTFAYV 480
           L+A++    A  ++F + + V  +  I  W+SI I+++ F  A+R+Q  G+  +    Y 
Sbjct: 452 LIAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISHLRFRDAIRSQLGGLRARDVVEYT 511

Query: 481 APFQPYGAWFSLFFCCLIALIKNFTVFL-----NHQFDYKNFITGYIGLPVFFFCYFGYK 535
           A     G+  +L     I L+  F V +     N Q D + F   Y+  PV    Y  YK
Sbjct: 512 AQTGYVGSLVALAISIFI-LVCQFWVAIAPLGHNGQLDVQIFFENYLAAPVLLGGYLAYK 570

Query: 536 FTYK 539
             ++
Sbjct: 571 IWHR 574

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  213 bits (541), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 161/586 (27%), Positives = 264/586 (45%), Gaps = 30/586 (5%)

Query: 11  TSDQYEEYFEQLPKKEFKLPIQE--EELINDDLERNISS---ASSQDENDSYNIDGKTEG 65
           T     + F       F   ++E  EE  +  + R + S   A SQ   D  +++  T  
Sbjct: 20  TDSALRDNFNTSTAASFSPEVKEHSEESRSGLVHRFVDSFRRAESQRLEDDNDLEDGTRS 79

Query: 66  TR----LKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTM 121
            R    LKK++K+RHV M                       P S +I Y  V  + +F +
Sbjct: 80  MRSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFVTYFMV 139

Query: 122 ACLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWV 179
              GEM  TY  L G F +Y S +   + GFA  + +  ++  + P +L  +++ I+YW 
Sbjct: 140 QAAGEMGVTYPTLPGNFNAYNSIFVSKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWN 199

Query: 180 DKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXP 239
           D   +N  V++ IF V ++ I+              +S K+                   
Sbjct: 200 DT--INADVFIAIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSVIINCGGAG 257

Query: 240 DHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNP 299
               +G  YWR+PGSF + S        RF     + V A +++ GIEL  +   E  NP
Sbjct: 258 VDGYIGGEYWRNPGSFADGSSAT-----RFKGICFILVTAYFSFGGIELFVLSINEQANP 312

Query: 300 RKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSG 359
           RKS P A K ++YRI+I YL+++ L+G  V +D+  L+            P+V+A    G
Sbjct: 313 RKSTPVAAKRSIYRILIIYLLTMILIGFNVPHDNDQLMGSGSSATHAS--PYVLAASIHG 370

Query: 360 INALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVS 419
           +  +PHIINA +L+ V S  NS LY + R + SLA    APK     +R G P  AL V 
Sbjct: 371 VKVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVC 430

Query: 420 VLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAY 479
               L+ ++  SS   + F +   +  +  I +W  I++++I F +A++ QG       Y
Sbjct: 431 SFVGLVGFVACSSQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLDEVGY 490

Query: 480 VAPFQPYGAWFSLFFCCLIALIKNFTVFL-----NHQFDYKNFITGYIGLPVFFFCYFGY 534
            +    +G+++ + F  L+  +  F V L     + + D ++F   Y+  P++ F Y GY
Sbjct: 491 KSNTGIWGSYYGVIFNILV-FMAQFWVALSPPGSDGKCDVESFFQSYLAAPLWIFMYLGY 549

Query: 535 KFTYKT-KVIDPL-KVDLYTFKAAIDQEEEDGKMADAEKAERIKQN 578
               K   +++PL K+DL   +   D E    +  D E  ER++ +
Sbjct: 550 MIYNKDFTLLNPLDKIDLDFHRRVYDPEIM--RQEDEENKERLRNS 593

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  213 bits (541), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 161/583 (27%), Positives = 262/583 (44%), Gaps = 36/583 (6%)

Query: 12  SDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQ---DENDSYNIDGK---TEG 65
           S   + Y EQ PK+   +         D  +R   S +     +EN S   DG    T  
Sbjct: 34  SSNEKIYSEQKPKRNRLI-----HRFTDSFKRAEGSTTKIKPINENTSDLEDGIQSFTSD 88

Query: 66  TRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLG 125
           ++LKK++K+RHV M                       P + +I Y  V  + +F +   G
Sbjct: 89  SKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFITYFMIQAAG 148

Query: 126 EMATYIPL--DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEK 183
           EMA   P     F +Y+S +     GFA  + Y F++  + P +L  A++ IQ+W DK  
Sbjct: 149 EMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELITASMTIQFWNDK-- 206

Query: 184 VNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDR 243
           +NP +++ IF V ++ ++              +  K+                   +   
Sbjct: 207 INPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIVLSVVINCGGAGNDGY 266

Query: 244 LGFRYWRHPGSFKEYSETITGDT--GRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRK 301
           +G  YW  PG+F        GDT   RF     + V A +++ G+EL  +   E  NPRK
Sbjct: 267 IGGAYWHKPGAF-------AGDTSIARFKNVCYILVTAYFSFGGMELFVLSVQEQTNPRK 319

Query: 302 SIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGIN 361
           S P A K ++YRIV+ YL+++ L+G  V Y+D  L+            P+V+A    G+ 
Sbjct: 320 STPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGAGGSATHAS--PYVLAASIHGVR 377

Query: 362 ALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVL 421
            +PHIINA +L+ V S  NS LY   R + SLA    APK     +R G P  AL V  +
Sbjct: 378 IVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCV 437

Query: 422 FCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVA 481
             ++A++  SS    +F +   +  +  + +W SI+++++ F +A++ QG   +   Y A
Sbjct: 438 IGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLNELGYKA 497

Query: 482 PFQPYGAWFSLFFCCLIALIKNFTVFL-----NHQFDYKNFITGYIGLPVFFFCYFGYK- 535
               +G+ +  FF  L+  I  F V L       + + + F   Y+  P++   Y GY  
Sbjct: 498 TTGIWGSIYGSFFNILV-FIAQFWVALAPLGNGGKCNAEAFFESYLAAPIWLIFYIGYMI 556

Query: 536 FTYKTKVIDPL-KVDLYTFKAAIDQEEEDGKMADAEKAERIKQ 577
           +     +++PL K+DL   +   D E    +  D E  E+IK 
Sbjct: 557 YNRDFTLLNPLDKIDLDFHRRVYDPELM--RQEDEENKEKIKN 597

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  212 bits (540), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 149/546 (27%), Positives = 251/546 (45%), Gaps = 28/546 (5%)

Query: 43  RNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXX 102
           + I+  +S  E D   ++  T  ++LKK++K+RHV M                       
Sbjct: 69  KQINENTSDLEGD---VNSFTSDSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGG 125

Query: 103 PVSTLIAYAFVGLLVFFTMACLGEMATYIPL--DGFTSYASRYCDPALGFAVGYAYLFKY 160
           P + +I Y  V  + +F +   GEMA   P     F +Y+S +     GFA  + Y F++
Sbjct: 126 PAALVIGYFLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQW 185

Query: 161 FILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKV 220
             + P +L  AA+ I++W D   +NP +++ IF V ++ I+              +  K+
Sbjct: 186 LTVLPLELITAAMTIKFWNDT--INPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKI 243

Query: 221 XXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDT--GRFVAFVSVFVY 278
                              +   +G +YWR+PG+F        GDT  GRF     + V 
Sbjct: 244 LMIAGFIILSVVINCGGAGNDGYIGGKYWRNPGAF-------AGDTSAGRFKNVCYILVT 296

Query: 279 ATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIX 338
           A +++ G+EL  +   E  NPRK+ P A K ++YRI++ YL+++ L+G  V Y+D  L+ 
Sbjct: 297 AYFSFGGMELFALSVQEQANPRKTTPVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMG 356

Query: 339 XXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNK 398
                      P+V+A    G+  +PHIINA +L+ V S  NS LY   R + SLA    
Sbjct: 357 AGGSATHAS--PYVLAASIHGVKVVPHIINAVILISVISVANSSLYAGPRLMCSLAQQGY 414

Query: 399 APKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILI 458
            PK     +R G P  AL V  +F ++ ++  SS    +F +   +  +  + +W SI++
Sbjct: 415 GPKFLDYVDREGRPLIALIVCSVFGVIGFVAASSKEEVVFAWLAAIAGLSELFTWTSIML 474

Query: 459 TYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL-----NHQFD 513
           +++ F +A++ QG       Y A    +G+ + +FF  L+  I  F V L       +  
Sbjct: 475 SHLRFRQAMKVQGRSLDELGYKATTGIWGSAYGVFFNILV-FIAQFWVALAPLNNGGKCS 533

Query: 514 YKNFITGYIGLPVFFFCYFGYK-FTYKTKVIDPL-KVDLYTFKAAIDQEEEDGKMADAEK 571
            ++F   Y+  P++   Y GY  +      ++PL K+DL   +   D E    +  D E 
Sbjct: 534 AESFFQSYLAFPIWIAFYLGYMIYNRDFTFLNPLDKIDLDFHRHIYDPELM--RQEDLEN 591

Query: 572 AERIKQ 577
            ER + 
Sbjct: 592 EERKRD 597

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  211 bits (538), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 147/524 (28%), Positives = 251/524 (47%), Gaps = 13/524 (2%)

Query: 54  NDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFV 113
            D   I  KT  + L+  LK+RH+ M                       P   LI +   
Sbjct: 74  TDIEKIAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGIT 133

Query: 114 GLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAA 172
           G ++F  +  LGE+A   P+ G F +YA+R+ D + GFA  + Y+F++ +  P ++ AA+
Sbjct: 134 GTMIFTMVMALGELAVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAAS 193

Query: 173 LVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXX 232
           + + YW    +   G +V +F +V+V IN              S  KV            
Sbjct: 194 ITVDYWETPVRYTDG-FVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGII 252

Query: 233 XXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIV 292
                 P    +G RYW  PG+F  +S        RF  F SVFV A +++ G EL GI 
Sbjct: 253 LVCGGGPVGGYVGGRYWHDPGAFAGHSPG-----RRFKGFCSVFVTAAFSFAGSELVGIA 307

Query: 293 AAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFV 352
           +AE++NPRKS+P+A K   +RI++FY++ + L+G+ V Y DP L+            PFV
Sbjct: 308 SAESKNPRKSVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASAS--PFV 365

Query: 353 VAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIP 412
           +AI+  GI+ LP ++N  +L+ V S  NS +Y  SR+L +L+     PK  A  +R G P
Sbjct: 366 IAIVTHGISGLPSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRP 425

Query: 413 YYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGV 472
              +++   F L+A++  S+   ++FN+ + +  I   L+W SI   +I F  A++  G 
Sbjct: 426 LVGIAICSGFGLIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGR 485

Query: 473 DKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVF--LNHQFDYKNFITGYIGLPVFFFC 530
                 + +P    G+++ +    L+ + + +     +    +  +F + Y+  P+    
Sbjct: 486 SDDELPFKSPVGIIGSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYLAAPIVLAF 545

Query: 531 YFGYKFTYKT-KVIDPLK-VDLYTFKAAIDQEEEDGKMADAEKA 572
           Y  +K   +  K++ PLK +D+ T +   D      ++A+ + A
Sbjct: 546 YIAHKLWKRNWKLLIPLKDIDIDTGRRETDINLLKQEIAEEKAA 589

>KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {ON}
           Anc_8.342 YDR160W
          Length = 834

 Score =  215 bits (547), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 146/552 (26%), Positives = 247/552 (44%), Gaps = 60/552 (10%)

Query: 67  RLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGE 126
            +++ L  RH+ M                       P  TL+ +   G ++  T+    E
Sbjct: 258 HIQRRLTVRHIQMLSVGPCLSVGLFLTSGRAFSIAGPFGTLLGFCLSGCVILATLLSFTE 317

Query: 127 MATYIPLD-GFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVN 185
           ++T IP+  GF+  ASR+ + A GFA+G+ Y F   I  P +  ++   + Y+     +N
Sbjct: 318 LSTLIPVSSGFSGLASRFVEDAFGFAIGWTYTFSCIIAFPAEAASSTFFLTYY-SHPLLN 376

Query: 186 PGV---WVTIFLVVIVSINXXXXXXXXXXXXWLSSFK-VXXXXXXXXXXXXXXXXXXPDH 241
             V   +VT+FL   +  N            +  + K +                   DH
Sbjct: 377 KSVISGFVTLFLSFPIVSNLLQVNYLGEVVFFFGAVKLIVSILIILVMIILNAGHGHRDH 436

Query: 242 DRLGFRYWRHPGSFKEYS------------------ETITGDTGRFVAFVSVFVYATYAY 283
            R+GFR+W    SF   +                    I G TGRF++ VSV + +T+AY
Sbjct: 437 HRVGFRFWDSSKSFDNLTYGLFRPTYDLRDEGTGSRNGIGGSTGRFLSVVSVMLISTFAY 496

Query: 284 LGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXX 343
            G+E+T + + EA NPRK+IP +IK T   I++ Y+++I  +G+ +   DP L+      
Sbjct: 497 SGVEMTFLASGEAVNPRKTIPSSIKRTFSSILLIYVLAILTVGINIYSGDPRLLAYLSKP 556

Query: 344 XXXXX--------------------------------XPFVVAIINSGINALPHIINACV 371
                                                 P+V+A+ + G+ A     N  +
Sbjct: 557 TSNRSEAARNGVGTQWQLDVSCNPRSHISGPLENGYSSPWVLALQSFGMCAFASAFNGLL 616

Query: 372 LVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVS 431
           +VF  ++  S LY SSR+LY+++I  KAP IF   NR+G+PY A+ V+  F ++AY+ V+
Sbjct: 617 IVFTATSAISSLYNSSRTLYAMSIQRKAPYIFQLCNRYGVPYVAVLVASSFGVIAYIAVN 676

Query: 432 SASAKIFNYFVNVVSIFGILSWISILITYICF----DRAVRAQGVDKSTFAYVAPFQPYG 487
             S   F+   N+ S    + W  + ++++ F    +R   +   D   + + +PFQPY 
Sbjct: 677 EQSQNNFSILTNMSSASTSIIWFGMNLSFLRFYYALNRRTDSLSRDDEAYPFRSPFQPYL 736

Query: 488 AWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLK 547
           A+F LF C +  L   +  FL H +  + F + Y GL +   CY GYK    +K+    +
Sbjct: 737 AFFGLFGCFIFVLFMGYPNFLTHFWSARGFFSAYGGLLICGVCYLGYKIFCTSKIQRLDQ 796

Query: 548 VDLYTFKAAIDQ 559
           +D+ T +  +D+
Sbjct: 797 LDMDTGRRELDR 808

>Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON}
           YBR069C (REAL)
          Length = 618

 Score =  211 bits (538), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 145/555 (26%), Positives = 242/555 (43%), Gaps = 35/555 (6%)

Query: 7   PSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDEN------DSYNID 60
           P+  T   +E    +  KK+F +   ++E +    +R  +S   + +N      DS+   
Sbjct: 14  PAPCTHGLHERGHAEKEKKDFTVTENQDEGLQQQAKRQGTSGKFKLQNECKKFFDSFKRQ 73

Query: 61  ---------GKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYA 111
                       E   L +++K+RH+ M                       P   ++ Y 
Sbjct: 74  LPADQNSELESQERNNLTRSIKSRHLIMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYG 133

Query: 112 FVGLLVFFTMACLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLT 169
              ++++  +   GE+   Y  L G +T Y+S   DP+LGFAV   Y  ++  + P QL 
Sbjct: 134 IASIMLYCIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLV 193

Query: 170 AAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXX 229
            AA+ I+YW +   VN  ++V    + ++ IN              +  K+         
Sbjct: 194 TAAMTIKYWTN---VNADIFVAAVFIFVIIINLFGSKGYAEAEFMFNICKILMVIGFVIL 250

Query: 230 XXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELT 289
                     D   +G +YW +PG F             F    +VF YA ++Y GIE+ 
Sbjct: 251 AIVINCGGAGDRKFIGTKYWHNPGPFAH----------GFKGVCTVFCYAAFSYGGIEVL 300

Query: 290 GIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXX 349
            + AAE +NP KSIP A K  +YRI+  Y+++  L+   V Y+   L+            
Sbjct: 301 LLSAAEQENPTKSIPNACKKVVYRILFIYMLTTILICFLVPYNSDELLGSGSSSGSHAS- 359

Query: 350 PFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRW 409
           PFV+A+ + G+  +PH INA +L+ V S  NS LY + R L SLA     PK  A  +R 
Sbjct: 360 PFVIAVASHGVKVVPHFINAVILISVISVANSSLYSAPRLLLSLAEQGFLPKCLAYVDRN 419

Query: 410 GIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRA 469
           G P     VS++F  + ++  S A  ++F + + + S+  +  W+S+ +++I F  A+  
Sbjct: 420 GRPLLCFLVSIIFGCIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAK 479

Query: 470 QGVDKSTFAYVAPFQPYGAWF----SLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLP 525
           QG       Y A    +G+W     +LFF      +    V  + + D   F   Y+ +P
Sbjct: 480 QGRSMDEVGYKAQTGYWGSWLAVLIALFFLVCQFWVAIAPVSKHGKLDANVFFQNYLAMP 539

Query: 526 VFFFCYFGYKFTYKT 540
           +  F YFG+K   K+
Sbjct: 540 IVLFAYFGHKIYTKS 554

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  211 bits (537), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 151/542 (27%), Positives = 248/542 (45%), Gaps = 29/542 (5%)

Query: 53  ENDSYNIDGKTE-----GTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTL 107
           E DS +++G         T LKKA+K+RHV M                       P + +
Sbjct: 95  EEDSLDLEGSDHDSIITNTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPAALV 154

Query: 108 IAYAFVGLLVFFTMACLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPP 165
           I Y  V  + +F +   GEMA TY  L G F +Y+S +   A GFA  + +  ++  + P
Sbjct: 155 IGYVLVSFVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLTVLP 214

Query: 166 NQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSF-KVXXXX 224
            +L  A+L I+YW DK  +N  V++ IF V ++ I+            +L +  K+    
Sbjct: 215 LELITASLTIKYWNDK--INADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILMVI 272

Query: 225 XXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTG--RFVAFVSVFVYATYA 282
                          + + +G ++W  PG+F        G T   RF     V V   ++
Sbjct: 273 GFIIMSIVINAGGAGNREYIGGKFWHDPGAF-------AGKTAGSRFKGICYVLVSGYFS 325

Query: 283 YLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXX 342
           Y G EL  +   E  NPR+S P+A K ++YRI+I YL+++ L+G  V YD   L+     
Sbjct: 326 YGGTELFALSVNEQSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGS 385

Query: 343 XXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKI 402
                  P+V+A   +G+   PH INA +L+ V S  NS LY + R + SLA    APK 
Sbjct: 386 ATHAS--PYVLAASLNGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKF 443

Query: 403 FAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYIC 462
               +R G P  AL   +L  ++ ++  S    ++F +   +  +  + +W SI+++++ 
Sbjct: 444 LDYVDRQGRPLLALIACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVR 503

Query: 463 FDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYK----NFI 518
           F  A++ Q        Y A    YG+ + + F  L+   + +T       D K    +F 
Sbjct: 504 FRMAMKLQNRSLEELGYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFF 563

Query: 519 TGYIGLPVFFFCYFGYK-FTYKTKVIDPL-KVDLYTFKAAIDQEEEDGKMADAEKAERIK 576
             Y+ +P++   YFGY  +T   +++ PL K+DL   +   D E    +  D E  ER++
Sbjct: 564 ANYLAMPIWLVFYFGYMLWTRDFQLLKPLDKIDLDFHRRIYDPELM--RQEDEESKERLR 621

Query: 577 QN 578
             
Sbjct: 622 NG 623

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  210 bits (535), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 160/591 (27%), Positives = 266/591 (45%), Gaps = 27/591 (4%)

Query: 1   MTIRQIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNID 60
           + ++ + SN+ S+  E+    LP  +++    +       L  +   A         + +
Sbjct: 11  IGLQDLKSNTGSESIEKV--SLPASDYQYHDGQVLSRFQRLTNSFKRAGEHGRGGDVDAE 68

Query: 61  GKT---EGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLV 117
           G+      T+LK+ + +RH+ M                       P    I YA +G  +
Sbjct: 69  GQPVAPRETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGSCI 128

Query: 118 FFTMACLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVI 175
           +  +   GEMA +Y  L G F +Y S   DPALGF+V + Y  ++  + P +L  A + I
Sbjct: 129 YCIIQAAGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATITI 188

Query: 176 QYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXX 235
           +YW     VNP V+V IF V+ V +N            + ++ KV               
Sbjct: 189 KYWTTA--VNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVNC 246

Query: 236 XXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAE 295
               +   LG +YW  PG+        T     F   ++  V A +A+   E   + AAE
Sbjct: 247 GGAGNDGYLGGKYWHDPGALYG-----TKPIHHFKGIIATMVTAAFAFGATEFIALTAAE 301

Query: 296 AQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAI 355
             NPR++IP A K  +YR+++ +L  I LLG  V Y+   L+            P+V+AI
Sbjct: 302 QANPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHAS--PYVIAI 359

Query: 356 INSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYA 415
            + G+  +PH INA +L+ V S  NS  Y SSR L SL+  + AP      +R G P  A
Sbjct: 360 ASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRA 419

Query: 416 LSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKS 475
           + VS +F L+A++  S     +F + + +  +  + +WI I +++I F +A+  QG    
Sbjct: 420 MLVSCIFGLIAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLG 479

Query: 476 TFAYVAPFQPYGAWF-SLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFC 530
              Y +     G+++ ++   C+  L   F V +      + D  NF   Y+ +P+    
Sbjct: 480 ELGYKSQTGVVGSYYATVIMACV--LTGQFWVAIAPVGTDKLDANNFFENYLAMPILIAL 537

Query: 531 YFGYKFTYKT-KVIDPL-KVDLYTFKAAIDQEEEDGKMADAEKAERIKQNG 579
           YFGY+   +  K+  PL ++DL + +   D  E+  K  DAE  E I+ +G
Sbjct: 538 YFGYRVWKRDWKLYIPLEQIDLVSHRKVFD--EDLLKQEDAEYEESIRNSG 586

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  209 bits (533), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 148/533 (27%), Positives = 252/533 (47%), Gaps = 35/533 (6%)

Query: 55  DSYN--IDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAF 112
           DS+   +DG  +   LK+ LK+RH+ M                       P++ LI +  
Sbjct: 53  DSFKPPVDGSFDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTL 112

Query: 113 VGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAA 171
            G  +  T+  LGE+    P+ G F +Y++R+ DP++ F V   Y+ ++F + P ++ A+
Sbjct: 113 AGTQMVGTIHGLGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIAS 172

Query: 172 ALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXX 231
           A+ +++W     V+P VWV +F  +I+SIN              S  K+           
Sbjct: 173 AITMEFWTTS--VDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCL 230

Query: 232 XXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGI 291
                  P H+ +G RYW  PG+              F    +V V A+Y+  G E+T +
Sbjct: 231 VLILGGGPTHEFIGARYWHDPGALAN----------GFKGVAAVMVTASYSLGGSEMTCL 280

Query: 292 VAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPF 351
            + E  +P K IP AIK   +RI+ F+L+S+ L+G  V Y +  L+            PF
Sbjct: 281 ASGET-DP-KEIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLGGSNVNNS----PF 334

Query: 352 VVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGI 411
           V+AI    I  LPHIIN  +LV + S  NS ++ SSR+L S+A     P+IF   +R G 
Sbjct: 335 VIAIKMHNIRVLPHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGR 394

Query: 412 PYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQG 471
           P   +  + LF LLA++  SS++  +F + + V  +   + W+SI +++I F  A++AQG
Sbjct: 395 PLTGILTNSLFGLLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQG 454

Query: 472 VDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKN-------FITGYIGL 524
                  +V+    +G+ +S     ++ L+  F V L     +K+       F   Y+  
Sbjct: 455 KSLDELEFVSAVGMWGSVYSGVMNVVV-LVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCA 513

Query: 525 PVFFFCYFGYKFTYKT------KVIDPLKVDLYTFKAAIDQEEEDGKMADAEK 571
            +  F +  +K  Y++      K++   ++DL + +  ID E    ++A  +K
Sbjct: 514 LILLFMFVAHKIYYRSTTGQWWKILPLAEIDLESGRKNIDIEVVKHEVAARKK 566

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  209 bits (532), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 162/571 (28%), Positives = 263/571 (46%), Gaps = 48/571 (8%)

Query: 38  NDDLE---RNISSASSQDENDSYN--IDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXX 92
           +DD E   RNI     Q   DS+   +DG  + + LK+ LK RH+ M             
Sbjct: 48  DDDGEHSNRNIF----QRCVDSFKPPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFV 103

Query: 93  XXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFA 151
                     P+  ++ +   G  +  T+  LGE+    P+ G F +Y +R+ DP++ F 
Sbjct: 104 GSGKAIAEGGPLGVVLGWTIAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFV 163

Query: 152 VGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXX 211
           V   Y+ ++F + P ++ AAA+ +QYW     ++P +WV IF  VIV IN          
Sbjct: 164 VSTIYVLQWFFVLPLEIIAAAMTVQYW--NSSIDPVIWVAIFYAVIVCINLFGARGFGEA 221

Query: 212 XXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVA 271
               S+ K                   PDH+ +G +YW  PG               F  
Sbjct: 222 EFAFSTVKAITVCGFIILSIVLICGGGPDHEFIGAKYWHDPGCLAN----------GFPG 271

Query: 272 FVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAY 331
            ++V V A+Y+  GIE+T + + E  +P K +P AIK   +RI+ F+L S+ L+G  V Y
Sbjct: 272 VLAVLVVASYSLGGIEMTCLASGET-DP-KGLPGAIKQVFWRILFFFLASLTLVGFLVPY 329

Query: 332 DDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLY 391
            +  L+            PFV+A+    I  LP I+NA +L+ V S  NS ++ SSR+L 
Sbjct: 330 TNQNLLGGSSVDNS----PFVIAMKLHHIKVLPTIVNAVILISVLSVGNSCIFASSRTLC 385

Query: 392 SLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGIL 451
           S+A     P  F   +R G P   +  + LF LLA++  S + A +FN+ + +  +   +
Sbjct: 386 SMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMADVFNWLMAIAGLATCI 445

Query: 452 SWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL--- 508
            W+SI +++I F  A++AQG       +V+    +G+ +S    CLI LI  F   L   
Sbjct: 446 VWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSAYSALINCLI-LIAQFYCSLWPI 504

Query: 509 ----NHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKV-----IDPLK-VDLYTFKAAID 558
               + +   K F   Y+   +  F +  +K  YK +      +  LK +DL T     D
Sbjct: 505 GGWSSGKERAKLFFQNYLCALIMLFIFVVHKIYYKCQTGKWWGVKSLKDIDLET-----D 559

Query: 559 QEEEDGKMADAEKAERIKQNGKNFEWFYDKF 589
           +++ D ++   E  ER K +  +  W+  +F
Sbjct: 560 RKDIDIEIIKQEIMER-KMHLDSRPWYVRQF 589

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  208 bits (530), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 155/551 (28%), Positives = 258/551 (46%), Gaps = 43/551 (7%)

Query: 55  DSYN--IDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAF 112
           DS+   +DG  + + LK+ LK+RH+ M                       P++ +I +  
Sbjct: 48  DSFKPPVDGSFDTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTI 107

Query: 113 VGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAA 171
            G  +  T+  LGE+    P+ G F  Y++R+ DP++ F V   Y+ ++F + P ++ A+
Sbjct: 108 AGSQIVGTIHGLGEITVRFPVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIAS 167

Query: 172 ALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXX 231
           A+ IQYW     ++P VWV IF  VIVSIN              S+ K            
Sbjct: 168 AITIQYW--NSSIDPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCI 225

Query: 232 XXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGI 291
                  PDH+ +G +YW  PG+              F   +SV V A+Y+  G E+T +
Sbjct: 226 VLICGGGPDHEFIGAKYWHDPGALAH----------GFPGVLSVLVVASYSLGGTEMTCL 275

Query: 292 VAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPF 351
            + E  +P K +P AIK   +RI+ F+L S+ L+G  V Y +  L+            PF
Sbjct: 276 ASGET-DP-KELPSAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSSVDNS----PF 329

Query: 352 VVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGI 411
           V+AI    I ALP I+NA +L+ + S  NS ++ SSR+L S+A     P+ F   +R G 
Sbjct: 330 VIAIKLHHIKALPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGR 389

Query: 412 PYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQG 471
           P   +  + LF LLA++  SS+ +++F++ + +  +   + W+SI +++I F  A++AQ 
Sbjct: 390 PLAGIVTNSLFGLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQN 449

Query: 472 VDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL-------NHQFDYKNFITGYIGL 524
                  +V+    +G+ +S     LI LI  F + L       +     K F   Y+  
Sbjct: 450 KTLDELEFVSAVGIWGSAYSALINVLI-LIAQFYISLWPIGGWTDSSQRAKKFFQSYLCA 508

Query: 525 PVFFFCYFGYKFTYKTKV-----IDPLK-VDLYTFKAAIDQEEEDGKMADAEKAER---I 575
            +    +  +K  Y+        + PLK +DL T +  +D +     +  AE AER   +
Sbjct: 509 LIMLLIFCIHKVYYRVSFGKWWDVKPLKDIDLETGRKNVDID-----VIKAEIAERKMYL 563

Query: 576 KQNGKNFEWFY 586
           K+      W++
Sbjct: 564 KKKPWIVRWYH 574

>Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON}
           YBR132C (REAL)
          Length = 590

 Score =  208 bits (530), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 141/539 (26%), Positives = 247/539 (45%), Gaps = 18/539 (3%)

Query: 31  IQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXX 90
           I EE     ++  +    +S DE+   N+   TE    ++ L+ RHV +           
Sbjct: 48  IHEE----GNMHVHEDGETSTDEDSRTNLLFSTE---TRRKLENRHVQLIAISGVIGTAL 100

Query: 91  XXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALG 149
                       P S L+A+A   + +        EM  + P+   F   A++  D +L 
Sbjct: 101 FVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMVCFFPVSSPFLRLATKCVDESLA 160

Query: 150 FAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXX 209
               + + F   +  P ++ +   +I YW D       + V + L +++SI         
Sbjct: 161 VMASWNFWFLECVQIPFEIVSVNTIIHYWRDDYSAGIPLAVQVVLYLLISI--CAVKYYG 218

Query: 210 XXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEY---SETITGDT 266
               WL+SFK+                  P HDR GFRY+     FK+Y    + +   +
Sbjct: 219 EMEFWLASFKIILALGLFIFTFVTMLGGNPKHDRYGFRYYGE-SPFKQYFPDGKDVGKSS 277

Query: 267 GRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLG 326
           G F  F++  + A++   G E   ++A E + PRK +PKA K    R+   +L S   +G
Sbjct: 278 GYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFLGSCLCVG 337

Query: 327 MCVAYDDP-LLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYV 385
           +  + +DP L              P+V+A+ N  I  LP ++N  ++   FSA N+  Y 
Sbjct: 338 IVCSPNDPDLTAAINEARPGAGSSPYVIAMNNMKIRILPDVVNIALITAAFSAGNAYTYC 397

Query: 386 SSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVV 445
           SSR+ Y +A+D  APKIF K N+ G+P YA+ +S+++ L++ + ++S SA + N+ +N++
Sbjct: 398 SSRTFYGMALDGYAPKIFTKCNKHGVPIYAVGISLIWALVSLLQLNSNSAVVLNWLINLI 457

Query: 446 SIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFT 505
           +   +++++ + I Y+ F R    Q        + +  QPY A   L  C  + +I+ +T
Sbjct: 458 TASQLINFVVLCIIYLFFRRTYSIQQDSLPKLPFRSWGQPYTAIIGLVSCLAMIMIQGYT 517

Query: 506 VFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKT---KVIDPLKVDLYTFKAAIDQEE 561
           VF    ++ ++F+  Y+ + +    Y GYKF +K    KV DP K+D       I+  E
Sbjct: 518 VFFPKLWNSQDFLFSYLMVFIDIGIYVGYKFIWKRGKDKVKDPYKIDFSKELIEIENHE 576

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  208 bits (530), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 155/555 (27%), Positives = 248/555 (44%), Gaps = 22/555 (3%)

Query: 35  ELINDDLERNISSASSQDENDSYNIDGKTEGTRL--KKALKARHVSMXXXXXXXXXXXXX 92
           ++ N  L+  I S    D++  +N   KT       KK +K+RHV M             
Sbjct: 58  QVKNRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLV 117

Query: 93  XXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMA-TYIPLDG-FTSYASRYCDPALGF 150
                     P S +IAY  V  + +F +   GEMA TY  L G F +Y S +     GF
Sbjct: 118 SNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGF 177

Query: 151 AVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXX 210
           A  + +  ++  + P +L  AA+ I+YW     ++P V+V IF V ++ I+         
Sbjct: 178 ATTWLFCIQWLTVLPLELITAAMTIKYW--NTSIDPDVFVIIFYVFLMFIHFFGVQAYGE 235

Query: 211 XXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFV 270
                ++ K+                       +G +YW  PG+F       +    RF 
Sbjct: 236 TEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYIGGKYWHDPGAFAS-----SNGASRFK 290

Query: 271 AFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVA 330
                 V A ++Y G EL  +   + +NPRKS P A K  +YRIV+ YL+++ L+G  V 
Sbjct: 291 GICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVP 350

Query: 331 YDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSL 390
           ++   L+            P+V+A    GI  +PHIINA +L+ + S  NS LY   R L
Sbjct: 351 HNSSELLGASGGNGLHAS-PYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLL 409

Query: 391 YSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGI 450
            SLA    AP+  +  +R G P  AL +S L  ++ +   S    ++F +   +  +  +
Sbjct: 410 SSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSEL 469

Query: 451 LSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLN- 509
            +W SI+ ++I F RA++ Q     T  Y A    +G++F + F  L+     F V L+ 
Sbjct: 470 FTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILV-FAAQFWVALSP 528

Query: 510 ----HQFDYKNFITGYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAIDQEEED 563
                + D  +F   Y+ +P++   YFGY   YK  T + D  +VDL   +   D E   
Sbjct: 529 PNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFL- 587

Query: 564 GKMADAEKAERIKQN 578
            +  D E  ER++ +
Sbjct: 588 -RQEDLENKERLRNS 601

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  207 bits (527), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 155/548 (28%), Positives = 253/548 (46%), Gaps = 23/548 (4%)

Query: 39  DDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXX 98
           D   R  +S S   E+   N    T+ T+L++ ++ RHV M                   
Sbjct: 37  DSFRREDTSRSGDLEDGEIN---STDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASL 93

Query: 99  XXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIP-LDG-FTSYASRYCDPALGFAVGYAY 156
               P   LI Y  V ++ +  M   GEMA   P L G F +Y+S +     GFA  + +
Sbjct: 94  HYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLF 153

Query: 157 LFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLS 216
             ++  + P +L  A +VI+YW  K  VN  V+V IF + I+ I+              +
Sbjct: 154 CLQWLTVFPLELITATIVIKYW--KVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFN 211

Query: 217 SFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVF 276
             KV                   D   +G RYWR+PGSF   +     D  +  A+V V 
Sbjct: 212 MCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPL---DKLKGTAYVLVT 268

Query: 277 VYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLL 336
            Y  +++ G+EL  +   E  NP+ +IP A K  +YRI++ YL+++ ++G  V +D   L
Sbjct: 269 AY--FSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRL 326

Query: 337 IXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAID 396
           +            P+V+AI   G+  LPHI+NA +L+ V S  NS +Y + R L +LA  
Sbjct: 327 MGSGSNDVHPS--PYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQ 384

Query: 397 NKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISI 456
             APK     +R G P  +L +  +F L+A+   S    KIF +   +  +  + +W SI
Sbjct: 385 GYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSI 444

Query: 457 LITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL----NHQF 512
            +++  F +A++ QG    T  Y A    +G+ +++FF  L+  I  F V L      + 
Sbjct: 445 CLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLV-FIAQFWVALVPIAKKKV 503

Query: 513 DYKNFITGYIGLPVFFFCYFGYK-FTYKTKVIDPL-KVDLYTFKAAIDQEEEDGKMADAE 570
           D  +F   Y+  P++   + GY  ++    +++PL K+DL T +   D E    K  + E
Sbjct: 504 DVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVL--KQEEYE 561

Query: 571 KAERIKQN 578
             ER++ +
Sbjct: 562 FKERMRNS 569

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  207 bits (526), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 147/515 (28%), Positives = 237/515 (46%), Gaps = 19/515 (3%)

Query: 63  TEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMA 122
           T    LK+ LK+RH+ M                       P   LI +A  G +++  + 
Sbjct: 71  TANAPLKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVM 130

Query: 123 CLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDK 181
            +GE+A   P+  G+T+YASR+ D + GFA    Y   + I  P ++ AA++ + YW   
Sbjct: 131 AMGELAVTFPVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTP 190

Query: 182 EKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDH 241
            K     +V +F VVIV IN              S  KV                  P  
Sbjct: 191 AKYRD-AFVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQG 249

Query: 242 DRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRK 301
             +G R W +PG+F             F    SVFV A +++ G EL G+ AAE  NPRK
Sbjct: 250 GYIGGRLWHNPGAFAN----------GFKGVCSVFVTAAFSFAGSELVGLAAAETANPRK 299

Query: 302 SIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGIN 361
           SIP A K   +RI +FY++++ ++G+ V Y    LI            PFV++I N+GI 
Sbjct: 300 SIPSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAAS--PFVISIQNAGIK 357

Query: 362 ALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVL 421
            LP +IN  +L+ V S  N  ++  SRS+ +LA     PKIF   +R G P   + V+ +
Sbjct: 358 GLPSVINVVILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCV 417

Query: 422 FCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVA 481
           F LL+++  S    ++F++ + +  +  + +W  IL+ +I   RA+ AQ    +  ++ A
Sbjct: 418 FGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTA 477

Query: 482 PFQPYGAWFSLFFCCLIALIKNFTVF--LNHQFDYKNFITGYIGLPVFFFCYFGYKFTYK 539
           P   +G+ +SL    LI + + +     +  +     F   Y+  P++   Y G+K   K
Sbjct: 478 PTDVWGSVYSLILIILILIAQFWIALFPIGGKPSAAAFFEAYLSFPIYIVFYIGHKIWKK 537

Query: 540 T--KVIDPLKVDLYTFKAAIDQEEEDGKMADAEKA 572
                I    +D+ + +   D E    ++A+ EKA
Sbjct: 538 NWKLFIKASDIDIDSGRRETDIEALKQEIAE-EKA 571

>TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.368
           YOL020W
          Length = 590

 Score =  206 bits (524), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 156/565 (27%), Positives = 266/565 (47%), Gaps = 47/565 (8%)

Query: 21  QLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNI------------DGKTEGTRL 68
           +L K EF   I  +    DD   +  S +   + ++ NI            +G    + L
Sbjct: 17  KLSKNEFVTTIFSDNKNIDDKYEHAESLTDYTKTENRNIFQRVIDSFKPPANGSFHTSNL 76

Query: 69  KKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMA 128
           K++LK+RH+ M                       P++ ++ ++  G  +  T+  LGE+ 
Sbjct: 77  KRSLKSRHLIMIAIGGSIGTGLFIGSGQALANGGPLALVLGWSIAGSQIVGTIHGLGEIT 136

Query: 129 TYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPG 187
              P+ G F +Y +R+ DP+L F +   Y+ ++F + P ++ ++A+ +QYW D   ++P 
Sbjct: 137 VRFPVVGAFANYQTRFLDPSLSFVISTIYVLQWFFVLPLEILSSAITVQYWNDT--IDPV 194

Query: 188 VWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFR 247
           V+V IF   IVSIN              S+ KV                  P H+ +G +
Sbjct: 195 VFVAIFYCAIVSINLFGVRGFGEAEFVFSTIKVITVTGFIILCIILICGGGPTHEFIGAK 254

Query: 248 YWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAI 307
           YW  PG               F  F+SV + A+Y+  G E+T + + E  +P K +P AI
Sbjct: 255 YWHDPGCLAN----------GFRGFLSVLITASYSLGGTEMTCLASGET-DP-KELPSAI 302

Query: 308 KLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHII 367
           K   +RI+ F+L+S+ L+G  V Y +  L+            PFV+AI    I  LP I+
Sbjct: 303 KQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSSVDNS----PFVIAIKLHNIKVLPSIV 358

Query: 368 NACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAY 427
           NA +L+ + S  NS ++ SSR+L S+A     P  F   +R G P   + ++ LF LLA+
Sbjct: 359 NAVILISILSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLTGIVINSLFGLLAF 418

Query: 428 MCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYG 487
           +  SS+ +++F++ + +  +   + W+SI I +I F  A++AQ        +V+    +G
Sbjct: 419 LVKSSSVSEVFDWLMAIAGLATCIVWLSINICHIRFRLAMKAQNKTIDELEFVSAVGVWG 478

Query: 488 AWFSLFFCCLIALIKNFTVF--LNHQFD--------YKNFITGYIGLPVFFFCYFGYKFT 537
           + +S     LI +++ +     +    D        ++N++   + L +FF C+  Y F 
Sbjct: 479 SVYSAIINSLILIVQFYVSLWPIGGWTDSKDRAGKFFQNYLCAIVSL-IFFICHKLY-FR 536

Query: 538 YKTKV---IDPLK-VDLYTFKAAID 558
           YKTK    I PLK +DL T +  ID
Sbjct: 537 YKTKKWWEIIPLKDIDLDTGRKNID 561

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  207 bits (526), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 164/560 (29%), Positives = 259/560 (46%), Gaps = 30/560 (5%)

Query: 35  ELINDDLERNISSASSQD---ENDSYNID---GKTEGTRLKKALKARHVSMXXXXXXXXX 88
           E + ++L   +S A+  D     DS ++D   GKT+   LKK++K RHV M         
Sbjct: 86  EDLENELTTCVSPATLSDYKKSGDSGSVDELEGKTKEEHLKKSIKPRHVVMISLGTGIGT 145

Query: 89  XXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMA-TYIPL-DGFTSYASRYCDP 146
                         P    I YA +G  ++  +   GEMA TY  L  GF +Y S    P
Sbjct: 146 GLLVGNAKALNDAGPAGLAIGYAIMGSCIYCIIQAAGEMAVTYSNLVGGFNAYPSFLVSP 205

Query: 147 ALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXX 206
            LGFAV + Y  ++  + P +L  A++ I+YW    KVNP V+V IF  +I+ IN     
Sbjct: 206 KLGFAVAWVYWLQWACVCPLELVTASMTIKYWT--TKVNPDVFVVIFYFLIIVINVFGAR 263

Query: 207 XXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDT 266
                  + +  KV                   +   +G +YW  PG+F+       GD 
Sbjct: 264 GYAEAEFFFNCCKVLMITGFFILGIIINCGGAGNDGYIGGKYWHDPGAFR-------GDK 316

Query: 267 G--RFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFL 324
              RF    +  V A +A+ G E   + A+E  NPRK+IP A K  +YRI+I +L SI +
Sbjct: 317 AIDRFKGVAATLVTAAFAFGGSEFIALTASEQSNPRKAIPAAAKKILYRIIIIFLGSIIM 376

Query: 325 LGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLY 384
           +G  V ++   L+            P+V+AI + G+  +PH +NA +L+ V S  NS  Y
Sbjct: 377 VGFLVPWNSDQLMGSDSSKTKAS--PYVIAISSHGVRVVPHFVNAVILLSVLSVGNSAFY 434

Query: 385 VSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNV 444
            SSR L SL+    APK F   +R G P  A+ +  LF ++A+   SS    +F + + +
Sbjct: 435 SSSRILISLSQQGYAPKFFNYIDREGRPARAMVIGALFAVIAFCAASSKEEDVFTWLLAI 494

Query: 445 VSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNF 504
             +  I +W +I +++I F RA+  QG       + +    +G++++     L+ LI  F
Sbjct: 495 SGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEIGFKSELGVWGSYYAAGMMFLV-LIAQF 553

Query: 505 TVFLN----HQFDYKNFITGYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAID 558
            V L     ++ D ++F   Y+ + +    Y GY F  K  T  I    +DL   +   D
Sbjct: 554 WVGLAPIGMNKLDAQSFFESYLAMLMLIAFYVGYMFWKKDWTLFIRAKDIDLDHHRQIFD 613

Query: 559 QEEEDGKMADAEKAERIKQN 578
             E+  +  D E  E+++  
Sbjct: 614 --EDVLRQEDEETKEKLRNG 631

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  206 bits (523), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 158/564 (28%), Positives = 259/564 (45%), Gaps = 30/564 (5%)

Query: 32  QEEELINDDLERNISS---ASSQDENDSYNIDGKTEGTR----LKKALKARHVSMXXXXX 84
             EE  N  + R + S   A SQ   +  +++  T+  +    LKK++K+RHV M     
Sbjct: 43  HSEESRNGLVHRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGT 102

Query: 85  XXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMA-TYIPLDG-FTSYASR 142
                             P S +I Y  V  + +F +   GEM  TY  L G F +Y S 
Sbjct: 103 GIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSI 162

Query: 143 YCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINX 202
           +   + GFA  + +  ++  + P +L  +++ ++YW D   +N  V++ IF V ++ I+ 
Sbjct: 163 FISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDT--INADVFIVIFYVFLLFIHF 220

Query: 203 XXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETI 262
                        +S K+                       +G +YWR PGSF E S   
Sbjct: 221 FGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGS--- 277

Query: 263 TGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISI 322
            G T RF     + V A +++ GIEL  +   E  NPRKS P A K ++YRI+I YL+++
Sbjct: 278 -GAT-RFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTM 335

Query: 323 FLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSD 382
            L+G  V +++  L+            P+V+A     +  +PHIINA +L+ V S  NS 
Sbjct: 336 ILIGFNVPHNNDQLMGSGGSATHAS--PYVLAASIHKVRVIPHIINAVILISVISVANSA 393

Query: 383 LYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFV 442
           LY + R + SLA    APK     +R G P  AL V  L  ++ ++  S    + F +  
Sbjct: 394 LYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSLVGVVGFVACSPQEEQAFTWLA 453

Query: 443 NVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIK 502
            +  +  + +W  I++++I F +A++ QG       Y A    +G+++ +FF  L+  + 
Sbjct: 454 AIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLV-FMA 512

Query: 503 NFTVFLN-----HQFDYKNFITGYIGLPVFFFCYFGYKFTYKTK--VIDPL-KVDLYTFK 554
            F V L+      + D + F   Y+  P++ F Y GY   YK     ++PL K+DL   +
Sbjct: 513 QFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGY-MVYKRDFTFLNPLDKIDLDFHR 571

Query: 555 AAIDQEEEDGKMADAEKAERIKQN 578
              D E    +  D E  ER+K +
Sbjct: 572 RVYDPEIM--RQEDEENKERLKNS 593

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  206 bits (523), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 167/587 (28%), Positives = 257/587 (43%), Gaps = 39/587 (6%)

Query: 2   TIRQIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDG 61
           +I + P+   S+    + +   + E  +P        DD    +++A  + E  S     
Sbjct: 59  SINESPAKKKSN-LRRFVDSFKRAEHMIPA-------DDKINEMTTAEPEAEMASVE--- 107

Query: 62  KTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTM 121
                 LK+ +K RHV M                       P   +  YA +G  V+  +
Sbjct: 108 ----DNLKQTIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGLVTGYAIMGTCVYCII 163

Query: 122 ACLGEMAT-YIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWV 179
              GEMA  Y  L+G F +Y +   +P          LF         +       +YW 
Sbjct: 164 QSAGEMAVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVLFTMVDCLSFGIGYCFDDYKYWT 223

Query: 180 DKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXP 239
              +V+P V+V IF V+I+ IN            + +  KV                   
Sbjct: 224 --TRVDPDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMAGFFILGIIINVGGAG 281

Query: 240 DHDRLGFRYWRHPGSFKEYSETITGDTG--RFVAFVSVFVYATYAYLGIELTGIVAAEAQ 297
           +   LG  YWR+PG+F+       GD G   F   V+  V A +A+ G E   + AAE  
Sbjct: 282 NDGYLGNIYWRNPGAFR-------GDKGIDHFKGVVATLVTAAFAFGGTEFIALTAAEQS 334

Query: 298 NPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIIN 357
           NPRK+IP A K  +YRIV+ YL SI L+G  V +  P L+            P+V+A+ +
Sbjct: 335 NPRKAIPSAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGSGSAATAAS--PYVIAVAS 392

Query: 358 SGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALS 417
            G+  +PH INA +L+ V S  NS  Y SSR L SL+    APK F   +R G P  A+ 
Sbjct: 393 HGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYVDREGRPSRAMI 452

Query: 418 VSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTF 477
           VS LF ++A+   S    ++F + + +  +  I +WISI +++I F  A++AQG      
Sbjct: 453 VSALFGVIAFCATSPKETEVFTWLLAISGLSQIFTWISICLSHIRFRAAMKAQGRSMGEV 512

Query: 478 AYVAPFQPYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFCYFG 533
            + A    +G+++S+F   ++ LI  F V +      +   +NF   Y+ +P+    YFG
Sbjct: 513 GFKAQTGIWGSYYSIFL-MILTLIGQFWVAIAPIGTAELSARNFFENYLAMPILIGFYFG 571

Query: 534 YKFTYK--TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQN 578
           YK   K  T  I    +DL + +   D  EE  K  D E  E++K  
Sbjct: 572 YKIWKKDWTLYIKAEDIDLISHRQIFD--EELLKQEDYELKEKLKNG 616

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  205 bits (522), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 152/563 (26%), Positives = 257/563 (45%), Gaps = 28/563 (4%)

Query: 32  QEEELINDDLERNISS---ASSQDENDSYNIDGKTE----GTRLKKALKARHVSMXXXXX 84
             EE  N  + R + S   A SQ   ++ +++  T        LKK++K+RHV M     
Sbjct: 43  HSEESRNGLVHRFVDSFRRAESQCLEENNDLEDGTRPMKSNNHLKKSMKSRHVVMMSLGT 102

Query: 85  XXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMA-TYIPLDG-FTSYASR 142
                             P S +I Y  V  + +F +   GEM   Y  L G F +Y S 
Sbjct: 103 GIGTGLLVANAKGLKLAGPGSLVIGYVLVSFITYFMVQAAGEMGVAYATLPGNFNAYNSI 162

Query: 143 YCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINX 202
           +   + GFA  + +  ++  + P +L  +++ I+YW D   +N  V++ IF V ++ I+ 
Sbjct: 163 FISKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDS--INADVFIVIFYVFLLFIHF 220

Query: 203 XXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETI 262
                        +S K+                       +G +YWR PGSF + S   
Sbjct: 221 FGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFADGS--- 277

Query: 263 TGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISI 322
             +  RF     + V A +++ GIEL  +   E  N RKS P A K ++YRI+I YL+++
Sbjct: 278 --NATRFKGICFILVTAYFSFGGIELFVLSINEQSNARKSTPLAAKRSVYRILIIYLLTM 335

Query: 323 FLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSD 382
            L+G  V +++  L+            P+V+A     +  +PHIINA +L+ V S  NS 
Sbjct: 336 ILIGFNVPHNNDQLMGSGSAATHAS--PYVLAASIHKVRVIPHIINAVILISVISVANSA 393

Query: 383 LYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFV 442
           LY + R + SLA    AP+     +R G P  AL+V  L  ++ ++  S    + F +  
Sbjct: 394 LYAAPRLMCSLAQQGYAPRFLNYIDREGRPLRALAVCALVGVVGFVACSPQEEQAFTWLA 453

Query: 443 NVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIK 502
            +  +  I +W  I++++I F +A++ QG       Y A    +G+++ +FF  L+  + 
Sbjct: 454 AIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLGELGYKANTGIWGSYYGVFFNILV-FMA 512

Query: 503 NFTVFLN-----HQFDYKNFITGYIGLPVFFFCYFGYKFTYKT-KVIDPL-KVDLYTFKA 555
            F V L+      + D + F  GY+  P++ F Y GY    K   +++PL K+DL   + 
Sbjct: 513 QFWVALSPIGNGGKCDVQAFFEGYLAAPLWIFMYLGYMLYNKDFTLLNPLDKIDLDFHRR 572

Query: 556 AIDQEEEDGKMADAEKAERIKQN 578
             D E    +  D E  E+++ +
Sbjct: 573 VYDPEIM--RQEDEENKEKLRNS 593

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  205 bits (521), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 157/563 (27%), Positives = 257/563 (45%), Gaps = 28/563 (4%)

Query: 32  QEEELINDDLERNISS---ASSQDENDSYNIDGKTE----GTRLKKALKARHVSMXXXXX 84
             EE  N  + R + S   A SQ   D  +++  T       RLKK++K+RHV M     
Sbjct: 43  HSEESRNGLVHRFVDSFKRAESQHLEDDNDLEDGTRSMKSNNRLKKSMKSRHVVMMSLGT 102

Query: 85  XXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMA-TYIPLDG-FTSYASR 142
                             P S +I Y  V  + +F +   GEM  TY  L G F +Y S 
Sbjct: 103 GIGTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSI 162

Query: 143 YCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINX 202
           +   + GFA  + +  ++  + P +L  +++ I+YW DK  +N  V++ IF V ++ I+ 
Sbjct: 163 FISKSFGFATTWIFCIQWLTVLPLELITSSMTIKYWNDK--INSDVFIVIFYVFLLFIHF 220

Query: 203 XXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETI 262
                        SS K+                       +G +YWR PGSF E +   
Sbjct: 221 FGVKAYGETEFIFSSCKILMIAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGN--- 277

Query: 263 TGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISI 322
            G T RF     + V A +++ GIEL  +   E  NPRKS P A K ++YRI+I YL+++
Sbjct: 278 -GAT-RFKGICFILVTAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTM 335

Query: 323 FLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSD 382
            L+G  V +++  L+            P+V+A     +  +PHIINA +L+ V S  NS 
Sbjct: 336 ILIGFNVPHNNDQLMGSGSAATHAS--PYVLAASIHKVRVVPHIINAVILISVISVANSA 393

Query: 383 LYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFV 442
           LY + R + SLA    APK     +R G P  AL V  L  ++ ++  S    + F +  
Sbjct: 394 LYAAPRLMCSLAQQGYAPKFLDYIDREGRPLRALFVCCLVGVIGFVACSPQEEQAFTWLA 453

Query: 443 NVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIK 502
            +  +  + +W  I++++I F +A++ QG       Y A    +G+++ +FF  L+  + 
Sbjct: 454 AIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNILV-FMA 512

Query: 503 NFTVFLN-----HQFDYKNFITGYIGLPVFFFCYFGYKFTYKT-KVIDPL-KVDLYTFKA 555
            F V L+      + + + F   Y+  P++   Y GY    +    ++PL K+DL   + 
Sbjct: 513 QFWVALSPIGNGGKCNAQAFFESYLAAPLWLCMYLGYMLYERDFTFLNPLDKIDLDYHRR 572

Query: 556 AIDQEEEDGKMADAEKAERIKQN 578
             D E    +  + E  ER+K +
Sbjct: 573 VYDPEII--RQENEENKERLKNS 593

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  205 bits (521), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 145/554 (26%), Positives = 245/554 (44%), Gaps = 30/554 (5%)

Query: 11  TSDQYEEYFEQL-PKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLK 69
           T  Q EE  +Q+ P+K        +  + ++ ++ +SS   Q      +     E   L 
Sbjct: 37  TEKQDEESEQQVKPQKT-----GNKSKLQNECKKILSSFKRQLPPSQNSELESQEKNNLT 91

Query: 70  KALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMA- 128
           K++K+RH+ M                       P   ++ Y    ++++  +   GE+  
Sbjct: 92  KSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGVASIMLYCIIQAAGELGL 151

Query: 129 TYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPG 187
            Y  L G +T Y S   DP+LGFAV   Y  ++  + P QL  AA+ ++YW     VN  
Sbjct: 152 CYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTS---VNSD 208

Query: 188 VWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFR 247
           ++V +  + ++ IN              +  K+                   D   +G  
Sbjct: 209 IFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVIGFVILAIIINCGGAGDRKYIGTE 268

Query: 248 YWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAI 307
           YW +PG F             F    +VF YA ++Y GIE+  + AAE +NP KSIP A 
Sbjct: 269 YWHNPGPFAH----------GFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPNAC 318

Query: 308 KLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHII 367
           K  +YRI++ Y+++  L+   V Y+   L+            PFV+A+ + G+  +PH I
Sbjct: 319 KKVVYRILLIYMLTTILVCFLVPYNSDELLGSDDSSGSHAS-PFVIAVASHGVKVVPHFI 377

Query: 368 NACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAY 427
           NA +L+ V S  NS LY   R L SLA     PK  A  +R G P     VS+ F  + +
Sbjct: 378 NAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRRGRPLLCFLVSLAFGCIGF 437

Query: 428 MCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYG 487
           +  S A  ++F + + + S+  +  W+S+ +++I F  A+  QG   +   Y A    +G
Sbjct: 438 VATSDAEEEVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQTGYWG 497

Query: 488 AWFSLFFCCLIALIKNFTVFL-----NHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKV 542
           +W ++       L+  F V +     + + + K F   Y+ +P+    YFG+K  +K+  
Sbjct: 498 SWLAVLIAVFF-LVCQFWVAIAPVNDHGKLNVKVFFQNYLAMPIVLVAYFGHKIYFKSWS 556

Query: 543 --IDPLKVDLYTFK 554
             I   K+DL + +
Sbjct: 557 FWIPADKIDLNSHR 570

>Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON}
           YBR132C (REAL)
          Length = 597

 Score =  204 bits (520), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 137/537 (25%), Positives = 242/537 (45%), Gaps = 16/537 (2%)

Query: 44  NISSASSQDENDSYNIDGKTE---GTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXX 100
           ++     +D   S + D +T     T  ++ L+ RHV +                     
Sbjct: 58  DVHVHEHEDRGSSIDEDSRTHLLFSTETRRKLENRHVQLIAISGVIGTALFVAIGKALYR 117

Query: 101 XXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFK 159
             P S L+A+A   + +        EM  + P+   F   A++  D +L     + + F 
Sbjct: 118 GGPASLLLAFALWCVPILCITVSTAEMVCFFPVSSPFLRLATKCVDDSLAVMASWNFWFL 177

Query: 160 YFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFK 219
             +  P ++ +   +I YW D       + V + L +++SI             WL+SFK
Sbjct: 178 ECVQIPFEIVSVNTIIHYWRDDYSAGIPLAVQVVLYLLISI--CAVKYYGEMEFWLASFK 235

Query: 220 VXXXXXXXXXXXXXXXXXXPDHDRLGFR-YWRHPGSFKEY---SETITGDTGRFVAFVSV 275
           +                  P HDR GFR Y   P  FK+Y      +   +G F  F++ 
Sbjct: 236 IILALGLFIFTFITMLGGNPRHDRYGFRNYGESP--FKKYFPDGNDVGKSSGYFQGFLAC 293

Query: 276 FVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDP- 334
            + A++   G E   ++A E + PRK +PKA K    R+   +L S   +G+  + +DP 
Sbjct: 294 LIQASFTIAGGEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPD 353

Query: 335 LLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLA 394
           L              P+V+A+ N  I  LP I+N  ++   FSA N+  Y SSR+ Y +A
Sbjct: 354 LTAAINEARPGAGSSPYVIAMNNLKIRILPDIVNIALITAAFSAGNAYTYCSSRTFYGMA 413

Query: 395 IDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWI 454
           +D  APK+F + NR G+P Y++ +S+++ L++ + ++S SA + N+ +N+++   +++++
Sbjct: 414 LDGYAPKLFTRCNRHGVPIYSVGISLIWALVSLLQLNSNSAVVLNWLINLITASQLINFV 473

Query: 455 SILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDY 514
            + I Y+ F RA R Q        + +  QPY A   L  C  + LI+ +TVF    +  
Sbjct: 474 VLCIIYLFFRRAYRVQQDSLPRLPFRSWGQPYTAIIGLVSCSAMILIQGYTVFFPKLWST 533

Query: 515 KNFITGYIGLPVFFFCYFGYKFTYKT---KVIDPLKVDLYTFKAAIDQEEEDGKMAD 568
           ++F+  Y+ + +    Y GYKF +K     + +P  +D       I+  E +    D
Sbjct: 534 QDFLFSYLMVFINIGIYVGYKFIWKRGKDSLKNPHDIDFSKELTEIENHEIECSFGD 590

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  206 bits (524), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 157/570 (27%), Positives = 256/570 (44%), Gaps = 29/570 (5%)

Query: 32  QEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXX 91
            E +L N  L     +      +    I+  ++   LKK +K RHV M            
Sbjct: 122 SESDLENMILYNEDGTPKPLPHHHDAQINDNSKSDELKKTIKPRHVLMISLGTGIGTGLL 181

Query: 92  XXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIP--LDGFTSYASRYCDPALG 149
                      P   +I +  +G  ++  +  +GE+A      + GF +Y S   D A  
Sbjct: 182 VGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQAVGELAVAYSDLVGGFNAYPSFLVDEAFC 241

Query: 150 FAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXX 209
           FAV + Y  ++  + P +L  A++ I+YW    KV+P ++V IF ++I+ IN        
Sbjct: 242 FAVAWLYAIQWLCVCPLELVTASMTIKYWT--TKVDPDIFVIIFYILIIGINLLGGAAGY 299

Query: 210 XXXXWL-SSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTG- 267
               ++ +S K+                       +G +YW  PG+ +       GDT  
Sbjct: 300 AEAEFIFNSCKIMMMIGFFILGITVICGGAGTDGYIGAKYWHDPGALR-------GDTSI 352

Query: 268 -RFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLG 326
            RF   ++  V A +A+   E  G+ A+E  NPRK+IP A K  +YRI+  +L SI ++G
Sbjct: 353 QRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMIYRILCMFLSSITIVG 412

Query: 327 MCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVS 386
             V Y+   L+            P+V+AI   G+  +PH INA +L+ V S  NS  Y S
Sbjct: 413 FLVPYNSDQLLGSTGSGVKAS--PYVLAISTHGVRVVPHFINAVILISVLSVANSAYYSS 470

Query: 387 SRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVS 446
           SR L SLA    APKI++  +R G P   ++ + +F ++A+   S    ++F + + +  
Sbjct: 471 SRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGVIAFCATSPKEDEVFVWLLAISG 530

Query: 447 IFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTV 506
           +  + +W++I I++I F RA+  QG       + +    YG+ ++     +I LI  F V
Sbjct: 531 LSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVGWYGSAYAAIMMFMI-LIAQFWV 589

Query: 507 F-------LNHQFDYKNFITGYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAI 557
                   L  + D KNF   Y+ +P+    YFGYK   K     I    +DL + +   
Sbjct: 590 ALVPINADLTIKLDAKNFFENYLAMPILLAFYFGYKIWKKDWKLFIRAKNIDLISHRNIF 649

Query: 558 DQEEEDGKMADAEKAERIKQNGKNFEWFYD 587
           D  EE  K  + E  ER++  G  +   YD
Sbjct: 650 D--EELIKQEEDEYRERLR-TGPKWRRVYD 676

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  203 bits (517), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 151/554 (27%), Positives = 250/554 (45%), Gaps = 28/554 (5%)

Query: 24  KKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXX 83
           K   KL  +++       E +   + ++D      + GK E   L+++++ RHV M    
Sbjct: 2   KTRLKLLCKKDA---SGAEADSVESVAEDVEAGAGVQGKKE--VLRQSIRPRHVFMISMA 56

Query: 84  XXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL--DGFTSYAS 141
                                 TLI Y  +G+++   M  +GE+    P    GF SY  
Sbjct: 57  TGIGTGLLVGNGKSIACAGIGGTLIGYGIIGVMLVCCMQSVGELVVAFPSLSGGFNSYGK 116

Query: 142 RYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSIN 201
           R+ DP+LGF+V + +  ++ I+ P +L   ++ I+YW     ++P ++V++F  +I  +N
Sbjct: 117 RFIDPSLGFSVSWLFCLQWMIVLPLELVTGSMTIKYW--NASLSPSLFVSVFYALICVVN 174

Query: 202 XXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSET 261
                         +S KV                       +GFRY   PG F +    
Sbjct: 175 SFGSGGYAEAEFIFNSLKVVVIIGFIILGVLIDTGCVGTSGTIGFRYLIDPGMFNKNYNI 234

Query: 262 ITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQ--NPRKSIPKAIKLTMYRIVIFYL 319
           I    G         V A ++  G+E   + AAE    N  KSI +A      RI +FYL
Sbjct: 235 IKATAG-------TLVNAAFSCGGVEFLALSAAEQNRDNMPKSIGRACNQVSIRIFVFYL 287

Query: 320 ISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSAC 379
           +SI ++G+ V ++ P+L+            P+V A+  +GI  +PHIINA +L+ V S  
Sbjct: 288 LSISVVGLLVPHNSPILMGSGSNMIHSS--PYVAAVAMNGITVVPHIINAVILIAVISVA 345

Query: 380 NSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFN 439
           NS +Y SSR+L+SLA  N APK F K N+ G P   L +S LF L++++        IF 
Sbjct: 346 NSAMYSSSRTLHSLAEQNFAPKYFTKLNKHGQPMRCLFISALFGLISFVAEYRDQEAIFI 405

Query: 440 YFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIA 499
           + +++  +  I +W +I I +I F  A++++G    T  Y +     G++ +     L+ 
Sbjct: 406 WLLSISGLSTIFTWTTICIAHIRFRDAIKSRGQSLETLGYKSITGVAGSYIATVI-NLVI 464

Query: 500 LIKNFTVFL-----NHQFDYKNFITGYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYT 552
           L+  F V L     N + +   F   Y+ +PV    Y G+K   K  + +I    VD+ T
Sbjct: 465 LVVQFWVSLFPLESNGKPNIVQFFQNYMAVPVALLFYIGHKVYTKNWSLLIRASNVDITT 524

Query: 553 FKAAIDQEEEDGKM 566
            +       ED K+
Sbjct: 525 DRDIYCPTIEDPKI 538

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  202 bits (514), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 153/563 (27%), Positives = 251/563 (44%), Gaps = 31/563 (5%)

Query: 25  KEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTE---GTRLKKALKARHVSMXX 81
           K +++   ++E  +DDL     S  S++E D++NI    +    T +K+ALK RH+S+  
Sbjct: 3   KTYEVACFKDESRSDDL-----SKFSKEEPDTHNIKSFEQFDPNTGVKRALKNRHISLLA 57

Query: 82  XXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYA 140
                                P+S L+ +  +G++ F  M  +GEM T  P   GF++ +
Sbjct: 58  LGGIIGPGCLVGAGNALSKGGPLSLLLGFGIIGIVAFAVMESIGEMITLYPSGSGFSTLS 117

Query: 141 SRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSI 200
            R+   AL    GYAY+  +F +  N+    + ++Q+W    +V    ++ IF V     
Sbjct: 118 RRFHSDALSAVSGYAYVVVFFAVLANEYNTLSSILQFW--GPQVPLYGYILIFSVAFQVF 175

Query: 201 NXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSE 260
                        WL+ FK+                   +    GF YW +PG+  +   
Sbjct: 176 QMLGVGIFGEFEYWLAWFKIIGLIAYYIFSIIYISGGIKNRPAFGFHYWNNPGALAD--- 232

Query: 261 TITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLI 320
                   F     VFV+ +  Y G E   + A E++NP K++P AIK T +RI+I YL 
Sbjct: 233 -------GFKGIAVVFVFCSSFYSGTESVALAATESRNPGKAVPIAIKQTFWRIIIVYLG 285

Query: 321 SIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACN 380
                G  V Y+D  L             P  +AI  +G     H++NA +L+   SA N
Sbjct: 286 IAVFYGATVPYNDTSL----GAHTKALKSPIAIAITRAGWEGGVHLVNAFILITCVSAIN 341

Query: 381 SDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNY 440
             LY+ SR+L  LA +  APK    T++ G+P  A+++     L++ M VS  ++  ++Y
Sbjct: 342 GSLYIGSRTLIYLAHEGLAPKFLKWTDKRGVPIPAITLFNALGLVSLMNVSVGASNAYSY 401

Query: 441 FVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIAL 500
            VN+  +   + W  I +T++ F +A   QG   S   Y +   P+G  FSL     + L
Sbjct: 402 IVNLSGVGVFIVWGIISLTHLRFRKAWDLQGRSASELPYKSLLFPWGPIFSLAANIFLGL 461

Query: 501 IKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKT--KVIDPLKVDLYTFKAAID 558
           I+ +T F+   F  K+F+  YI LP     Y           K++D   VDL   +   +
Sbjct: 462 IQGWTTFV--PFSAKDFVDAYILLPAAVILYIVISLVKIGGFKLVDLRTVDLEEGRR--E 517

Query: 559 QEEEDGKMADAEKAERIKQNGKN 581
             + DG   D+E  +R  ++ K 
Sbjct: 518 DLDSDGTDEDSEGKDRSVRSAKR 540

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  201 bits (512), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 139/457 (30%), Positives = 220/457 (48%), Gaps = 26/457 (5%)

Query: 53  ENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAF 112
           EN S++ D       LK++LK+RH+ M                       P++ +I +  
Sbjct: 68  ENGSFDPD------SLKRSLKSRHLIMIAIGGSIGTGLFVGSGKALAIGGPLAVIIGWLI 121

Query: 113 VGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAA 171
            G  +  T+  LGE+    P+ G F  Y +R+ DP+L F V   Y+ ++F + P ++ A+
Sbjct: 122 AGTQMVGTIHGLGEITVRFPVVGAFADYGTRFLDPSLSFVVSSIYVLQWFFVLPLEIIAS 181

Query: 172 ALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXX 231
           A+ IQ+W     ++P VWV IF V IV+IN              SS KV           
Sbjct: 182 AMTIQFW--NTSIDPVVWVAIFYVTIVAINLFGVRGFGEAEFLFSSIKVITISGFIILCI 239

Query: 232 XXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGI 291
                  P H+ +G RYW  PG+              F    SVFV A+Y+  G E+  +
Sbjct: 240 VLIVGGGPTHEYVGARYWHDPGALAH----------GFKGVASVFVTASYSLGGSEMACL 289

Query: 292 VAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPF 351
            + E  +P K +P AIK   +RI+ F+L+S+ L+G  V Y +  L+            PF
Sbjct: 290 ASGET-DP-KELPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSSVNNS----PF 343

Query: 352 VVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGI 411
           V+A     I  LP IINA +LV + S  NS ++ SSR+L S+A     P+IF   +R G 
Sbjct: 344 VIACNLYHIKVLPSIINAVILVSIMSVGNSCIFASSRTLCSMAHQGLIPQIFGYVDRAGR 403

Query: 412 PYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQG 471
           P   +  + LF LLA++  SS+ +++FN+ + +  +   + W+SI +++I F  A++AQ 
Sbjct: 404 PLVGIITNSLFGLLAFLVKSSSMSEVFNWLMAIAGLATCVVWLSINVSHIRFRMAMKAQD 463

Query: 472 VDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL 508
                  +V+    +G+ +S     LI LI  F + L
Sbjct: 464 KTLDELEFVSAVGIWGSVYSAVVNVLI-LIAQFYISL 499

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  200 bits (508), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 136/458 (29%), Positives = 219/458 (47%), Gaps = 22/458 (4%)

Query: 38  NDDLERNISSASS-QDENDSYNI--DGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXX 94
           ND + R  ++ +  Q   DS+    DG      LKK+LKARH+ M               
Sbjct: 40  NDGVRRRSTNRNVLQRMVDSFKPPEDGSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGS 99

Query: 95  XXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVG 153
                   P++ +I +   G  +  T+  LGE+    P+ G F  Y +R+ +P++ F V 
Sbjct: 100 GKALALGGPLALIIGWTIAGTQMVGTIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVV 159

Query: 154 YAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXX 213
             Y+ ++  + P ++ AAA+ ++YW     V+P VWV IF  +I  IN            
Sbjct: 160 LIYVLQWCFVLPLEIIAAAMTVEYW--DTSVSPVVWVAIFYGIIALINLVGVRGFGEAEF 217

Query: 214 WLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFV 273
             S  KV                  P  + +G +YW  PG      + + G         
Sbjct: 218 VFSLIKVITIVGFIILCIVLICGGGPKKEFVGAKYWHDPGPLANGFKGVAG--------- 268

Query: 274 SVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDD 333
            V V A+Y+  G E+  + + E  +P K +P AIK   +RIV F+L+S+ L+G  V Y +
Sbjct: 269 -VLVIASYSLGGTEMACLASGET-DP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTN 325

Query: 334 PLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSL 393
             L+            PFV+AI   GINALP I+NA +LV + S  NS ++ SSR+L S+
Sbjct: 326 QNLMGGSSVDNS----PFVIAIRLHGINALPSIVNAVILVSLLSVGNSCIFASSRTLCSM 381

Query: 394 AIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSW 453
           A     P++F   +R G P   +  ++LF LLA++  S ++  +F + + +  +   + W
Sbjct: 382 AHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLAFLVKSGSAGDVFTWLMAIAGLATCVVW 441

Query: 454 ISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFS 491
           +SI I++I F  A++AQGVD     +V+    YG+ +S
Sbjct: 442 LSINISHIRFRLAMKAQGVDLEELEFVSGVGIYGSVYS 479

>Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON}
           ANNOTATED BY YGOB - YOL020W (TAT2) - Tryptophan
           permease, high affinity [contig 265] PARTIAL
          Length = 491

 Score =  200 bits (508), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 136/458 (29%), Positives = 219/458 (47%), Gaps = 22/458 (4%)

Query: 38  NDDLERNISSASS-QDENDSYNI--DGKTEGTRLKKALKARHVSMXXXXXXXXXXXXXXX 94
           ND + R  ++ +  Q   DS+    DG      LKK+LKARH+ M               
Sbjct: 40  NDGVRRRSTNRNVLQRMVDSFKPPEDGSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGS 99

Query: 95  XXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVG 153
                   P++ +I +   G  +  T+  LGE+    P+ G F  Y +R+ +P++ F V 
Sbjct: 100 GKALALGGPLALIIGWTIAGTQMVGTIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVV 159

Query: 154 YAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXX 213
             Y+ ++  + P ++ AAA+ ++YW     V+P VWV IF  +I  IN            
Sbjct: 160 LIYVLQWCFVLPLEIIAAAMTVEYW--DTSVSPVVWVAIFYGIIALINLVGVRGFGEAEF 217

Query: 214 WLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFV 273
             S  KV                  P  + +G +YW  PG      + + G         
Sbjct: 218 VFSLIKVITIVGFIILCIVLICGGGPKKEFVGAKYWHDPGPLANGFKGVAG--------- 268

Query: 274 SVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDD 333
            V V A+Y+  G E+  + + E  +P K +P AIK   +RIV F+L+S+ L+G  V Y +
Sbjct: 269 -VLVIASYSLGGTEMACLASGET-DP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTN 325

Query: 334 PLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSL 393
             L+            PFV+AI   GINALP I+NA +LV + S  NS ++ SSR+L S+
Sbjct: 326 QNLMGGSSVDNS----PFVIAIRLHGINALPSIVNAVILVSLLSVGNSCIFASSRTLCSM 381

Query: 394 AIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSW 453
           A     P++F   +R G P   +  ++LF LLA++  S ++  +F + + +  +   + W
Sbjct: 382 AHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLAFLVKSGSAGDVFTWLMAIAGLATCVVW 441

Query: 454 ISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFS 491
           +SI I++I F  A++AQGVD     +V+    YG+ +S
Sbjct: 442 LSINISHIRFRLAMKAQGVDLEELEFVSGVGIYGSVYS 479

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  201 bits (511), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 139/516 (26%), Positives = 242/516 (46%), Gaps = 24/516 (4%)

Query: 68  LKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEM 127
           L ++L  RH++M                       P S  I Y  +G +V+ TM CLGEM
Sbjct: 57  LNRSLSPRHINMISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIMGGVVYLTMLCLGEM 116

Query: 128 ATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNP 186
           +T++P+ G F SYA ++   +  FA+   Y F   +   + LTA  LV+ YW   +   P
Sbjct: 117 STFMPISGSFCSYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQLVLDYWKSSQHNFP 176

Query: 187 GVWVT--IFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRL 244
             W    +F V ++ +N            WL+  KV                  PDH+ +
Sbjct: 177 -YWAASLLFWVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILAIVVNVGHNPDHEYI 235

Query: 245 GFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIP 304
           GF+YW    S+KE +  + G    F  FV++FV + ++Y G E   + A EA+NP ++ P
Sbjct: 236 GFKYW----SYKE-APFVNG----FKGFVTIFVSSAFSYGGTESITLTAGEARNPIRNTP 286

Query: 305 KAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALP 364
           + +K   +RI+IFY+ ++F + M + YD P L             PF +    +G  A  
Sbjct: 287 RIVKTVFWRILIFYVATMFFISMNIPYDYPNL-----STKSVMTSPFTIIFQMAGTKAAG 341

Query: 365 HIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKA-PKIFAKTNRWGIPYYALSVSVLFC 423
             +NA +L  + SA N  L+  SR LY++ ++    PK+  KTNR+  PY A+ ++    
Sbjct: 342 SFMNAVILTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAPYVAVILTWAVG 401

Query: 424 LLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPF 483
            L +      +  ++ +  N+V +   ++W+SI +T I F + +  QG  +    +    
Sbjct: 402 GLCFGASFIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQQGKTQE-LQFKNWT 460

Query: 484 QPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVI 543
            PYG +F + F  LI L++ ++ F    +   +F + Y+ L VF  C+  +    + + +
Sbjct: 461 YPYGPYFLVIFVTLIILVQGWSAF--DPWSTSDFFSYYLELFVFPTCWLIWWIFKRDRFV 518

Query: 544 DPLKVDLYT--FKAAIDQEEEDGKMADAEKAERIKQ 577
            P  +D  T  +  +  + EE+ ++ + E   + +Q
Sbjct: 519 KPEDMDFITDRYIQSPQEIEENERLDNLEGYPKYRQ 554

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  201 bits (511), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 155/590 (26%), Positives = 265/590 (44%), Gaps = 42/590 (7%)

Query: 8   SNSTSDQY---EEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTE 64
           S S++  Y   E+Y++ L       P ++ E++   +E + S  + +D +   NI     
Sbjct: 4   SESSASGYIPEEDYYKGL-----NTPPKKNEVV---VELDPSLTTEEDYDPEANIR---- 51

Query: 65  GTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACL 124
              L++ALK RH++M                       P S  + Y  +G +V+ T+ CL
Sbjct: 52  -EDLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPASLFMNYTIMGGVVYLTLLCL 110

Query: 125 GEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEK 183
           GEM+TY+P+ G F SYA ++   +   A+ + Y F   +   + +TA  LV+ YW D E 
Sbjct: 111 GEMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDMTALQLVMDYW-DTEA 169

Query: 184 VNPGVWVT--IFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDH 241
                W    +F  ++V +N            WL+  KV                  P H
Sbjct: 170 SGFPYWAASLLFWFLVVLLNVIHVRFYGEAEYWLAMLKVIAIIIFFILSIVVNVGHNPQH 229

Query: 242 DRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRK 301
           + +GF+ W H        E    D   F  F S+FV A++AY G E   +   EA NP +
Sbjct: 230 EYIGFKNWNH-------GEAPFVDG--FKGFASLFVSASFAYGGTESITLTNGEAANPLR 280

Query: 302 SIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSGIN 361
           + PK +K   +RI++FY+ S F + M + YD P L             PF +    +G  
Sbjct: 281 NTPKIVKTVFWRILVFYVGSTFFIAMNIPYDYPGL-----DTKSVVTSPFTLVFQMAGTK 335

Query: 362 ALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAP-KIFAKTNRWGIPYYALSVSV 420
           A    +NA ++  V SACN  L+  SR +Y++ ++   P KI ++TNR+ +PY ++ ++ 
Sbjct: 336 AAGSFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPKKIVSRTNRYKVPYVSVLITS 395

Query: 421 LFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYV 480
              LL +      +  ++ +  N+V +   ++W+ I IT I F + +  QG       Y 
Sbjct: 396 SIGLLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQG-KTHELRYK 454

Query: 481 APFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKT 540
               PYG +F + F   I L++ ++ F    +D  NF + Y+ L VF FC+  +    + 
Sbjct: 455 NWTYPYGPYFLVIFVTFIILVQGWSAF--DPWDVTNFFSYYLDLFVFPFCFIIWWLYKRD 512

Query: 541 KVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKFL 590
           + +    +D  T +    +E     +   E  + +K   +  +W  D F+
Sbjct: 513 RFVKLEDMDFVTDRYIPTKE----IIELNENLDHLKGWKRTRQWLNDYFV 558

>YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}
           AGP2High affinity polyamine permease, preferentially
           uses spermidine over putrescine; expression is
           down-regulated by osmotic stress; plasma membrane
           carnitine transporter, also functions as a low-affinity
           amino acid permease
          Length = 596

 Score =  201 bits (510), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 136/523 (26%), Positives = 240/523 (45%), Gaps = 16/523 (3%)

Query: 51  QDENDSYNIDGKTEG---TRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTL 107
           +D   S + D +T     T  ++ L+ RHV +                       P S L
Sbjct: 64  EDRGSSIDDDSRTYLLYFTETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLL 123

Query: 108 IAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPN 166
           +A+A   + +        EM  + P+   F   A++  D +L     + + F   +  P 
Sbjct: 124 LAFALWCVPILCITVSTAEMVCFFPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPF 183

Query: 167 QLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXX 226
           ++ +   +I YW D       + V + L +++SI             WL+SFK+      
Sbjct: 184 EIVSVNTIIHYWRDDYSAGIPLAVQVVLYLLISI--CAVKYYGEMEFWLASFKIILALGL 241

Query: 227 XXXXXXXXXXXXPDHDRLGFR-YWRHPGSFKEY---SETITGDTGRFVAFVSVFVYATYA 282
                       P+HDR GFR Y   P  FK+Y      +   +G F  F++  + A++ 
Sbjct: 242 FTFTFITMLGGNPEHDRYGFRNYGESP--FKKYFPDGNDVGKSSGYFQGFLACLIQASFT 299

Query: 283 YLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDP-LLIXXXX 341
             G E   ++A E + PRK +PKA K    R+   +L S   +G+  + +DP L      
Sbjct: 300 IAGGEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINE 359

Query: 342 XXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPK 401
                   P+V+A+ N  I  LP I+N  ++   FSA N+  Y SSR+ Y +A+D  APK
Sbjct: 360 ARPGAGSSPYVIAMNNLKIRILPDIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPK 419

Query: 402 IFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYI 461
           IF + NR G+P Y++++S+++ L++ + ++S SA + N+ +N+++   +++++ + I Y+
Sbjct: 420 IFTRCNRHGVPIYSVAISLVWALVSLLQLNSNSAVVLNWLINLITASQLINFVVLCIVYL 479

Query: 462 CFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGY 521
            F RA   Q        + +  QPY A   L  C  + LI+ +TVF    ++ ++F+  Y
Sbjct: 480 FFRRAYHVQQDSLPKLPFRSWGQPYTAIIGLVSCSAMILIQGYTVFFPKLWNTQDFLFSY 539

Query: 522 IGLPVFFFCYFGYKFTYKT---KVIDPLKVDLYTFKAAIDQEE 561
           + + +    Y GYKF +K       +P ++D       I+  E
Sbjct: 540 LMVFINIGIYVGYKFIWKRGKDHFKNPHEIDFSKELTEIENHE 582

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  201 bits (512), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 158/553 (28%), Positives = 249/553 (45%), Gaps = 31/553 (5%)

Query: 40  DLERNISSASSQDENDSYNIDGKTE----GTRLKKALKARHVSMXXXXXXXXXXXXXXXX 95
           DLE ++++A S   ++ +      E       LK+ +  RH+                  
Sbjct: 85  DLENDLTTAVSPQLSNYHGSIPSDEVVIKKEELKRDINQRHMVFMAIGSGVGTGLLVGNA 144

Query: 96  XXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMA-TYIPL-DGFTSYASRYCDPALGFAVG 153
                  P   LI YA +G  V+  +   GE+  TY  L  GF +Y +    P+  F+VG
Sbjct: 145 STLNSAGPAGLLIGYALMGTCVYCVIQAAGELGVTYANLIGGFNAYPAILVAPSFAFSVG 204

Query: 154 YAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXX 213
           + Y  ++  + P +L  A+L I+YW    KV+P V+V IF ++I+ IN            
Sbjct: 205 WIYTLQWLCMTPLELVTASLTIKYWT--TKVDPDVFVVIFYLLILLINFFGSKGYAEADF 262

Query: 214 WLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFV 273
           + +  K+                       LG +YW +PG+F+            F    
Sbjct: 263 FFNCMKLAMISGFFILGIVVACGGAGHDGYLGGKYWHNPGAFRGEKAI-----DHFKGVS 317

Query: 274 SVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDD 333
           SVFV + +A+ G E   + A+E  NPRKSIP A KL +YRI+  YL SI +LG  V +D 
Sbjct: 318 SVFVTSAFAFGGSEFVALSASEQANPRKSIPSAAKLILYRIIWVYLTSITILGFLVPWDS 377

Query: 334 PLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSL 393
           P L             P+VVAI   G+  +PH+INA +L+ V S  NS  + SSR L SL
Sbjct: 378 PQL---QPSSDGKKTSPYVVAIAMHGVKVVPHLINAVILMAVLSVSNSAFFYSSRLLLSL 434

Query: 394 AIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSW 453
           +    APK F   +R G P  A+ +S LF ++ +   S     +F++ + +  +  I ++
Sbjct: 435 SQRGYAPKWFDYVDRKGRPVRAMLISALFGVICFCATSKKETDVFSWLLAISGLSTIFTY 494

Query: 454 ISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCL---IALIKNFTVFL-- 508
            SI +++I    A++ QG       + +    YG+    F+ CL   ++L+  F V L  
Sbjct: 495 FSICVSHIRMRSAMKVQGRSLGELGFRSQVGTYGS----FYACLLLVLSLMAEFWVALAP 550

Query: 509 --NHQFDYKNFITGYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAIDQEEEDG 564
               + D ++F   Y+  P+    YFGY    K     I    +DL   +   D  E+  
Sbjct: 551 IGEGKLDAESFFENYLAAPIGIVFYFGYMIWKKDFRIFIRSKDIDLDFKRQVFD--EDLI 608

Query: 565 KMADAEKAERIKQ 577
           K  D E AE+++ 
Sbjct: 609 KQEDEEYAEQMRN 621

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  200 bits (509), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 155/557 (27%), Positives = 247/557 (44%), Gaps = 37/557 (6%)

Query: 32  QEEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMXXXXXXXXXXXX 91
           +  EL  +DLE    S  ++              T LKKA+K+RHV M            
Sbjct: 31  ESPELEENDLEDGTRSIVTK--------------THLKKAMKSRHVVMMSIGTGIGTGLL 76

Query: 92  XXXXXXXXXXXPVSTLIAYAFVGLLVFFTMACLGEMATYIP-LDG-FTSYASRYCDPALG 149
                      P S +I Y  V  + +F +   GEMA   P L G F SY S +     G
Sbjct: 77  VANAKGLYFSGPASLIIGYVLVSFVTYFMIQAAGEMAVAYPTLPGSFNSYTSTFISKPFG 136

Query: 150 FAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINXXXXXXXX 209
           FA  + +  ++  + P +L  A+L ++YW DK  +N  V++ IF   ++ I+        
Sbjct: 137 FATVWLFFIQWLTVFPLELITASLTVKYWNDK--INADVFIIIFYAFLLFIHFFGVKAYG 194

Query: 210 XXXXWLSSFKVXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRHPGSFKEYSETITGDTGRF 269
                 +S KV                       +G +YW  PGSF +    IT    RF
Sbjct: 195 ETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGYIGAKYWHDPGSFAD-GPPIT----RF 249

Query: 270 VAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCV 329
                + V A ++Y G EL  +   E +NPRKS P A K ++YRI+I YL ++ L+G  V
Sbjct: 250 KGVCFILVSAYFSYGGAELFSLSVNEQENPRKSTPAAAKQSIYRILIIYLATMILIGFNV 309

Query: 330 AYDDPLLIXXXXXXXXXXXXPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRS 389
            ++   L+            P+V+A     +  +PH INA +L+ V S  NS LY + R 
Sbjct: 310 PHNSDELMGAGSAATHAS--PYVLAASLHSVKVVPHFINAVILISVISVANSALYAAPRL 367

Query: 390 LYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFG 449
           + SLA    APK     +R G P   L +  LF ++ ++  SS   ++F +   +  +  
Sbjct: 368 MCSLAEQGYAPKFLNYVDREGRPLRGLILCALFGVIGFVSASSKEEEVFTWLAAIAGLSE 427

Query: 450 ILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLN 509
           + +W  I++++I F +A++  G       + A    +G+++   F  L+  I  F V L+
Sbjct: 428 LFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAVTGIWGSYYGCAFNILV-FIAQFWVALS 486

Query: 510 -----HQFDYKNFITGYIGLPVFFFCYFGYKFTYKTK--VIDPL-KVDLYTFKAAIDQEE 561
                 + D + F   Y+  P++   YFGY   YK    +++PL K+DL   +   D + 
Sbjct: 487 PPGSGGKCDAEAFFQSYLAAPIWLVFYFGY-MIYKRDFTILNPLEKIDLDFHRRIYDPDF 545

Query: 562 EDGKMADAEKAERIKQN 578
              K  D E  ER+K +
Sbjct: 546 I--KQEDEENKERLKNS 560

>YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}
           MMP1High-affinity S-methylmethionine permease, required
           for utilization of S-methylmethionine as a sulfur
           source; has similarity to S-adenosylmethionine permease
           Sam3p
          Length = 583

 Score =  200 bits (508), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 153/587 (26%), Positives = 259/587 (44%), Gaps = 49/587 (8%)

Query: 2   TIRQIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDG 61
           ++   PSN  ++    +     + +   P  +E L+  +L        S++E   +++  
Sbjct: 17  SVLSTPSNEGNNLIHRFKNSFKRNDS--PAIQEGLLYSEL--------SEEEKIQWDLAN 66

Query: 62  KTEGTRLKKALKARHVSMXXXXXXXXXXXXXXXXXXXXXXXPVSTLIAYAFVGLLVFFTM 121
           +      KK L  RH++M                       P S LI +  VG  +   +
Sbjct: 67  QP----YKKVLDQRHLTMIAIGGTLGTGLFIGLGESLASG-PASLLIGFLLVGASMLCVV 121

Query: 122 ACLGEMATYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVD 180
            C  E++   P+ G +  +ASR+ DP++GF++G  YL  + I  P++L   +L I YW  
Sbjct: 122 QCGAELSCQYPVSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYWA- 180

Query: 181 KEKVNPGVWVTIFLVVIVSINXXXXXXXXXXXXWLSSFKVXXXXXXXXXXXXXXXXXXPD 240
              VNP  WV I  V+ + +N            ++S FK+                  PD
Sbjct: 181 -PSVNPAAWVAIAFVLSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIGIVLIAGGGPD 239

Query: 241 HDR-LGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNP 299
               +G +YW  PGSF             F    + FV A Y++ G E+  + + EA++ 
Sbjct: 240 STGYIGTKYWHDPGSFA---------VPVFKNLCNTFVSAAYSFSGTEMVVLTSTEARSV 290

Query: 300 RKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIXXXXXXXXXXXXPFVVAIINSG 359
             S+ +A K T +RI+IFY++++ ++G  V Y+DP LI            PFV+A+ N+G
Sbjct: 291 -SSVSRAAKGTFWRIIIFYIVTVIIIGCLVPYNDPRLISGSSSEDITAS-PFVIALSNTG 348

Query: 360 I--NALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALS 417
                + H +NA +L+ VFS CNS +Y SSR +  LA   + PKI A  +R G P   ++
Sbjct: 349 AMGTRVSHFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPKICAYMDRNGRPLVGMA 408

Query: 418 VSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTF 477
           +   F LL ++ VS     +F +   + SI    +W  I    + F  A++AQG  K   
Sbjct: 409 ICGAFGLLGFLVVSKNQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDI 468

Query: 478 AYVAPFQPYGAWFSLFFCCLIALIKNFTVFLN-----HQFDYKNFITGYIGLPVFFFCYF 532
            Y +    YG    +F C L  L+    ++++           NF    + +P+    Y 
Sbjct: 469 IYRSTLGIYGG---IFGCILNVLLVIGEIYVSAAPVGSPSSAANFFEYCMSIPIMIAVYI 525

Query: 533 G---YKFTYKTKVIDPLKVDLYT------FKAAIDQEEEDGKMADAE 570
           G   Y+  ++   I  + +DL +      F+A   + +ED K   ++
Sbjct: 526 GHRIYRRDWRHWYIKRMDIDLDSGHSLEDFEATKLERDEDKKYVSSK 572

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.141    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,564,389
Number of extensions: 2258042
Number of successful extensions: 12632
Number of sequences better than 10.0: 380
Number of HSP's gapped: 11146
Number of HSP's successfully gapped: 411
Length of query: 594
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 479
Effective length of database: 40,294,809
Effective search space: 19301213511
Effective search space used: 19301213511
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 69 (31.2 bits)