Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0I02650na 1ON63863830630.0
NCAS0D02350na 1ON63460223440.0
Skud_5.24na 1ON62758120580.0
Kpol_358.4na 1ON61756920540.0
Suva_5.2na 1ON62760120530.0
YEL065W (SIT1)na 1ON62858120460.0
Smik_5.22na 1ON62857920420.0
SAKL0C12122gna 2ON61159520260.0
TPHA0M00120singletonON61958520240.0
Kwal_23.5241na 2ON59155418950.0
TDEL0G04740singletonON60159918930.0
KLTH0A01562gna 2ON61559018810.0
Kwal_23.4853na 3ON60354917810.0
KLTH0G09504gna 3ON62459417760.0
Kpol_416.6singletonON59759616920.0
Kpol_416.5singletonON60759615840.0
TPHA0G03780singletonON61256514920.0
Kpol_513.33singletonON62657914920.0
NCAS0A11500singletonON61459614820.0
TDEL0B00140singletonON63260614790.0
NDAI0A02050singletonON61757614410.0
TPHA0B00180singletonON63360514070.0
KAFR0D00930singletonON61459113940.0
SAKL0G06600gsingletonON62959213531e-180
KNAG0J02980singletonON63662213471e-179
Suva_8.12na 4ON63357513281e-176
CAGL0E04092gna 4ON64557713101e-173
TBLA0C01040singletonON66961513021e-171
YHL040C (ARN1)na 4ON62761512971e-171
KAFR0I01560singletonON63262212891e-170
Smik_8.1na 4ON62757512841e-169
Skud_8.3na 4ON63162712821e-169
KAFR0C02660singletonON59158212661e-167
NDAI0H00140na 4ON63262612571e-165
SAKL0G03300gsingletonON61659912471e-164
KLTH0D00506gsingletonON61662112251e-160
ZYRO0G07414gsingletonON70758112241e-159
KLLA0A10439gsingletonON63458712141e-159
KLLA0C19272gsingletonON62356512111e-158
TPHA0K02330singletonON63160211951e-156
SAKL0F00792gsingletonON61758911501e-149
KLTH0D00110gsingletonON62061811441e-148
KLTH0B10450gsingletonON62061811441e-148
Kwal_56.22298singletonON61057611421e-148
KLTH0D18150gsingletonON60761611351e-147
Kwal_34.15711na 4ON61861011301e-146
TDEL0H00130singletonON62157811201e-145
SAKL0F00110gsingletonON62060611041e-142
Kwal_23.2794singletonON61961611031e-142
KLTH0A07964gsingletonON61957111011e-142
SAKL0E00132gsingletonON62059610991e-142
YHL047C (ARN2)singletonON62061610921e-140
KLLA0C00220gsingletonON62460810711e-137
TBLA0F00470singletonON73258110571e-134
NCAS0I00110na 4ON45244710151e-131
Skud_18.6singletonON61059710031e-127
KLLA0E14609gsingletonON6395679731e-123
YKR106W (GEX2)singletonON6156009311e-117
YCL073C (GEX1)singletonON6156009281e-116
Kwal_14.722singletonON6115979181e-115
KLTH0B00110gsingletonON6275918711e-108
KLLA0D19945gsingletonON6446148661e-107
KLTH0G00198gna 4ON4584407907e-98
Smik_11.370singletonON4404397758e-96
YOL158C (ENB1)singletonON6065405941e-67
TDEL0H01600singletonON6045405232e-57
Smik_21.4singletonON6055415214e-57
Suva_26.1singletonON5345434954e-54
Smik_6.22singletonON6366224549e-48
Skud_6.14singletonON6366224451e-46
Suva_10.9singletonON6375704372e-45
TDEL0A03210singletonON5844793318e-32
NCAS0I00100singletonON1631612672e-26
Smik_11.369singletonON1681252284e-21
Smik_17.11singletonON5443471787e-13
YPR198W (SGE1)singletonON5433431563e-10
Skud_16.503singletonON5433431564e-10
SAKL0A00726gsingletonON5982811378e-08
Smik_16.81na 5ON6254861296e-07
KNAG0K01020singletonON5993541262e-06
KLTH0B00132gsingletonON5683781262e-06
Skud_7.560na 5ON6423721252e-06
Kwal_26.9616singletonON5623471252e-06
KLTH0C10120gsingletonON6513751172e-05
YKR105C (VBA5)singletonON5823991145e-05
KLTH0C10142gsingletonON5735141101e-04
Skud_13.258.843ON537771082e-04
NCAS0C03460na 5ON6303911082e-04
KLTH0D16962gsingletonON5713391047e-04
TDEL0F039908.272ON631242970.005
TBLA0D032708.843ON55078950.007
KLLA0A04631g8.272ON57977940.010
KLTH0G13464g8.272ON593346940.011
Kwal_27.102458.843ON51589930.012
TBLA0D05810singletonON574181930.014
TBLA0D03280singletonON58078930.015
CAGL0J01375g2.473ON564254920.016
KLTH0B10142gsingletonON568367920.019
TPHA0A017508.272ON636256910.021
TBLA0A03450singletonON573275900.026
TBLA0E01970singletonON578149900.034
Kpol_543.448.272ON643246890.037
Skud_4.5singletonON573165880.047
TBLA0A03480singletonON574121880.050
Suva_13.278.843ON55344880.057
ABL040W2.473ON567243870.069
NCAS0B002908.843ON54275860.078
ZYRO0C01430g8.272ON590254860.082
YNR072W (HXT17)singletonON56477860.10
YEL069C (HXT13)na 6ON56477850.11
YDL245C (HXT15)singletonON56777850.11
YJR158W (HXT16)singletonON56777850.11
TBLA0F030408.272ON906273850.12
Smik_25.4singletonON315103830.15
Smik_11.368singletonON580397840.18
Ecym_13888.858ON572166840.18
ZYRO0C00374gna 7ON56460830.18
NDAI0E002108.858ON61393830.22
KLTH0H05456gna 8ON568172820.24
KAFR0B039408.843ON54779820.26
SAKL0D00814g8.858ON570192820.29
Skud_14.406na 9ON564171820.30
Smik_14.401na 9ON63694810.33
YGR224W (AZR1)na 5ON613266810.37
Smik_5.19na 6ON56794810.38
Smik_6.20singletonON569131810.40
TBLA0D05800singletonON574152800.45
Smik_10.8singletonON569103800.53
Suva_4.2singletonON57057800.54
YJL214W (HXT8)singletonON569131790.56
AGR076C8.272ON686251790.60
Kwal_14.1585na 8ON570132790.68
NCAS0C002708.858ON57096780.78
Skud_7.620singletonON468103770.90
Suva_13.4678.843ON54373770.93
KLLA0D19941gsingletonON611367770.96
YML116W (ATR1)8.843ON54277771.0
Skud_6.12singletonON470103771.0
Skud_13.188.858ON58593771.1
Suva_13.208.858ON58493771.1
Suva_4.553na 10ON562329771.1
TBLA0A033905.394ON57470771.2
YCL069W (VBA3)singletonON458239761.2
SAKL0C02178gsingletonON565206771.2
CAGL0B02079gna 5ON624381771.2
Skud_18.3singletonON590393771.2
TBLA0A03430singletonON56468761.4
TBLA0B00840singletonON63774761.4
NCAS0B002208.858ON62593761.5
TBLA0A03460singletonON56874761.5
KNAG0C051905.395ON56469751.7
NDAI0B03060singletonON59852751.7
KLLA0E09021gna 7ON56657751.7
Kwal_26.6686singletonON56939751.8
TBLA0B029408.858ON66194751.9
NDAI0K004008.843ON55379751.9
TBLA0A03400singletonON57475752.0
KLLA0F13684g2.473ON571155742.2
Ecym_42988.272ON678121742.4
SAKL0F00198gsingletonON537356742.5
NCAS0F031005.395ON57069742.6
YML123C (PHO84)8.858ON58793732.9
SAKL0H16808g8.272ON657130733.1
AFL205C5.395ON546163733.3
TBLA0A01250singletonON50370733.4
ZYRO0A00330gsingletonON576268733.4
SAKL0B12716gsingletonON632360733.4
TBLA0A03470singletonON57874733.4
TBLA0A01240singletonON56970733.5
Smik_13.2722.473ON561295733.5
Kwal_56.22285singletonON56739733.5
Kwal_55.19582singletonON56739733.6
Kwal_14.854na 11ON57039724.1
ZYRO0G00286gsingletonON58969724.1
AFL207C5.394ON53975724.4
NDAI0D05020singletonON573155724.8
Suva_13.174na 12ON54139714.9
NDAI0G015203.23ON53047715.0
CAGL0B02475g8.858ON58096715.1
TPHA0I003808.858ON57893715.5
TDEL0E02290singletonON57140715.5
Skud_6.61na 13ON54639715.5
Smik_13.118.858ON58693716.1
TDEL0H04480na 7ON57057716.2
Skud_13.163na 12ON54739716.3
KNAG0J002608.843ON55060716.3
ZYRO0A00902g8.858ON604194707.2
Suva_13.2652.473ON561137707.9
TBLA0F01600singletonON567165707.9
Smik_13.188.843ON54576708.2
TPHA0A006203.84ON63442708.6
Smik_12.140na 14ON57369698.6
NDAI0C017405.396ON60775698.8
TPHA0B039001.432ON55452699.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0I02650
         (638 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON}             1184   0.0  
NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON}              907   0.0  
Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)   797   0.0  
Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON} c...   795   0.0  
Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)      795   0.0  
YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}  SIT1Ferrioxa...   792   0.0  
Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)   791   0.0  
SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} simi...   785   0.0  
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}               784   0.0  
Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL06...   734   0.0  
TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {O...   733   0.0  
KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {...   729   0.0  
Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {O...   690   0.0  
KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {...   688   0.0  
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...   656   0.0  
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...   614   0.0  
TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {O...   579   0.0  
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...   579   0.0  
NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa] ...   575   0.0  
TDEL0B00140 Chr2 (25633..27531) [1899 bp, 632 aa] {ON}                574   0.0  
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...   559   0.0  
TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON}      546   0.0  
KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {O...   541   0.0  
SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {...   525   e-180
KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON}             523   e-179
Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON} Y...   516   e-176
CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} simila...   509   e-173
TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON}              506   e-171
YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}  AR...   504   e-171
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C     501   e-170
Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL0...   499   e-169
Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL0...   498   e-169
KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON}              492   e-167
NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON}      488   e-165
SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} simila...   484   e-164
KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar ...   476   e-160
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...   476   e-159
KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {...   472   e-159
KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]...   471   e-158
TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON}             464   e-156
SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar ...   447   e-149
KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to ...   445   e-148
KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {...   445   e-148
Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C ...   444   e-148
KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]...   441   e-147
Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C ...   439   e-146
TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON}      436   e-145
SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to...   429   e-142
Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C (...   429   e-142
KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {...   428   e-142
SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to...   427   e-142
YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}  ARN...   425   e-140
KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar ...   417   e-137
TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON}              411   e-134
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}        395   e-131
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...   390   e-127
KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} simi...   379   e-123
YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}  GEX2Proto...   363   e-117
YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}  GEX1...   362   e-116
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...   358   e-115
KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON} ...   340   e-108
KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} simi...   338   e-107
KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to...   308   7e-98
Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106...   303   8e-96
YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}  E...   233   1e-67
TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {O...   206   2e-57
Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)    205   4e-57
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)       195   4e-54
Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON} Y...   179   9e-48
Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON} Y...   176   1e-46
Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON} ...   172   2e-45
TDEL0A03210 Chr1 (574153..575907) [1755 bp, 584 aa] {ON}              132   8e-32
NCAS0I00100 Chr9 complement(4805..5296) [492 bp, 163 aa] {ON}         107   2e-26
Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W...    92   4e-21
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    73   7e-13
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    65   3e-10
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    65   4e-10
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    57   8e-08
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    54   6e-07
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    53   2e-06
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    53   2e-06
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    53   2e-06
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    53   2e-06
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    50   2e-05
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    49   5e-05
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    47   1e-04
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...    46   2e-04
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    46   2e-04
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    45   7e-04
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    42   0.005
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...    41   0.007
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    41   0.010
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    41   0.011
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...    40   0.012
TBLA0D05810 Chr4 complement(1441639..1443363) [1725 bp, 574 aa] ...    40   0.014
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...    40   0.015
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    40   0.016
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...    40   0.019
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    40   0.021
TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {O...    39   0.026
TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {O...    39   0.034
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    39   0.037
Skud_4.5 Chr4 complement(9302..11023) [1722 bp, 573 aa] {ON} YJR...    39   0.047
TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}               39   0.050
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...    39   0.057
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    38   0.069
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843       38   0.078
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    38   0.082
YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexo...    38   0.10 
YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}  HX...    37   0.11 
YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}  HX...    37   0.11 
YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Prot...    37   0.11 
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    37   0.12 
Smik_25.4 Chr25 (8471..9415) [945 bp, 315 aa] {ON} YJL214W (REAL)      37   0.15 
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    37   0.18 
Ecym_1388 Chr1 complement(806312..808030) [1719 bp, 572 aa] {ON}...    37   0.18 
ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar ...    37   0.18 
NDAI0E00210 Chr5 complement(19177..21018) [1842 bp, 613 aa] {ON}...    37   0.22 
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...    36   0.24 
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...    36   0.26 
SAKL0D00814g Chr4 complement(63086..64798) [1713 bp, 570 aa] {ON...    36   0.29 
Skud_14.406 Chr14 (740510..742204) [1695 bp, 564 aa] {ON} YNR072...    36   0.30 
Smik_14.401 Chr14 (716260..718170) [1911 bp, 636 aa] {ON} YNR072...    36   0.33 
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    36   0.37 
Smik_5.19 Chr5 complement(25102..26805) [1704 bp, 567 aa] {ON} Y...    36   0.38 
Smik_6.20 Chr6 (28923..30632) [1710 bp, 569 aa] {ON} YJL219W (REAL)    36   0.40 
TBLA0D05800 Chr4 complement(1435290..1437014) [1725 bp, 574 aa] ...    35   0.45 
Smik_10.8 Chr10 (9814..11523) [1710 bp, 569 aa] {ON} YJL214W (REAL)    35   0.53 
Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)       35   0.54 
YJL214W Chr10 (26887..28596) [1710 bp, 569 aa] {ON}  HXT8Protein...    35   0.56 
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    35   0.60 
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...    35   0.68 
NCAS0C00270 Chr3 complement(34958..36670) [1713 bp, 570 aa] {ON}...    35   0.78 
Skud_7.620 Chr7 complement(1041205..1041522,1041626..1042714) [1...    34   0.90 
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...    34   0.93 
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    34   0.96 
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...    34   1.0  
Skud_6.12 Chr6 (17593..18687,18791..19108) [1413 bp, 470 aa] {ON...    34   1.0  
Skud_13.18 Chr13 complement(23890..25647) [1758 bp, 585 aa] {ON}...    34   1.1  
Suva_13.20 Chr13 complement(24012..25766) [1755 bp, 584 aa] {ON}...    34   1.1  
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...    34   1.1  
TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {O...    34   1.2  
YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease ...    34   1.2  
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    34   1.2  
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    34   1.2  
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    34   1.2  
TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {O...    34   1.4  
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    34   1.4  
NCAS0B00220 Chr2 complement(20530..22407) [1878 bp, 625 aa] {ON}...    34   1.5  
TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}     34   1.5  
KNAG0C05190 Chr3 (1014564..1016258) [1695 bp, 564 aa] {ON}             33   1.7  
NDAI0B03060 Chr2 complement(775021..776817) [1797 bp, 598 aa] {O...    33   1.7  
KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON} unipro...    33   1.7  
Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}...    33   1.8  
TBLA0B02940 Chr2 (677253..679238) [1986 bp, 661 aa] {ON} Anc_8.8...    33   1.9  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}                33   1.9  
TBLA0A03400 Chr1 complement(810961..812685) [1725 bp, 574 aa] {O...    33   2.0  
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    33   2.2  
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    33   2.4  
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    33   2.5  
NCAS0F03100 Chr6 complement(618654..620366) [1713 bp, 570 aa] {O...    33   2.6  
YML123C Chr13 complement(24037..25800) [1764 bp, 587 aa] {ON}  P...    33   2.9  
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    33   3.1  
AFL205C Chr6 complement(49039..50679) [1641 bp, 546 aa] {ON} Syn...    33   3.3  
TBLA0A01250 Chr1 (294923..296434) [1512 bp, 503 aa] {ON}               33   3.4  
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    33   3.4  
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    33   3.4  
TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}     33   3.4  
TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {O...    33   3.5  
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    33   3.5  
Kwal_56.22285 s56 (26966..28669) [1704 bp, 567 aa] {ON} YNR072W ...    33   3.5  
Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W ...    33   3.6  
Kwal_14.854 s14 complement(82977..84689) [1713 bp, 570 aa] {ON} ...    32   4.1  
ZYRO0G00286g Chr7 (18542..20311) [1770 bp, 589 aa] {ON} highly s...    32   4.1  
AFL207C Chr6 complement(44349..45968) [1620 bp, 539 aa] {ON} Unc...    32   4.4  
NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa] ...    32   4.8  
Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011...    32   4.9  
NDAI0G01520 Chr7 complement(336365..337957) [1593 bp, 530 aa] {O...    32   5.0  
CAGL0B02475g Chr2 (236029..237771) [1743 bp, 580 aa] {ON} highly...    32   5.1  
TPHA0I00380 Chr9 (72432..74168) [1737 bp, 578 aa] {ON} Anc_8.858...    32   5.5  
TDEL0E02290 Chr5 (441643..443358) [1716 bp, 571 aa] {ON} Anc_5.3...    32   5.5  
Skud_6.61 Chr6 (114670..116310) [1641 bp, 546 aa] {ON} YFL011W (...    32   5.5  
Smik_13.11 Chr13 complement(20464..22224) [1761 bp, 586 aa] {ON}...    32   6.1  
TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {O...    32   6.2  
Skud_13.163 Chr13 (274262..275905) [1644 bp, 547 aa] {ON} YHR094...    32   6.3  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...    32   6.3  
ZYRO0A00902g Chr1 complement(64264..66078) [1815 bp, 604 aa] {ON...    32   7.2  
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    32   7.9  
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    32   7.9  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...    32   8.2  
TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.8...    32   8.6  
Smik_12.140 Chr12 (270030..271751) [1722 bp, 573 aa] {ON} YLR081...    31   8.6  
NDAI0C01740 Chr3 (378218..380041) [1824 bp, 607 aa] {ON}               31   8.8  
TPHA0B03900 Chr2 (920520..922184) [1665 bp, 554 aa] {ON} Anc_1.432     31   9.4  

>NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score = 1184 bits (3063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/638 (91%), Positives = 583/638 (91%)

Query: 1   MSLESSHSNQGEEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLL 60
           MSLESSHSNQGEEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLL
Sbjct: 1   MSLESSHSNQGEEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLL 60

Query: 61  FFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIF 120
           FFSLFLVAYAYGLDGNIR               LLSTVNCIKTVIAAAGQIWFARASDIF
Sbjct: 61  FFSLFLVAYAYGLDGNIRYTYQAYATSSYSQHSLLSTVNCIKTVIAAAGQIWFARASDIF 120

Query: 121 GRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWR 180
           GRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWR
Sbjct: 121 GRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWR 180

Query: 181 LLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANK 240
           LLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANK
Sbjct: 181 LLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANK 240

Query: 241 NSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEW 300
           NSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEW
Sbjct: 241 NSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEW 300

Query: 301 KTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQ 360
           KTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQ
Sbjct: 301 KTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQ 360

Query: 361 GDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFV 420
           GDYMYTVLVVAVHESVKSATRITSLYSFVS           IKVRRTKPFIIFGISMWFV
Sbjct: 361 GDYMYTVLVVAVHESVKSATRITSLYSFVSVLTGTGLGLVLIKVRRTKPFIIFGISMWFV 420

Query: 421 AFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAA 480
           AFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAA
Sbjct: 421 AFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAA 480

Query: 481 YNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVK 540
           YNI            WTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVK
Sbjct: 481 YNIGSGLGSAVSGAVWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVK 540

Query: 541 AYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKEDDPVVDFLAKFI 600
           AYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKEDDPVVDFLAKFI
Sbjct: 541 AYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKEDDPVVDFLAKFI 600

Query: 601 PSLRNKKXXXXXXXXXXXXXXXXXSDIELVNTKSTETV 638
           PSLRNKK                 SDIELVNTKSTETV
Sbjct: 601 PSLRNKKNSGNIPNTTHNNNYNNNSDIELVNTKSTETV 638

>NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score =  907 bits (2344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/602 (73%), Positives = 499/602 (82%), Gaps = 2/602 (0%)

Query: 6   SHSNQGEEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLF 65
           S     +++  +KET S     +SS SE S+KDAGV NIE+YAEQY+ P+ R +LFFSLF
Sbjct: 15  STQAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLF 74

Query: 66  LVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRLTM 125
           LVAYAYGLDGNIR               LLSTVNCIKTVIAAAGQIWFARASDIFGRLT+
Sbjct: 75  LVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTI 134

Query: 126 LIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALF 185
           L ++I+FY++GT+IESQATNVARFTAGGCFYQ+GYTGAMLI+E+IATDFSNLNWRLLALF
Sbjct: 135 LGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALF 194

Query: 186 VPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSKDK 245
           +PALPFIINTWISGDVT+AV G+WKWGIGMWAFIFPLACIPL CCMLHMRYLA+KN+KD+
Sbjct: 195 IPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNAKDR 254

Query: 246 LAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHI 305
           L     +PKD   K YF IDV FW+LDMIGLLL+VCFFGCVL+PFTLAGGM  +W+TAHI
Sbjct: 255 LMPSFTIPKDVSRKEYF-IDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHI 313

Query: 306 IVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMY 365
           IVPEVIGW V LPLYILWE+KFS+HPLTPW LLKDRGV+SALIIA +INFCWYMQGDYMY
Sbjct: 314 IVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMY 373

Query: 366 TVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLL 425
           TVL+VAVHESVK+ATRITSLYSFVS           +K+RRTKPFI+FGI  WF++FGLL
Sbjct: 374 TVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGLL 433

Query: 426 IRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIXX 485
           I YRGDS +HAGIIGSLCLLGF AGFFTYTTQ SIQATTRSH K+AVITALYLA YNI  
Sbjct: 434 IHYRGDSGAHAGIIGSLCLLGFCAGFFTYTTQTSIQATTRSHAKMAVITALYLACYNIGS 493

Query: 486 XXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDV 545
                     WTNVLPDRIS+ I+NQTLAAEAYGSPFTFIIT TW T +R AVVKAYR+ 
Sbjct: 494 SFGAAVSGGVWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAERQAVVKAYRET 553

Query: 546 QKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKEDDPVVDFLAKFIPSLRN 605
           QKILCIIGL FC+PLL AAL LR+H+LEDVVAL+++ EK V++DDP+  FL K IP   N
Sbjct: 554 QKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVEDDDPIFAFLKKCIP-FYN 612

Query: 606 KK 607
           KK
Sbjct: 613 KK 614

>Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/581 (66%), Positives = 455/581 (78%), Gaps = 7/581 (1%)

Query: 14  EIAQKE---TYSVHST-DISSG--SEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLV 67
           EI +KE   T  V+ T  ISS   S I + D GV NIE+YAE Y +P YRV LFFSLFL+
Sbjct: 21  EIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIYAEIYNRPLYRVALFFSLFLI 80

Query: 68  AYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLI 127
           AYAYGLDGNIR               LLSTVNCIKTVIAA GQI+FAR SDIFGR ++L+
Sbjct: 81  AYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILV 140

Query: 128 IAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVP 187
           I+++FY++GT+IESQA N+ RF  GGCFYQ+G TG +LI+EVIA+DFSNLNWRLLALF+P
Sbjct: 141 ISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIP 200

Query: 188 ALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSKDKLA 247
           ALPFIINTWISG+VTSA+G +WKWGIGMWAFI PLACIPLG CMLHMRYLA K++KD+L 
Sbjct: 201 ALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRYLARKHAKDRLK 260

Query: 248 KHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIV 307
                    +WK  F ID+ FWKLD+IG+LL+  FFGCVLVPFTLAGG+  EW+TAHIIV
Sbjct: 261 PEFEALNKLKWKS-FCIDIAFWKLDIIGMLLITAFFGCVLVPFTLAGGLKEEWRTAHIIV 319

Query: 308 PEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTV 367
           PEVIGWVV LPLY+LWEMK+S+HPLTPW L+KDRG+F AL+IA  INF WYMQGDYMYTV
Sbjct: 320 PEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGIFFALLIAFFINFNWYMQGDYMYTV 379

Query: 368 LVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIR 427
           L+VAVHES+KSATRITSLYSFVS           IKVRRTKPFI+FGIS W V+FGLL+ 
Sbjct: 380 LIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVH 439

Query: 428 YRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXX 487
           YRGDS +HAGIIGSLCLLGFGAG FTY TQASIQA+ ++H ++A++T+LYLA YNI    
Sbjct: 440 YRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAIVTSLYLATYNIGSAF 499

Query: 488 XXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQK 547
                   WTN+LP  ISK I++ TLAA+AYGSPFTFIIT TWGTP+R+A+V +YR VQK
Sbjct: 500 GSSVSGAVWTNILPREISKRISDPTLAAQAYGSPFTFIITYTWGTPERIALVMSYRYVQK 559

Query: 548 ILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKE 588
           ILCIIGL FC PLL  AL LRNH+L D +AL   D    K+
Sbjct: 560 ILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLESKD 600

>Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON}
           complement(9458..11311) [1854 nt, 618 aa]
          Length = 617

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/569 (68%), Positives = 445/569 (78%), Gaps = 7/569 (1%)

Query: 37  KDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLS 96
           KDAGV NIEVYAEQY  P YRV+LFFSLFLVAYAYGLDG++R               LLS
Sbjct: 54  KDAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLS 113

Query: 97  TVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFY 156
           TVN I TVIAAAGQI +ARASDIFGR+T+LII ++FY VGTIIESQATNV RF  G CFY
Sbjct: 114 TVNAITTVIAAAGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFY 173

Query: 157 QVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMW 216
           Q+GYTG +L +E+IA DFSNLNWRL A FVPALPFIINTWISG+V+ AVG  WKWGIGMW
Sbjct: 174 QLGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMW 233

Query: 217 AFIFPLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGL 276
           AFI PL+ IPLGCC+LHMR+LA+KN+KD+L       +D  W  Y  +DV  WKLD IGL
Sbjct: 234 AFIVPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYI-VDVFLWKLDFIGL 292

Query: 277 LLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWA 336
           LL+   FGC+LVPFTLAGG+  +WKTAHIIVPEVIGW V LP+++LWE+KFSK PLTPWA
Sbjct: 293 LLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWA 352

Query: 337 LLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXX 396
           L+KDRG+F AL+IA  INF WYMQGDYMYTVL+V+V+ES+KSATRITSLYSFVS      
Sbjct: 353 LIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTL 412

Query: 397 XXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTT 456
                IKVRRTKPFIIFG+S WF+AFGLL+ YRG S+SH+GI+GSLCLLGFGAGFFTYTT
Sbjct: 413 LGLVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRGSSSSHSGIVGSLCLLGFGAGFFTYTT 472

Query: 457 QASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAE 516
           QASIQA+ + H K+AVITALYLA YNI            WTNVLP +ISK IAN+TLAAE
Sbjct: 473 QASIQASVKYHSKMAVITALYLAMYNIGSAVGAAVSGAIWTNVLPKQISKRIANETLAAE 532

Query: 517 AYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVV 576
           AYGSPFTFI+T TW TP+R AVV +YR  QKILCI+GLCFC  LL AALFLRNH+LE VV
Sbjct: 533 AYGSPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVV 592

Query: 577 ALNELDEKNVKEDDPVVDFLAKFIPSLRN 605
           AL+EL      E+ P  D    F  + +N
Sbjct: 593 ALSEL------ENTPNSDEQGSFADNDKN 615

>Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/601 (64%), Positives = 455/601 (75%), Gaps = 16/601 (2%)

Query: 14  EIAQKETYSVH------STDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLV 67
           EI +KE  +        +T   + S I + D GV+NIE+YAEQY +P YR  LFFS+FL+
Sbjct: 21  EILEKEVGTTTAAGPALTTSSPAPSYIELIDPGVRNIEIYAEQYSRPLYRAGLFFSIFLI 80

Query: 68  AYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLI 127
           AYAYGLDG IR               LLSTVNCIKTVIAA GQI+FAR SDIFGR ++L+
Sbjct: 81  AYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILV 140

Query: 128 IAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVP 187
           I+++FY VGTIIESQA  + RF  GGCFYQ+G TG +LI+EVIA+DFSNLNWRLLALFVP
Sbjct: 141 ISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNWRLLALFVP 200

Query: 188 ALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSKDKLA 247
           ALPFI+NTWISGDVTSA+G +WKWGIGMWAFI PLACIPLG CMLHMRYLA K++KDKL 
Sbjct: 201 ALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRYLARKHAKDKLR 260

Query: 248 KHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIV 307
                  + +WK  F ID++FWKLD+IGLLL+  FFGCVLVPFTLAGG+  EWK AHIIV
Sbjct: 261 PEFETLNNLDWKS-FSIDIVFWKLDLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIV 319

Query: 308 PEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTV 367
           PEVIGWVV LPLY++WE+K+S+HPLTPW L+KDRGV  AL IA  INF WYMQGDYMYTV
Sbjct: 320 PEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVLFALFIAFFINFNWYMQGDYMYTV 379

Query: 368 LVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIR 427
           LVVAVHES+KSATRIT+LYSFVS           IKVRRTKPFI+FGIS W V+FGLL+ 
Sbjct: 380 LVVAVHESIKSATRITALYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVH 439

Query: 428 YRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXX 487
           YRGDS +HAGIIGSLCLLGFGAG FTY TQASIQA+  +H ++A++T+LYLA YNI    
Sbjct: 440 YRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAGTHARMAIVTSLYLATYNIGSAF 499

Query: 488 XXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQK 547
                   WTN+LP  ISK I++ TLAAEAYGSPFTFI T TWGTP+R+A+V +YR VQK
Sbjct: 500 GSSVSGAVWTNILPKEISKRISDPTLAAEAYGSPFTFITTYTWGTPERIALVMSYRYVQK 559

Query: 548 ILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKEDDPVVD---------FLAK 598
           ILCIIGL FC PLL  A  LRNH+L D +AL   D    K D+ +V+         FLA+
Sbjct: 560 ILCIIGLVFCFPLLGCACMLRNHKLTDSIALEGNDHLESKNDNEIVEKEETSLRTRFLAQ 619

Query: 599 F 599
           F
Sbjct: 620 F 620

>YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}
           SIT1Ferrioxamine B transporter, member of the ARN family
           of transporters that specifically recognize
           siderophore-iron chelates; transcription is induced
           during iron deprivation and diauxic shift; potentially
           phosphorylated by Cdc28p
          Length = 628

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/581 (66%), Positives = 451/581 (77%), Gaps = 5/581 (0%)

Query: 12  EEEIAQK-ETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYA 70
           E+E+  K +     +T   + S I + D GV NIE+YAE Y +P YRV LFFSLFL+AYA
Sbjct: 24  EKEVGAKVDVKPTLTTSSPAPSYIELIDPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYA 83

Query: 71  YGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAI 130
           YGLDGNIR               LLSTVNCIKTVIAA GQI+FAR SDIFGR +++I++I
Sbjct: 84  YGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSI 143

Query: 131 LFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVPALP 190
           +FY +GTIIESQA N+ RF  GGCFYQ+G TG +LI+EVIA+DFSNLNWRLLALF+PALP
Sbjct: 144 IFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALP 203

Query: 191 FIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSKDKLAKHV 250
           FIINTWISG+VTSA+  +WKWGIGMWAFI PLACIPLG CMLHMRYLA K++KD+L    
Sbjct: 204 FIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRLKPEF 263

Query: 251 MVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEV 310
                 +WK  F ID+ FWKLD+IG+LL+  FFGCVLVPFTLAGG+  EWKTAHIIVPEV
Sbjct: 264 EALNKLKWKS-FCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEV 322

Query: 311 IGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVV 370
           IGWVV LPLY+LWE+K+S+HPLTPW L++DRG+F AL+IA  INF WYMQGDYMYTVLVV
Sbjct: 323 IGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGIFFALLIAFFINFNWYMQGDYMYTVLVV 382

Query: 371 AVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRG 430
           AVHES+KSATRITSLYSFVS           IKVRRTKPFIIFGIS W V+FGLL+ YRG
Sbjct: 383 AVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRG 442

Query: 431 DSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXX 490
           DS +H+GIIGSLCLLGFGAG FTY TQASIQA+ ++H ++AV+T+LYLA YNI       
Sbjct: 443 DSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIGSAFGSS 502

Query: 491 XXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILC 550
                WTN+LP  ISK I++ TLAA+AYGSPFTFI T TWGTP+R+A+V +YR VQKILC
Sbjct: 503 VSGAVWTNILPKEISKRISDPTLAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILC 562

Query: 551 IIGLCFCIPLLCAALFLRNHRLEDVVAL---NELDEKNVKE 588
           IIGL FC PLL  A  LRNH+L D +AL   + L+ KN  E
Sbjct: 563 IIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESKNTFE 603

>Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)
          Length = 628

 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/579 (65%), Positives = 446/579 (77%), Gaps = 1/579 (0%)

Query: 25  STDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXX 84
           +T   + S I + D GV NIE+YAE Y +P YRV LFFSLFL+AYAYGLDGNIR      
Sbjct: 38  TTSSPAPSYIELIDPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAY 97

Query: 85  XXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQAT 144
                    LLSTVNCIKTVIAA GQI+FAR SDIFGR +++I++++FY VGTIIESQA 
Sbjct: 98  ATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAV 157

Query: 145 NVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSA 204
           N+ RF  GGCFYQ+G TG +LI+EVIA+DFSNLNWRLLALF+PALPFIINTWISGDVTSA
Sbjct: 158 NITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSA 217

Query: 205 VGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFI 264
           +G +WKWGIGMWAFI PLACIPLG CMLHMRYLA K++KD+L          +WK  F I
Sbjct: 218 IGTNWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKS-FCI 276

Query: 265 DVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWE 324
           D+ FWKLD+IG+LL+  FFGCVLVPFTLAGG+  EWK+AHIIVPEVIGWVV LPLY+LWE
Sbjct: 277 DIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWE 336

Query: 325 MKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITS 384
           MK+S+HPLTPW L+KDRG+F AL+IA  INF WYMQGDYMYTVLVVAVHES+KSATRITS
Sbjct: 337 MKYSRHPLTPWDLIKDRGIFFALLIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITS 396

Query: 385 LYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCL 444
           LYSFVS           IKVRRTKPFIIFGIS W V+FGLL+ YRGDS +H+GIIGSLCL
Sbjct: 397 LYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCL 456

Query: 445 LGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRI 504
           LGFGAG FTY TQASIQA+ ++H ++AV+T+LYLA YNI            WTN+LP  I
Sbjct: 457 LGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIGSAFGSSVSGAVWTNILPKEI 516

Query: 505 SKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAA 564
           SK I++ TLAA+AY +PFTFI T TWGTP+R+A+V +YR VQKILCIIGL FC PLL  A
Sbjct: 517 SKRISDPTLAAQAYSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCA 576

Query: 565 LFLRNHRLEDVVALNELDEKNVKEDDPVVDFLAKFIPSL 603
             LRNH L D +AL   D    K+     +    F+ S+
Sbjct: 577 FMLRNHELTDSIALEGNDHLKSKDSFETEEKQESFLKSM 615

>SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} similar
           to uniprot|P39980 Saccharomyces cerevisiae YEL065W SIT1
           Ferrioxamine B transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 611

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/595 (65%), Positives = 470/595 (78%), Gaps = 7/595 (1%)

Query: 12  EEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAY 71
           E  +A K+T+S+ ++D S G     KDAGV NIE+YA+QYK PYYRV LFFS+FLVAYAY
Sbjct: 12  EGSVAPKDTWSIKTSD-SKG-----KDAGVHNIEIYADQYKSPYYRVALFFSIFLVAYAY 65

Query: 72  GLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAIL 131
           GLDGNIR               L+STVNCIKTVIAAAGQI FARASD+FGRL++LIIA+L
Sbjct: 66  GLDGNIRYTFQAYATSSYSQHSLISTVNCIKTVIAAAGQICFARASDVFGRLSILIIAVL 125

Query: 132 FYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPF 191
           FYVVGT+IESQATNV+RF AG CFYQ+G TG +LI+EVI  DFSNLNWRL+A FVPALPF
Sbjct: 126 FYVVGTVIESQATNVSRFAAGACFYQLGLTGIILILEVIVMDFSNLNWRLVASFVPALPF 185

Query: 192 IINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSKDKLAKHVM 251
           IINTWISGDVTSA+G +W+WGI MWAFI PL+CIPL CCMLHMRYLA+KN+ + L     
Sbjct: 186 IINTWISGDVTSAIGTNWEWGIAMWAFILPLSCIPLVCCMLHMRYLAHKNAPENLMSEFK 245

Query: 252 VPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVI 311
           + K   W  Y  +++ FWKLD +GLLL+   FG VL+PFTLAGG+ ++WK+A IIVPEV+
Sbjct: 246 LYKQMPWSEYL-VEIFFWKLDFLGLLLLCVSFGLVLIPFTLAGGLQTKWKSASIIVPEVL 304

Query: 312 GWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVA 371
           GW + LPL++LWE K++++PLTPW L+KDRG+FSALIIA +INF WYMQGDYMYTVL+VA
Sbjct: 305 GWCLALPLFLLWEGKYARNPLTPWDLIKDRGIFSALIIAFLINFIWYMQGDYMYTVLIVA 364

Query: 372 VHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGD 431
           VHES+KSATRI SLYSFVS           +KVRRTKPFI+FG+  WF++FGLL+ YRGD
Sbjct: 365 VHESIKSATRIVSLYSFVSVITGTLLGFVIVKVRRTKPFILFGVCCWFLSFGLLVHYRGD 424

Query: 432 SASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXX 491
           S +HAGI+GSLCLLGFGAGFFTYTTQASIQA+T SHQ +AVITALYLA YNI        
Sbjct: 425 SGAHAGIVGSLCLLGFGAGFFTYTTQASIQASTGSHQNMAVITALYLATYNIGSAVGNAV 484

Query: 492 XXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCI 551
               WTNVLP ++SK +++  +A+ AYGSPFTFIIT TW T +R AVV AYR VQKILC 
Sbjct: 485 SGAIWTNVLPQQLSKRLSDPEMASAAYGSPFTFIITYTWETLERQAVVHAYRHVQKILCT 544

Query: 552 IGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKEDDPVVDFLAKFIPSLRNK 606
           +G+CFC+PL+ AAL LRNH+LE VVAL++LDEKN  +D+   +FL KF PS R+ 
Sbjct: 545 VGVCFCVPLVLAALLLRNHKLESVVALDDLDEKNRVDDNENGNFLTKFFPSSRSN 599

>TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/585 (64%), Positives = 452/585 (77%), Gaps = 6/585 (1%)

Query: 4   ESSHSNQGEEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFS 63
           +S    Q + +I  K T    S+D +     S  DAGV NIEVYAEQY  P +R  LFFS
Sbjct: 21  KSDAEMQKDLDIEPKLTAVSSSSDDAE----SHVDAGVHNIEVYAEQYSSPIHRFALFFS 76

Query: 64  LFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRL 123
           +FLVAYAYGLDG +R               LLSTVNCI TVIAAAGQI +ARASDIFGR+
Sbjct: 77  IFLVAYAYGLDGQVRYTYQSYATSSYAQHSLLSTVNCITTVIAAAGQICYARASDIFGRM 136

Query: 124 TMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLA 183
           T+L+I ++FY +GTIIESQATNV+RF AG CFYQ+GYTG +L +EVIA DFSNLNWRLLA
Sbjct: 137 TILVIGVIFYSMGTIIESQATNVSRFAAGSCFYQLGYTGIVLTLEVIAADFSNLNWRLLA 196

Query: 184 LFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSK 243
            FVPALPFIINTWISG+VTSAV G+WKWGIGMWAFI PL+ IPLGCC+LHMRYLA KN+ 
Sbjct: 197 SFVPALPFIINTWISGNVTSAVNGNWKWGIGMWAFILPLSAIPLGCCLLHMRYLAKKNAG 256

Query: 244 DKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTA 303
           D+L K   +     WK+ F +++LFW+LD IGLL++   FGC+L+PFTLAGG+ SEW+TA
Sbjct: 257 DRLLKEASLIGTLGWKK-FIVEILFWRLDFIGLLMLCVTFGCILIPFTLAGGLQSEWQTA 315

Query: 304 HIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDY 363
           HIIVPEVIGW + LPL++LWE+KFS+HPLTPWAL+KDRG+  A+ IA  INFCWYMQGDY
Sbjct: 316 HIIVPEVIGWCLALPLFLLWEIKFSRHPLTPWALIKDRGIIFAIFIAFHINFCWYMQGDY 375

Query: 364 MYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFG 423
           MYTVL+V+VHESVKSATRITSLYSFVS            K+RRTKPFI+FG+  WF+AFG
Sbjct: 376 MYTVLIVSVHESVKSATRITSLYSFVSVITGTILGMFITKIRRTKPFIVFGVVCWFIAFG 435

Query: 424 LLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNI 483
           LL+ YRGD+ SH+GIIGSLCLLGFGAGFFTYTTQASIQA+ +SH K+AVITALYLA YNI
Sbjct: 436 LLVHYRGDNNSHSGIIGSLCLLGFGAGFFTYTTQASIQASAKSHSKMAVITALYLATYNI 495

Query: 484 XXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYR 543
                       WTN+LP  ISK + N+TLAA AY SP++FII  TWGTP+R AVV AYR
Sbjct: 496 GSSVGAAVSGAIWTNILPKEISKRLNNETLAALAYSSPYSFIIDYTWGTPERDAVVLAYR 555

Query: 544 DVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKE 588
             Q+ILCI+GLCFC  LL +ALFLRNH+L   V++++ ++  V+E
Sbjct: 556 YTQRILCIVGLCFCTTLLISALFLRNHKLVSSVSIDK-EQTKVEE 599

>Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL065W
           (SIT1) - Ferrioxamine B permease [contig 8] FULL
          Length = 591

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/554 (63%), Positives = 425/554 (76%), Gaps = 1/554 (0%)

Query: 37  KDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLS 96
           KDAGV NIEVYA+QY    YR+LLFFSLFLVAYAYGLDG +R               LLS
Sbjct: 23  KDAGVNNIEVYADQYSHIGYRILLFFSLFLVAYAYGLDGMVRYNFQAYATNSYGSHSLLS 82

Query: 97  TVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFY 156
           TVNCIK VIAAAGQ+ FARA+DIFGR++++I++ILFYVVGTII+SQAT V+++ AG C Y
Sbjct: 83  TVNCIKAVIAAAGQLCFARAADIFGRISIIIVSILFYVVGTIIDSQATTVSKYAAGACIY 142

Query: 157 QVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMW 216
           Q+GYTG +LI+E+IA DFSNLNWRLLA FVPA+PFIINTWISGDV SAVG +WKWGIGMW
Sbjct: 143 QLGYTGIILILEIIAMDFSNLNWRLLASFVPAIPFIINTWISGDVVSAVGANWKWGIGMW 202

Query: 217 AFIFPLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGL 276
           AFIFPL+ +PL  CM HMRYLA + + D+L   V + K   W  Y   +V FW+LD +GL
Sbjct: 203 AFIFPLSALPLLGCMFHMRYLARRRASDRLVTEVSLYKHMSWSTYL-TEVFFWRLDAVGL 261

Query: 277 LLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWA 336
           +++   FGC+L+PFTLAG +  +W+TA IIVPEVIGW V LPL++LWEMKF+KHPL PW 
Sbjct: 262 IMVCVVFGCILIPFTLAGSLKDKWQTAEIIVPEVIGWCVALPLFLLWEMKFAKHPLVPWN 321

Query: 337 LLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXX 396
           ++KDRG++SALIIA  INF WYMQG +MYTVL++AV+ESVKSATRITSLYSFVS      
Sbjct: 322 VIKDRGIWSALIIAIHINFIWYMQGSFMYTVLIIAVNESVKSATRITSLYSFVSVLTGLG 381

Query: 397 XXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTT 456
                  +R+TK FI+FGI  W V+FGLLI YRGDS+SH+GIIG+ CLLGFGAGFFTYTT
Sbjct: 382 LGFVIAYIRKTKKFIMFGIGCWVVSFGLLIHYRGDSSSHSGIIGAQCLLGFGAGFFTYTT 441

Query: 457 QASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAE 516
           Q SIQA+ ++HQ +AVITALYL+ YNI            WTN+LP  + K I + T  A 
Sbjct: 442 QTSIQASAKTHQDMAVITALYLSFYNIGSALGSSVSGAIWTNILPRELRKRITDPTTYAL 501

Query: 517 AYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVV 576
           AYGSPFTFIIT  WGTP+R AVVK+Y+ VQK+LC++G+CFC  L+ +ALFLR+HRL D V
Sbjct: 502 AYGSPFTFIITYVWGTPEREAVVKSYQYVQKLLCVVGICFCATLIASALFLRDHRLGDSV 561

Query: 577 ALNELDEKNVKEDD 590
           AL + DEK     D
Sbjct: 562 ALEDEDEKFSINSD 575

>TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {ON} 
          Length = 601

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/599 (61%), Positives = 444/599 (74%), Gaps = 6/599 (1%)

Query: 9   NQGEEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVA 68
            Q + E A  E  S    D  +G E   KDAGV NIEV+  QY    YR++LFFS+FL++
Sbjct: 8   EQTKFETANSELSSHTHED--AGEE---KDAGVHNIEVFTAQYDHIGYRLMLFFSIFLIS 62

Query: 69  YAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLII 128
           YAYGLD NIR               LL+TVNCI  VIAA GQ+ FARA+DIFGR T+LI+
Sbjct: 63  YAYGLDQNIRYTLQTYATNSYSQHSLLATVNCIIAVIAAPGQVCFARAADIFGRFTVLIV 122

Query: 129 AILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVPA 188
           A++FYV+GTIIESQATNV+RF AG CFY++G TG ML++EVIA DFSNLNWRLLA FVPA
Sbjct: 123 AVIFYVMGTIIESQATNVSRFAAGACFYRLGITGLMLMMEVIAMDFSNLNWRLLASFVPA 182

Query: 189 LPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSKDKLAK 248
           LPFIINTWISG+V +A+G +WKWGIGMWAFI PL+CIPLG CMLHMRYLA+KN+KD+L  
Sbjct: 183 LPFIINTWISGNVLTAIGTNWKWGIGMWAFILPLSCIPLGFCMLHMRYLAHKNAKDQLRS 242

Query: 249 HVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVP 308
              + K   W  Y  ++V FW+LD  GL+L+   FGC+L+PFTL GG+N +WKTA IIVP
Sbjct: 243 EFKLFKTMSWYEYI-VEVFFWRLDFPGLILICVTFGCILIPFTLGGGLNEKWKTAGIIVP 301

Query: 309 EVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVL 368
           EVIGWVV LPLY++WE K+++HPLTPW L+KDRG+FSALIIA  INF WYMQGDYM+TVL
Sbjct: 302 EVIGWVVALPLYMIWESKYARHPLTPWKLIKDRGIFSALIIAFHINFIWYMQGDYMFTVL 361

Query: 369 VVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRY 428
            VAV+ES  SA RITSLYSFVS           +KVRRTK FI+FGI  WF++FGLL+ +
Sbjct: 362 RVAVNESNSSAQRITSLYSFVSVITGTLLGLVIVKVRRTKKFILFGIVCWFISFGLLVHF 421

Query: 429 RGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXXX 488
           RGDS+SH+GIIGSLCL+GFGAGFFTYTTQASIQA+T+ H+ LAVIT+LYLA YNI     
Sbjct: 422 RGDSSSHSGIIGSLCLMGFGAGFFTYTTQASIQASTKHHENLAVITSLYLATYNIGSAVG 481

Query: 489 XXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKI 548
                  WTNVLP  I K + + TL  +AY  P TFI+T TW T +R AVV AYR  QK+
Sbjct: 482 AAVSGAIWTNVLPKEIGKRLNDATLTQQAYLEPLTFILTYTWETIERQAVVLAYRYTQKV 541

Query: 549 LCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKEDDPVVDFLAKFIPSLRNKK 607
           LCI+GLCFC PLL +A  LR+HRL DV+AL +LDEKN+ ED+    F  K+    R  +
Sbjct: 542 LCIVGLCFCAPLLFSAFLLRDHRLGDVIALEDLDEKNLAEDEESGKFWGKYFRFARKHE 600

>KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 615

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/590 (60%), Positives = 440/590 (74%), Gaps = 5/590 (0%)

Query: 7   HSNQGEEEIAQKETYSVH-STDISSGSEISI---KDAGVQNIEVYAEQYKKPYYRVLLFF 62
           HS +      +K +   H + D    +E  +   KDAGV NIEVYA QY    YRV LFF
Sbjct: 9   HSGKNSRNKLKKMSLEGHPAKDAKDHAEQILARRKDAGVNNIEVYAAQYSHFAYRVALFF 68

Query: 63  SLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGR 122
           SLFLVAYAYGLDG +R               LL+T+NC+K VIAAAGQI FARASDIFGR
Sbjct: 69  SLFLVAYAYGLDGMVRSSLQAYATSSYGSHSLLATINCVKAVIAAAGQICFARASDIFGR 128

Query: 123 LTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLL 182
           +T+L +A++ Y VGTII+SQATN+ R+ AG C YQ+GYTG +LI+E+IA DFSNLNWRL+
Sbjct: 129 MTILALAVVLYAVGTIIDSQATNITRYAAGACIYQLGYTGIILILEIIAMDFSNLNWRLM 188

Query: 183 ALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNS 242
           A FVPALPFIINTWISG+   A+G +WKWGIGMWAFI PL+C+PL  C+LHMR+LA+KN+
Sbjct: 189 ASFVPALPFIINTWISGNALEALGMNWKWGIGMWAFIVPLSCVPLFACILHMRFLAHKNA 248

Query: 243 KDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKT 302
           KD+L   V++ K   W +Y  ++V FW+LD++GLLL+   FGC+LVPFTLAG + S+WK 
Sbjct: 249 KDQLESEVLLYKHMPWSQYL-VEVFFWRLDLLGLLLVCVVFGCILVPFTLAGSLQSKWKR 307

Query: 303 AHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGD 362
           A IIVPEVIGW V LPL++LWE K+S+HPL PW+L+KDRG++SALIIA  INF WYMQGD
Sbjct: 308 AEIIVPEVIGWCVALPLFLLWEGKYSRHPLVPWSLVKDRGIWSALIIAIHINFVWYMQGD 367

Query: 363 YMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAF 422
           YMYTVL+VAV+E+ KSA RITSLYSFVS           +  RRTK FI+FGI+ WFVAF
Sbjct: 368 YMYTVLMVAVNETAKSAARITSLYSFVSVITGFLLGGVIVYARRTKKFILFGIACWFVAF 427

Query: 423 GLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYN 482
           GLL+ YRGDS+SH+GI+GSLCLLGFGAGFFTYTTQ SIQA+T+SHQ +AVITALYL+ YN
Sbjct: 428 GLLVHYRGDSSSHSGIVGSLCLLGFGAGFFTYTTQTSIQASTKSHQDMAVITALYLSHYN 487

Query: 483 IXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAY 542
           I            WTN+LP  + K I +      AYGSPF FI    WGTP+RM VV AY
Sbjct: 488 IGSALGASISGAIWTNILPRELRKRITDVATYTLAYGSPFVFIEEYLWGTPERMEVVAAY 547

Query: 543 RDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKEDDPV 592
           R VQ+IL I+GLCFC+ LL +A FLR+HRLE+ VAL ++DEK+ ++ D +
Sbjct: 548 RVVQRILSIVGLCFCVTLLLSAFFLRDHRLENAVALEDVDEKSSRKSDEL 597

>Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {ON}
           YEL065W (SIT1) - Ferrioxamine B permease [contig 5] FULL
          Length = 603

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/549 (59%), Positives = 415/549 (75%), Gaps = 1/549 (0%)

Query: 37  KDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLS 96
           KDAGV+NI+VYA+QY   +YRV LFFSLFLVAY+Y LDG +R               LLS
Sbjct: 26  KDAGVKNIKVYADQYNNVFYRVALFFSLFLVAYSYRLDGLVRGKLETYATDSYGHHSLLS 85

Query: 97  TVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFY 156
           TVNCIKTVI AAG I +ARASDIFGR+TML IA+L YVVGTI+E Q+  V++F  G   +
Sbjct: 86  TVNCIKTVIGAAGLIAYARASDIFGRMTMLAIAVLLYVVGTIVECQSNTVSKFATGASIF 145

Query: 157 QVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMW 216
           Q+G  G +L+++VIA DFS LNWR++AL+VPALP IINTW+SGD+  A+ G+WKWGIGMW
Sbjct: 146 QLGKAGIVLLLQVIAMDFSTLNWRMVALYVPALPIIINTWVSGDIIKAINGNWKWGIGMW 205

Query: 217 AFIFPLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGL 276
           AFI PLAC+PL  C++HMRYLA+KN KD+L     + K+  W  Y   +V FW+LD++GL
Sbjct: 206 AFILPLACLPLFGCLIHMRYLAHKNCKDQLVNEWELYKNTSWPAYL-KEVFFWRLDILGL 264

Query: 277 LLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWA 336
           +L+    GCVL+PFTLAGG++ +WK+AHIIVPEVIGW V  PL++LWE K+++HPLTPW 
Sbjct: 265 ILITAGLGCVLIPFTLAGGLSDKWKSAHIIVPEVIGWCVAFPLFVLWEKKYARHPLTPWR 324

Query: 337 LLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXX 396
           LLKDRGV SA+II   I+F  YMQ DYMYTVLVVAV+ESVKSA RIT+L++FV+      
Sbjct: 325 LLKDRGVISAIIIGFHIHFVVYMQADYMYTVLVVAVNESVKSAQRITTLFNFVTIITGTL 384

Query: 397 XXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTT 456
                  V+RTK FI+FGI +WFVAFGLLIRYRGDS+SH+GI+G+LCLLGFG GFF Y T
Sbjct: 385 LGFVIAYVKRTKKFILFGICIWFVAFGLLIRYRGDSSSHSGIVGALCLLGFGGGFFNYAT 444

Query: 457 QASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAE 516
           Q S+ A+T SHQ +AVIT+LYLA+YN+            WTNVLP ++ K I++ ++A  
Sbjct: 445 QVSLHASTSSHQDMAVITSLYLASYNVGSAVASAVAGAIWTNVLPKQLHKRISDASIANI 504

Query: 517 AYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVV 576
           AY SPF FI    WG+P+R+AV++AY+ VQKILC +GLCFC+ LL AALFLR+ +LE VV
Sbjct: 505 AYSSPFKFIKKYKWGSPERIAVMQAYQVVQKILCTVGLCFCVTLLVAALFLRDKKLESVV 564

Query: 577 ALNELDEKN 585
           AL + +EK 
Sbjct: 565 ALEDAEEKE 573

>KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 624

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/594 (55%), Positives = 426/594 (71%), Gaps = 3/594 (0%)

Query: 1   MSLESSHSNQGEEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLL 60
           MSL+    N+G EE  ++   ++  +  +  +    KD GV+NIEVYA QY    YRV L
Sbjct: 1   MSLKMLGFNKGPEE--KEAGDAMERSRRADEALRRQKDVGVKNIEVYAAQYDHVAYRVAL 58

Query: 61  FFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIF 120
           FFSLFL+AYAY LDG +R               LLSTVNCIKTV+AA G + +ARASD+F
Sbjct: 59  FFSLFLIAYAYRLDGLVRSKLEAYATDSYGNHSLLSTVNCIKTVMAAGGMVAYARASDMF 118

Query: 121 GRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWR 180
           GR+ ML I+I+  VVGTI+E Q+  V++F  G C YQ+G  G  LI++VIA DFSNLNWR
Sbjct: 119 GRMEMLAISIVLVVVGTIVECQSDTVSKFATGACLYQLGKAGLALILQVIAVDFSNLNWR 178

Query: 181 LLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANK 240
           ++AL+VPALP IINTW+SGDV SA+G DW+WGIGMWAFI PL+CIPL CC++HMRYLA+K
Sbjct: 179 MVALYVPALPTIINTWVSGDVISAIGSDWEWGIGMWAFIIPLSCIPLFCCLVHMRYLAHK 238

Query: 241 NSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEW 300
           ++ ++L K   +     W  Y  I+V FW+LD +GL+L+V   GCVLVPFTLAGG++ +W
Sbjct: 239 HAPEQLGKQRQLYSMASWSEYL-IEVFFWRLDSVGLILVVGALGCVLVPFTLAGGLSDKW 297

Query: 301 KTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQ 360
           +TA IIVPEVIGW V LPL++LWE KF++ PLTP ++LKDRGV +AL+IA  I+FC YMQ
Sbjct: 298 RTAQIIVPEVIGWCVALPLFVLWEAKFARFPLTPRSVLKDRGVIAALVIAFHIHFCVYMQ 357

Query: 361 GDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFV 420
            DYMYTVLV+AVHESVK+A RIT+L++FVS           + V+RTK FI+FG+ +WFV
Sbjct: 358 ADYMYTVLVIAVHESVKAAQRITTLFNFVSIITGTLLGFVIVYVKRTKKFILFGVCVWFV 417

Query: 421 AFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAA 480
           AFGLL+ +RGD +SH+GIIG+LCLLGFG GFF Y+ Q S+QA+T +HQ LAV+T+LYLA 
Sbjct: 418 AFGLLVHFRGDESSHSGIIGALCLLGFGGGFFNYSAQVSMQASTAAHQDLAVVTSLYLAC 477

Query: 481 YNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVK 540
           YNI            WTNVLP  ++K I  + +A  AY SPF FII   WGTP R+AVV 
Sbjct: 478 YNIGSAFASAISGAIWTNVLPKELNKRITEKQVATLAYSSPFKFIIKYKWGTPQRVAVVH 537

Query: 541 AYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKEDDPVVD 594
           AY+ VQ+ILCI+ LCFC+ LL AA  LR+ +L +VVAL EL+  + +      D
Sbjct: 538 AYQKVQRILCIVPLCFCVTLLIAAFLLRDKKLSEVVALGELEHGHSESASSTGD 591

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/596 (53%), Positives = 414/596 (69%), Gaps = 19/596 (3%)

Query: 12  EEEIAQKETYSVHSTDISSGSEISI---------------KDAGVQNIEVYAEQYKKPYY 56
           +E I Q ET  +HS + SS   +S                + AGV N EVYA+ Y  P  
Sbjct: 6   DENIKQNET--IHSEEFSSNITVSSITTNSLNGEKEPHLEESAGVYNSEVYAKYYSSPTR 63

Query: 57  RVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARA 116
           R ++F  LF + YAYGLD  +R               LLSTVN IK+VI+AAGQIWFARA
Sbjct: 64  RSIVFLCLFFICYAYGLDNKLRSPYQTLATSSYKQHSLLSTVNAIKSVISAAGQIWFARA 123

Query: 117 SDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSN 176
           SD+FGR T+LI+A++FYVVGTI+ESQA +V++F AG C +Q+GY G +++V+++ +DFSN
Sbjct: 124 SDLFGRGTILIVAVMFYVVGTIVESQAVDVSKFAAGACLFQLGYDGVVMMVQILVSDFSN 183

Query: 177 LNWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRY 236
           LNWR+ A+  P LP +INTW+SGD+ SAV  +WKWGIGMWAFIFPL+CIP G  +LHM+Y
Sbjct: 184 LNWRVTAVAFPVLPNVINTWVSGDIASAVDENWKWGIGMWAFIFPLSCIPFGILLLHMKY 243

Query: 237 LANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGM 296
           LA KN+ D L      P+D  WK+Y   ++  WKLD IGLLL V FFG VLVPFTLAGG+
Sbjct: 244 LARKNN-DTLKSSFDKPEDITWKQYL-TEIFLWKLDFIGLLLAVAFFGLVLVPFTLAGGL 301

Query: 297 NSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFC 356
           N +WKTA IIVPEV+GWVV  P ++ WE+KF+K+PLTPW  +KDRGVFSALIIA  +   
Sbjct: 302 NKKWKTARIIVPEVLGWVVAFPAFLTWEIKFAKYPLTPWKTVKDRGVFSALIIAIFLQTA 361

Query: 357 WYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGIS 416
           +YMQ  YMYT+L+VAV+++ KSATRI SL++FV+           +KVRRTK FI FGI+
Sbjct: 362 FYMQKTYMYTILLVAVNQTKKSATRINSLFTFVTALSGTLLGLVIVKVRRTKEFIFFGIA 421

Query: 417 MWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITAL 476
           +WF++FGLL RY G + ++AGII +LCLLGFG GF  Y T+AS+QA+  +H+ +A+IT+L
Sbjct: 422 VWFLSFGLLERYTGGTNAYAGIIAALCLLGFGNGFIKYPTKASMQASALTHEMMAIITSL 481

Query: 477 YLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRM 536
           ++A   I            WTNVLPD+I K + N TLA  AY SP  FI+   W +P+R 
Sbjct: 482 FMAISTIGTSVGSSVAGAIWTNVLPDKIEKGLNNSTLANFAYNSPTKFILQYNWESPERQ 541

Query: 537 AVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKEDDPV 592
            VV AY+ V+KIL I+GLCF +PLL  A  LRN RLED VAL++++ KN K++  V
Sbjct: 542 IVVNAYKHVEKILIIVGLCFLVPLLGGAFLLRNQRLEDAVALDKVEPKNEKKEMEV 597

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/596 (51%), Positives = 405/596 (67%), Gaps = 5/596 (0%)

Query: 1   MSLESSHSNQGEEEIAQKE---TYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYR 57
           M +   H+ +   E    E   + +  S  ISS S+      GV N+E+YA+ Y  P  R
Sbjct: 1   MEINIKHNQKENTEFEYSEELPSSTSESDHISSHSDAESDKFGVHNVEIYAKYYSTPVKR 60

Query: 58  VLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARAS 117
            L+FFSLF +AYAYGLD ++R               LLSTV+CIK VI+AA QIWFAR++
Sbjct: 61  FLIFFSLFTIAYAYGLDNSVRGTYQTLATSSYNQHSLLSTVSCIKAVISAAAQIWFARSA 120

Query: 118 DIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNL 177
           D+FGR T+L+I+I+FYVVGT++ESQA +V++F AG C Y VG++  +L  EV   DFSNL
Sbjct: 121 DMFGRTTILMISIVFYVVGTVVESQAVDVSKFAAGACLYAVGHSAIVLFSEVYVADFSNL 180

Query: 178 NWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYL 237
           NWR+ A   P LP +INTWISGD+T+A+  +WKWGIGMWAFIFPL+CIP+G C+LHM+YL
Sbjct: 181 NWRVTAAAAPLLPNVINTWISGDITAAIDENWKWGIGMWAFIFPLSCIPMGACILHMKYL 240

Query: 238 ANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMN 297
           A KN KD L      P+   W +Y  +DV FWKLD++GLLL+V  FG +L+PFTLAGG  
Sbjct: 241 AKKN-KDDLKVAFKKPEHYTWSQYL-VDVFFWKLDLVGLLLLVAIFGMILIPFTLAGGEE 298

Query: 298 SEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCW 357
             W TA IIVPEV+GW   LPL+++WE+KF+++PLTP   LK+RG+ SAL++   + F +
Sbjct: 299 KVWSTARIIVPEVLGWAFALPLFLVWEIKFARYPLTPKDALKNRGIVSALVLVLFLQFAY 358

Query: 358 YMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISM 417
            MQ  Y+YTVL+VAV ES KSATRI  L+SFVS            KVRRTK FI FGI +
Sbjct: 359 QMQSTYLYTVLLVAVDESKKSATRINKLFSFVSVITGFLSGFVVAKVRRTKEFIFFGIGV 418

Query: 418 WFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALY 477
           WF++FGL+IRY G   SH GII + C+LGFG GF  +  +ASIQA+  SH+ +AV+T+L+
Sbjct: 419 WFISFGLMIRYTGGLDSHVGIIVARCILGFGNGFLKFPARASIQASAYSHEMMAVMTSLF 478

Query: 478 LAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMA 537
           LA  +I            WTNVLP +IS+ I N+TLA  AYGSP  FI+   W TP+R A
Sbjct: 479 LAVSSIGSAFGDAVAGSIWTNVLPGKISEGITNETLADYAYGSPTKFILKYKWDTPERQA 538

Query: 538 VVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKEDDPVV 593
           VV+AY+ + ++L I+G+C  +PLL +A FL+N RLEDVV+ ++ D+ N +  +  V
Sbjct: 539 VVEAYKVIGRLLNIVGICLLVPLLISAFFLKNRRLEDVVSFDKFDKMNSENAEDSV 594

>TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/565 (49%), Positives = 382/565 (67%), Gaps = 3/565 (0%)

Query: 29  SSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXX 88
           +S SE  +   GV N ++Y + Y +PY R+++FFSLFL+ YAYGLD   R          
Sbjct: 37  TSDSENEVLSPGVHNAKIYGKYYTEPYQRIMIFFSLFLICYAYGLDKKTRTTYVTLATSS 96

Query: 89  XXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVAR 148
                L+STV CI  VI+AAGQIWFARASDIFGR  +  ++++FYV+GT+IESQAT ++R
Sbjct: 97  YKEHSLMSTVTCITKVISAAGQIWFARASDIFGRKLIFGLSVIFYVIGTVIESQATEISR 156

Query: 149 FTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGGD 208
           +  G C Y +G+ G +L  E+ A DFSNLNWR++A   P LP IINTW+SG++T+ V  +
Sbjct: 157 YAGGECLYGLGHAGIVLTTELYAADFSNLNWRVVAAAAPMLPNIINTWVSGNITADVDEN 216

Query: 209 WKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLF 268
           WKWGIGMWAFIFP++C+PL  C+LHMRY A KN+++ L    + P +  +K Y  +DV F
Sbjct: 217 WKWGIGMWAFIFPISCLPLIGCLLHMRYKAQKNNEE-LKPVFVKPSNMSYKEYL-VDVFF 274

Query: 269 WKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFS 328
           WK D+IGL+L+V  FG VLVP TLAGG+N +W  A IIVPEV+GW + LPLY+ WE KF+
Sbjct: 275 WKSDIIGLILLVGVFGLVLVPITLAGGLNKKWNEAQIIVPEVLGWTLALPLYVFWENKFA 334

Query: 329 KHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSF 388
           K+P+     ++D G++SAL I+  I+FC+YM   Y+ T L+VAV+ES KSATRI SL +F
Sbjct: 335 KYPIIKLETVRDSGIWSALSISLFIDFCFYMHETYLVTFLLVAVNESKKSATRINSLSTF 394

Query: 389 VSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFG 448
           V+           +++RRTK  I+FG  +WFVA GL I Y G   SH+G+IG++CLLGFG
Sbjct: 395 VTVITGFFLGLAIVRIRRTKISIVFGTLVWFVAHGLFIEYNGGLRSHSGLIGAICLLGFG 454

Query: 449 AGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAI 508
            GF  +  +ASIQ +  +H+KLA++T+L+LA  +I            W+NVLP +I   I
Sbjct: 455 NGFIRFPVRASIQVSVGTHEKLAIVTSLFLAVGSIGTAIGSAVAGAIWSNVLPGQIESRI 514

Query: 509 ANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLR 568
           +N T+AA AY SP TFI    WGT  R AVV AY  V KIL I GL   +PLL +ALFLR
Sbjct: 515 SNATIAASAYSSPTTFIKKYKWGTEYRTAVVSAYGYVWKILNITGLVLVLPLLISALFLR 574

Query: 569 NHRLEDVVALNEL-DEKNVKEDDPV 592
           + +LE V+A +E+ D +   E++ V
Sbjct: 575 DRKLESVLAFDEVTDTEGYSENEKV 599

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/579 (48%), Positives = 386/579 (66%), Gaps = 11/579 (1%)

Query: 13  EEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYG 72
           +E A+ E+ SVH+      SE  + +    N  +Y + Y  P    +L+FSLFL+AYAY 
Sbjct: 16  DEDAKIESISVHT-----DSENIVTNIAAHNARIYVKYYSTPLRVTILYFSLFLLAYAYN 70

Query: 73  LDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILF 132
           L  ++R               LL+TV CI  VI+AAGQIW+ARASDIFGR  +LI++ILF
Sbjct: 71  LHKDVRGTYQTLATSSYSKHSLLATVQCINQVISAAGQIWYARASDIFGRTPILILSILF 130

Query: 133 YVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPFI 192
           Y +GT+IESQAT+++++ AG C Y +GY G++L+ +V+ +D+S L WRL++  V  LP I
Sbjct: 131 YFIGTLIESQATDISKYAAGSCIYALGYAGSVLVTQVLVSDYSTLKWRLVSSTVLFLPNI 190

Query: 193 INTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSKD-KLAKHVM 251
           INTW+ G++T  VG  W+WG GMWAFIFPLA IPL CC+ HM+YLA KN +D KL   + 
Sbjct: 191 INTWVGGNITEDVGNRWQWGFGMWAFIFPLASIPLLCCLAHMKYLAIKNKEDVKLT--IS 248

Query: 252 VPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVI 311
            P+   W R+ + D+ FWKLDM+GL+L+V FF  +LVP TLA G++  W +A  IVPEV+
Sbjct: 249 KPRSISWARHLY-DIFFWKLDMLGLILLVAFFALILVPLTLAKGLHEGWGSAKFIVPEVL 307

Query: 312 GWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVA 371
           GW + LPL++ WE+KF+ +P+TP  L+KDRG++  + ++  + F + +   Y+YTVLVVA
Sbjct: 308 GWALALPLFLTWELKFASNPITPLDLIKDRGIYGGIGVSLFLEFVYDIGSTYLYTVLVVA 367

Query: 372 VHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGD 431
           V+ES KSATRITSL++FVS           +KVRRTK FIIFGI+MW++A+GL   YRG 
Sbjct: 368 VNESTKSATRITSLFTFVSVLTAFFLGFVVVKVRRTKEFIIFGIAMWYIAYGLFEHYRGG 427

Query: 432 SASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXX 491
           + SHAGII ++C+ GFG GF  +  + S QA+ ++H +LA+ T+LYLAA +I        
Sbjct: 428 AESHAGIIAAVCVHGFGNGFIKFPVRVSTQASAKTHDRLAIATSLYLAAGDIGMAFGSAT 487

Query: 492 XXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCI 551
               WTN+LP +I   I N TLA  AY SP  FI T+ W +P+R A+V AYR +Q++L I
Sbjct: 488 AGAMWTNILPAQIDMVIQNSTLAKIAYESPIKFIRTHKWDSPERQALVVAYRYIQRLLMI 547

Query: 552 IGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKEDD 590
           + LC  IPLL ++ FLRN  L D VA  + D    KE D
Sbjct: 548 VALCLIIPLLLSSFFLRNRALTDTVAFEQTDIP--KESD 584

>NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa]
           {ON} 
          Length = 614

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/596 (47%), Positives = 396/596 (66%), Gaps = 15/596 (2%)

Query: 8   SNQGEEEIAQKETYSVHSTDISSGSEIS------IKDAGVQNIEVYAEQYKKPYYRVLLF 61
           ++ G+ E+  K + ++   ++SS +  S      I+++GV N E+Y + Y  P  R+++F
Sbjct: 20  NDSGKVELTGKAS-AIKINELSSSAASSTIGSEYIENSGVHNAEIYCKYYSHPIKRIMVF 78

Query: 62  FSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFG 121
            SLFL+A+AYGLD ++R               LLSTV CIK VI+AA Q+WFAR++D+FG
Sbjct: 79  SSLFLIAFAYGLDNSVRTTYQTMATSSYSQHSLLSTVTCIKKVISAAAQLWFARSADMFG 138

Query: 122 RLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRL 181
           R T+L I+I+FYV+GTIIE +A +V+R+ AG C + +G+ G +L+ E+   DFSNLNWR+
Sbjct: 139 RPTILTISIIFYVIGTIIECRAFDVSRYAAGACIFSLGHAGIVLVSELYVADFSNLNWRV 198

Query: 182 LALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKN 241
            A     LP +I TWISG++T A+  +W+WGIGMWAFIFPL+C+PL  C++HMRYLA KN
Sbjct: 199 TAAAAQVLPNVITTWISGNITGAIDKNWEWGIGMWAFIFPLSCVPLIICIIHMRYLARKN 258

Query: 242 SKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWK 301
           +++ L      P    WK Y  ID+ FWKLD+IGL+L+V FF  +LVPFTLAG +   WK
Sbjct: 259 NEN-LKVVFQKPNYMTWKEYC-IDIFFWKLDIIGLILLVAFFSLILVPFTLAGSLT--WK 314

Query: 302 TAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQG 361
           +  IIVPEV+GWV+ +PLY++WE+K++++PLTPW  +KDRG+++ LII     F +YMQ 
Sbjct: 315 SPKIIVPEVLGWVLAIPLYLIWELKYARYPLTPWNSIKDRGIWAPLIINLFQEFAYYMQN 374

Query: 362 DYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVA 421
            YM TVL+VAV +S KSATRI   YSFV             KVRRTK FI  GI +WFVA
Sbjct: 375 TYMLTVLLVAVGQSKKSATRIIKFYSFVGVLTAFFLGFVVAKVRRTKEFIALGIGIWFVA 434

Query: 422 FGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAY 481
           FGLL  Y G   + AGII ++C+LGFG GF  +  +ASIQA   SH  + + T+L+ A  
Sbjct: 435 FGLLEHYEGGLGARAGIIAAICILGFGNGFLKFPCRASIQAAANSHAMMGIATSLFQAVG 494

Query: 482 NIXXXXXXXXXXXXWTNVLPDRISKAIANQ-TLAAEAYGSPFTFIITNTWGTPDRMAVVK 540
           +I            W+NVLP  I+K I N  TLA  AYGSP  FI    W T +R AVV 
Sbjct: 495 SIGTAFGSAVAGGIWSNVLPGEINKRITNNSTLATYAYGSPTKFIKQYGWETTERQAVVS 554

Query: 541 AYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDE---KNVKEDDPVV 593
           AY+ V++++ I+GLC  +P+L A++FLRN RLEDVV+ ++LDE   +   +D+ VV
Sbjct: 555 AYKVVERLMAIVGLCLLVPMLVASIFLRNRRLEDVVSFDKLDETFDEKSTDDEEVV 610

>TDEL0B00140 Chr2 (25633..27531) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/606 (49%), Positives = 403/606 (66%), Gaps = 3/606 (0%)

Query: 2   SLESSHSNQGEEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLF 61
           +L+S       +  +       H +D   G +  IK +GV NIE+Y +QY KP Y+V+L+
Sbjct: 24  ALDSGKDGHTSDSNSNVPDAYEHESD-CVGDKKYIKGSGVINIELYKQQYHKPIYKVMLY 82

Query: 62  FSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFG 121
           FS+FLVAY Y LD  +R                L TVNCIKTV+  AGQ  FAR SDIFG
Sbjct: 83  FSIFLVAYVYSLDSLVRFTYQYQTTSKFRDKNQLRTVNCIKTVMGTAGQFGFARCSDIFG 142

Query: 122 RLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRL 181
           R T+L  +I+ Y++GTII+ +AT++++F+AG   YQ+G  G  +++ VIA+DFS+LNWRL
Sbjct: 143 RTTVLNFSIILYIIGTIIQCKATDISKFSAGTILYQLGLIGIQIMLGVIASDFSDLNWRL 202

Query: 182 LALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKN 241
            A FVPALPF+IN WI G +T  +G  W+WGIGM+AFI P ACIPL  C+LHMRYLA KN
Sbjct: 203 FASFVPALPFVINIWICGFITQLIGDRWQWGIGMFAFIMPCACIPLAFCLLHMRYLAYKN 262

Query: 242 SKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWK 301
            + K+     + +   ++ Y  +D+ FW+LD++G  L+   FGC+L+P  LAGG ++ W+
Sbjct: 263 CRGKVQNEFRMYRVLTFRDYI-VDIFFWRLDLVGFGLLCALFGCILIPLVLAGGSSNHWR 321

Query: 302 TAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQG 361
              IIVPEV+GWVV LP+++ WE K +KHPL  W  ++DRG+ +ALIIA  INF +++ G
Sbjct: 322 NFRIIVPEVVGWVVVLPIFLTWEAKGAKHPLLTWDFIEDRGILAALIIAFYINFVYHLLG 381

Query: 362 DYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVA 421
           DY++TVL++ + +SV ++TRITS YSFV            I+ RRTKPFIIFGI  WF+A
Sbjct: 382 DYLFTVLMITLDQSVLASTRITSSYSFVCIICGTLIGLVIIRARRTKPFIIFGIGCWFLA 441

Query: 422 FGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAY 481
            GLL+ + G+     G+ GSLCLLG GAGFFTYTTQASIQA  ++H K+AV+TALYL+ Y
Sbjct: 442 LGLLVHFFGNRPFMPGVTGSLCLLGLGAGFFTYTTQASIQAAIKTHAKMAVVTALYLSIY 501

Query: 482 NIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKA 541
           +I            WTN+LP +I + + N + A  AY SP  FI+ N WG+P R  + +A
Sbjct: 502 SIGSAVGSAISGAIWTNLLPRKIFRTM-NHSDATAAYDSPQLFILNNPWGSPARNGLNEA 560

Query: 542 YRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKEDDPVVDFLAKFIP 601
           Y  VQK+LC++ LCFC+PLL AALFLRNH+L+  VAL  +DEK VKED+   D + K   
Sbjct: 561 YSYVQKMLCVVALCFCVPLLAAALFLRNHKLQSTVALENVDEKQVKEDERRHDLICKIQD 620

Query: 602 SLRNKK 607
             R KK
Sbjct: 621 RRRAKK 626

>NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/576 (48%), Positives = 379/576 (65%), Gaps = 7/576 (1%)

Query: 12  EEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAY 71
           ++EI ++E  SV ST+    S+I+  D GV NIEVY+E Y     R+L FFS+FL  Y Y
Sbjct: 17  KDEIHEQEIDSVSSTE---ESQINY-DTGVINIEVYSEYYSTTQRRLLFFFSIFLTTYCY 72

Query: 72  GLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAIL 131
            LD  +R               L+STV CI TVI+AAGQI +ARA+DIFGR +++  AI 
Sbjct: 73  TLDKRVRSTFQTEATSSYKNHSLMSTVTCITTVISAAGQIAYARAADIFGRTSLVFTAIF 132

Query: 132 FYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPF 191
           FYV+GT++ESQATN+ R+  G CFY +G+   +L +EV+A DFSNLN+R+LA   P LP 
Sbjct: 133 FYVIGTVVESQATNITRYAVGACFYSLGHAAIVLALEVLAADFSNLNYRILASAAPMLPN 192

Query: 192 IINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLAN-KNSKDKLAKHV 250
           +INTWISG++TS +G  W+WGIGMWA IFP+ CIPL  C+ HMRYLA  K+++ +L    
Sbjct: 193 VINTWISGNITSDIGDHWQWGIGMWAIIFPVCCIPLLFCLFHMRYLAQYKHNRRELRSFS 252

Query: 251 MVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEV 310
            +P +     Y FIDV FW+LD++GLLL V FF CVL+PFTLA     +WK+A IIVPEV
Sbjct: 253 TIPPNMTRMEY-FIDVFFWRLDILGLLLGVIFFACVLIPFTLAAKATDKWKSASIIVPEV 311

Query: 311 IGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVV 370
           IGW+V LPLYI WE KF+K PLTPW L+KDRGV+  L+IA  ++F +Y+Q  Y YTVL+V
Sbjct: 312 IGWLVALPLYIFWEWKFAKFPLTPWNLVKDRGVYGGLLIALFLDFAYYVQSTYKYTVLLV 371

Query: 371 AVHESVKSATRITSLYSFVSXXXXXXXXXXXI-KVRRTKPFIIFGISMWFVAFGLLIRYR 429
           +   +V +ATR  ++++FV              K+RRTK FI FGISM+ V+ GLL RYR
Sbjct: 372 SFDTTVLAATRTNNMFTFVGVITANLLGIFVAKKLRRTKGFIFFGISMYIVSTGLLYRYR 431

Query: 430 GDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXX 489
             + +  G I + CLLGFG GF  +  +ASIQA   +H+ LA+IT+L+LA  +I      
Sbjct: 432 IGAHAKVGTIVACCLLGFGNGFLKFPARASIQAAAYTHKNLAIITSLFLALGSIGEGFGS 491

Query: 490 XXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKIL 549
                 W+N +   +SK I+NQT  + AY SP  FI +  W +P+R+ +V+AY  V  IL
Sbjct: 492 SVAGAIWSNRMEVELSKYISNQTAVSLAYESPTKFIKSYKWESPERIGLVQAYSHVTNIL 551

Query: 550 CIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKN 585
            I+ +C CIPL   AL LR+  L DVVA  +LD ++
Sbjct: 552 YIVTICLCIPLYVFALLLRDRELADVVAFEQLDGQD 587

>TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/605 (45%), Positives = 381/605 (62%), Gaps = 24/605 (3%)

Query: 4   ESSHSNQGEEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFS 63
           +++ SN  EE    K   +V ST             GV N+E+YA+ Y  P+ + L++FS
Sbjct: 35  DATESNASEEITTNKLKPAVSST-------------GVYNMEIYAKYYANPFQKFLIYFS 81

Query: 64  LFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRL 123
           LF++ YAYGLDGN+R               L STV CI  V ++AGQIWFARASDIF R 
Sbjct: 82  LFVIYYAYGLDGNVRPTYQTLATSSFNRHSLNSTVTCINRVTSSAGQIWFARASDIFSRE 141

Query: 124 TMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLA 183
             ++I+ILFYVVGTII SQAT+VA++  G C Y +G+ G +L+ E+   DFSNLNWR++A
Sbjct: 142 FSMVISILFYVVGTIISSQATSVAKYAVGACIYGIGHAGIVLLCEIYMADFSNLNWRVVA 201

Query: 184 LFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSK 243
              P LP IINTW+SG++TS +G  W+WG+GMWA IFP +CIPL  C+ HMRY+A KN+ 
Sbjct: 202 ENAPMLPAIINTWVSGNITSDLGSKWQWGLGMWAIIFPASCIPLFVCIYHMRYMAKKNN- 260

Query: 244 DKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTA 303
           +K+ K    P +  WK+Y  ID+  WKLD IGL+L+V  F  +LVPFT +GG++ EW +A
Sbjct: 261 EKIRKIFEKPSEIAWKKYL-IDIFIWKLDFIGLVLLVAVFALILVPFTTSGGLHREWNSA 319

Query: 304 HIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDY 363
           + IVPEV+GWVV LP++ +WE KFS++P+    L+ DRG++SAL I+  I FC Y+   Y
Sbjct: 320 NFIVPEVVGWVVALPIFSVWEWKFSRYPILRLDLISDRGIYSALSISFFIQFCLYVNDTY 379

Query: 364 MYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFG 423
           +YT L+VAV ++ KS TRI SL SFV+           +K+RRT+ FI+ G   WFV +G
Sbjct: 380 LYTFLLVAVDQTTKSGTRINSLMSFVNVITACCLGLFIVKIRRTQIFIVIGCVSWFVVYG 439

Query: 424 LLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNI 483
           L + Y G   S +GII + CL GFG GF     +AS+QA++ SHQ LA++TAL+LA  NI
Sbjct: 440 LYVHYNGGLGSRSGIITASCLSGFGYGFIKSPLKASLQASSNSHQNLAIVTALFLAIGNI 499

Query: 484 XXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYR 543
                       W+N+LP R+ K+I N TLA  A+ SP  FI    W T  R  +V +Y 
Sbjct: 500 GTAFGAAVAGAIWSNLLPHRLEKSIGNVTLADSAFDSPIKFIKQYKWHTAVRQHLVSSYG 559

Query: 544 DVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELD-------EKNVKEDDP--VVD 594
            V +IL I+ L   IP+L ++  LR+ +L + VA ++ D       E+N+ +D    + D
Sbjct: 560 SVWRILNIVCLVLVIPMLVSSFLLRDRKLSNSVAYDQRDFSPTDCEEENIGQDRRSYIGD 619

Query: 595 FLAKF 599
             AKF
Sbjct: 620 RYAKF 624

>KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {ON} 
          Length = 614

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/591 (45%), Positives = 385/591 (65%), Gaps = 14/591 (2%)

Query: 12  EEEIAQKETYSVHSTDISSGSEISIK-----------DAGVQNIEVYAEQYKKPYYRVLL 60
           +EE   KET +V S D ++ ++ SI+           DAGV+NIE+YAE Y   + R + 
Sbjct: 11  KEEAVAKET-TVVSHDAAAKNDFSIETREDGDDAIVYDAGVRNIEIYAEYYTSKFSRFMY 69

Query: 61  FFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIF 120
           FF LFLVAYAYGLD  +R               L+STV CIKT+I+AAGQI FAR+ DIF
Sbjct: 70  FFFLFLVAYAYGLDTRVRTTFATDATSSYKKHTLMSTVTCIKTIISAAGQIGFARSCDIF 129

Query: 121 GRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWR 180
           GR ++ + +I+ Y VGTI+ESQAT ++++  G   Y +G++G +L+ EV+  DFSNLNWR
Sbjct: 130 GRTSIFVFSIILYAVGTIVESQATTISKYAGGVVLYSLGHSGIVLVSEVLIADFSNLNWR 189

Query: 181 LLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLAN- 239
           ++A   P LP +INTWISG++ + +G  WKWGIG+WA +FP+ CIPL   +LHM+YLA  
Sbjct: 190 VVAAAAPMLPNVINTWISGNIVADLGDHWKWGIGLWAIVFPVCCIPLLFILLHMKYLAQY 249

Query: 240 KNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSE 299
           K+ + +L +   +PK    K  + I+ LFW++D++GL+L+   FG +L+PFTLA   N +
Sbjct: 250 KDKRPELKRIWTLPKGMT-KVQYLIETLFWRVDVVGLILLAATFGLILIPFTLAEKKNYQ 308

Query: 300 WKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYM 359
           WK A  IVPEV+GW V LPLY +WE  F++ PLTP A +KDRG++ AL+++  I+F +YM
Sbjct: 309 WKKASYIVPEVLGWAVSLPLYCIWEKFFARFPLTPLATVKDRGIYGALLVSLFIDFVYYM 368

Query: 360 QGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWF 419
           Q  Y+YTVL VA + +  +ATRI +LYSFV            +++++ K FI+FGI++W 
Sbjct: 369 QHTYLYTVLYVAFNNTTSAATRINNLYSFVGVITSFFLGFVVVRLKKVKKFILFGIAVWI 428

Query: 420 VAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLA 479
           +A+GL IRYR   AS+ G I ++C+LGFG GF     +ASIQA+  SHQK+AVIT+L+LA
Sbjct: 429 IAYGLFIRYRTGQASYVGSIAAICVLGFGNGFLKIPARASIQASVGSHQKMAVITSLFLA 488

Query: 480 AYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVV 539
             +I            W N +   I K ++N T AA AY SP  F+    WGT  RM VV
Sbjct: 489 LADIGEAFGSAVAGAIWGNRMEAEIYKRVSNTTAAALAYDSPTKFVKKYKWGTATRMEVV 548

Query: 540 KAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKEDD 590
            AYR+V  IL ++G+C C+PLL  +  LR+ +LE+V++ + +   +  +D+
Sbjct: 549 AAYREVTLILYVVGICLCVPLLLCSFLLRDRKLEEVISYDMMGSNSESKDE 599

>SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 629

 Score =  525 bits (1353), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 266/592 (44%), Positives = 370/592 (62%), Gaps = 11/592 (1%)

Query: 5   SSHSNQGEEEIAQKETYS-VHSTDI-----SSGSEISIKDAGVQNIEVYAEQYKKPYYRV 58
           SS+SN       +K  YS  H   I     S   E   K  GVQ +E+  +QY   + + 
Sbjct: 16  SSNSNSHIGTDVEKYQYSNTHGDSIPDNYDSHFEEEEEKSYGVQKVEILNKQYNHLWGKS 75

Query: 59  LLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASD 118
            +FFSLFL+ + + LD  +R               LLSTVN +++V AA G   ++R SD
Sbjct: 76  AIFFSLFLMGFVFRLDSMVRRSMNAYATNSYKQHSLLSTVNVVRSVAAACGLPLYSRLSD 135

Query: 119 IFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLN 178
           +FGR+ ++++++L YV GTII +QA +V R+ AG   YQ G  G  ++ +VIA DFSNLN
Sbjct: 136 VFGRIELIVVSVLLYVAGTIICTQAYDVTRYAAGMILYQFGLCGLAILFKVIAADFSNLN 195

Query: 179 WRLLALFVPALPFIINTWISGDVTSAVGGDWKW-GIGMWAFIFPLACIPLGCCMLHMRYL 237
           WR+    + A PFIINTW+SGD+  A+G +W W GIG+WA   P+A IPL  C +HM+YL
Sbjct: 196 WRVFCTLISAAPFIINTWVSGDIVEAIGDNWSWPGIGVWAICLPVATIPLVLCFIHMQYL 255

Query: 238 ANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMN 297
           A K+      + +     +   + F ++V FWKLD+ G+L ++   G +L P TLAGG  
Sbjct: 256 AKKSGDLNQLRGMQTEYKRLGFKKFVVEVFFWKLDIFGVLSLMIILGLILTPLTLAGGET 315

Query: 298 SEWKTAHIIVPEVIGWVVC-LPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFC 356
           +EW+TA +IVP ++G+  C +P++  WE + + HP+ P  + +DRGV+ AL I  +I+FC
Sbjct: 316 AEWRTAKVIVPLILGF--CWIPVFAFWENRIATHPIAPTDMFRDRGVYCALGIGILIDFC 373

Query: 357 WYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGIS 416
           WYMQGDY+YT+LVVA+HESVKSATRI SLYSF +            KVR+ K FI+FG+ 
Sbjct: 374 WYMQGDYLYTILVVAIHESVKSATRINSLYSFSTIITGLCVGLAISKVRKMKCFIVFGVC 433

Query: 417 MWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITAL 476
           MW VAFG++I+YRG S SH G+I S  LLGFG  FFT+  QAS+QA   +H+++A IT L
Sbjct: 434 MWLVAFGIMIKYRGGSQSHGGMIASQVLLGFGGAFFTHPVQASLQAYV-NHERMATITTL 492

Query: 477 YLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRM 536
           Y  +Y I            WT VLP+ I K   N+TLA  AY +P +FI   TWGTP RM
Sbjct: 493 YAISYYIGSAVGSSVSGAIWTQVLPNEIGKRFTNKTLARLAYSAPLSFIKKYTWGTPLRM 552

Query: 537 AVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKE 588
            +V+AYR VQK+L I+G+CFC+P+L  ALFLR+  L     + + ++K VKE
Sbjct: 553 ELVEAYRHVQKLLIIVGICFCVPILGFALFLRDPVLISAQNIVDAEDKEVKE 604

>KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score =  523 bits (1347), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 276/622 (44%), Positives = 375/622 (60%), Gaps = 35/622 (5%)

Query: 4   ESSHSNQGEEEIAQKETYSVHSTDISSGSEISIKDA-GVQNIEVYAEQYKKPYYRVLLFF 62
            ++ ++ G      KE Y  H    +   E   K    ++  E+ ++ Y K Y + +L F
Sbjct: 25  SATETSDGTNSFVNKEQYEAHQDSTTDEHETGKKKTLTIRKTELLSKSYDKWYLQAILLF 84

Query: 63  SLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGR 122
           S F+  Y YGLDGNIR               LLST+N I  V++AA QI +AR SDI+GR
Sbjct: 85  SAFVCGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIVYARLSDIYGR 144

Query: 123 LTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLL 182
           +++L++AI+ Y VGTII+ QA +V R+ AG  FY  GY G +LI+ +I +DFS+L WRL 
Sbjct: 145 MSLLVVAIVLYAVGTIIQCQAYDVQRYAAGSIFYNAGYVGVILILLLILSDFSSLRWRLF 204

Query: 183 ALFVPALPFIINTWISGDVTSAVG--GDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANK 240
             FVP  PFIINTWISG++T        W W IGMWAFIFPL+C+P+ CCM+HM      
Sbjct: 205 YQFVPTWPFIINTWISGNITQKANPLKHWSWDIGMWAFIFPLSCVPILCCMIHM------ 258

Query: 241 NSKDKLAKHVMVPKDKEWKR------YFFI-------DVLFWKLDMIGLLLMVCFFGCVL 287
                   H  V  D EWK       YF I         LFWKLD++G+LLMV   GC+L
Sbjct: 259 --------HWRVRNDPEWKELQGEKTYFQIHGWKVTLKTLFWKLDVVGVLLMVACLGCIL 310

Query: 288 VPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSAL 347
           VP TLAGG++S+W  ++II P V+G+V+ +P++  WE +++ +PL P+ L+KDRGV++AL
Sbjct: 311 VPLTLAGGVSSKWNHSNIIGPFVLGFVL-IPIFSYWEARWATNPLVPYKLVKDRGVWAAL 369

Query: 348 IIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRT 407
            I+ +I+F +YM  DY+YTVL+VAVHESVKSATRI+SL SFVS            +V R 
Sbjct: 370 GISFLIDFIFYMAVDYLYTVLIVAVHESVKSATRISSLSSFVSTVASPIVALALTRVTRM 429

Query: 408 KPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSH 467
           KP II G S+W +A GLL  +RG   SH+GIIG+LC+ G G   FTY    S+QA T +H
Sbjct: 430 KPVIIVGCSLWLLAMGLLYHFRGGRESHSGIIGALCVWGLGTTLFTYPVTVSVQAAT-NH 488

Query: 468 QKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIIT 527
             +A +TAL    Y I            WT  L  ++ K I N  LA +AY SP+TFI T
Sbjct: 489 DNMATVTALNYTLYRIGSAVGAAVSGAIWTQTLYKQLLKRIGNSELATKAYASPYTFITT 548

Query: 528 NTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVK 587
            TWGTP+R A+V+AYR VQ++  I+ + FC PL+  +L LR+ +L D VA  ++ E    
Sbjct: 549 YTWGTPEREAMVQAYRYVQRLETIVAVVFCAPLIMFSLCLRDAKLTDEVAHEDISEGEYI 608

Query: 588 ED---DPVVDFLAKFIPSLRNK 606
           E    DP+ +F AK     +NK
Sbjct: 609 EKASGDPIGEFFAKLFKKTKNK 630

>Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON}
           YHL040C (REAL)
          Length = 633

 Score =  516 bits (1328), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 262/575 (45%), Positives = 369/575 (64%), Gaps = 14/575 (2%)

Query: 41  VQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNC 100
           ++  E+  E YKK Y++ +L  S F+  Y YGLDGNIR               LLST+N 
Sbjct: 63  IKQTEIIGEAYKKWYFQAILLISAFVCGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINV 122

Query: 101 IKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGY 160
           I  V++AA QI +AR SD+FGRL + I A++ YVVGTII+SQA +V R+ AG  FY  GY
Sbjct: 123 INAVVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGSIFYNAGY 182

Query: 161 TGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVG--GDWKWGIGMWAF 218
            G +LI+ +I +DFS+L WRLL  F P  PFIINTWI+G++TS      +W W IGMWAF
Sbjct: 183 VGVILILLIILSDFSSLKWRLLYQFAPTWPFIINTWIAGNITSKANPVENWSWDIGMWAF 242

Query: 219 IFPLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVL---FWKLDMIG 275
           IFPL+CIP+  CMLHM+++A K  +     H +  +   ++ + F+ VL   FWKLD+IG
Sbjct: 243 IFPLSCIPIVLCMLHMQWIARKTPE----WHALKDEKSYYQEHGFVKVLEQLFWKLDVIG 298

Query: 276 LLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPW 335
           +LLM C  GC+LVP TLAGG+ + W  + +I P V+G+V+ +P+  +WE + ++ P+ P+
Sbjct: 299 VLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVL-IPILWVWEYRVARDPIIPY 357

Query: 336 ALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXX 395
            L+KDRGV+S++ I+ +I+F +YM  DY+YTV++VAV+ES+KSATRI++L SFVS     
Sbjct: 358 KLVKDRGVWSSMGISFLIDFIYYMAADYLYTVMLVAVNESIKSATRISTLSSFVSVVASP 417

Query: 396 XXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYT 455
                  +  R KPFI+FG  +W +A GLL RYRG   SH+GIIG+LC+ G G   FTY 
Sbjct: 418 FFGLIMTRCTRLKPFIMFGCCLWMLAMGLLYRYRGGRESHSGIIGALCVWGLGTTLFTYP 477

Query: 456 TQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAA 515
              S+Q+   SH+ LA +TAL    Y I            WT  L  +I K + + TLA 
Sbjct: 478 VTVSVQSAV-SHENLATVTALNYTLYRIGSAVGAAVSGAIWTQTLYKQILKRMGDVTLAT 536

Query: 516 EAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDV 575
            AY SP+TFI T TWGTP R+A+V AY+ VQ++  I+ L FC PL+  +L LR+ +L D 
Sbjct: 537 AAYTSPYTFIETYTWGTPQRVALVNAYKYVQRLETIVALVFCAPLIAFSLCLRDPKLTDT 596

Query: 576 VALNELDEK---NVKEDDPVVDFLAKFIPSLRNKK 607
           VA+  ++E    + K++DP++D+  KF     + K
Sbjct: 597 VAVENIEEGEYVDTKDNDPILDWFKKFTSKFSSSK 631

>CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040c ARN1
           or uniprot|P38724 Saccharomyces cerevisiae YHL047c TAF1
          Length = 645

 Score =  509 bits (1310), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 262/577 (45%), Positives = 361/577 (62%), Gaps = 10/577 (1%)

Query: 36  IKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLL 95
           +K+  ++  E+ AE Y K YY  +L F+ F+  Y YGLDGN R               LL
Sbjct: 70  VKNIIIRKTEIMAEVYDKWYYHAILLFTAFVCGYGYGLDGNTRYIYTGYATSSYAQHSLL 129

Query: 96  STVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCF 155
           ST+N I  VI+AA QI +AR SD++GR  +  ++I+ Y VGTII+SQA +V R+ AG  F
Sbjct: 130 STINVINAVISAASQIVYARLSDVYGRFALFCVSIVLYSVGTIIQSQAYDVQRYAAGSIF 189

Query: 156 YQVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVG--GDWKWGI 213
           Y  GY G +L++ +I +DFS+L WRL+  FVP  PFIINTWISG+VTS      +W W I
Sbjct: 190 YNTGYVGVILVLLLILSDFSSLRWRLVYQFVPTWPFIINTWISGNVTSRANPLKNWSWDI 249

Query: 214 GMWAFIFPLACIPLGCCMLHMRYLANKNSK-DKLAKHVMVPKDKEWKRYFFIDVLFWKLD 272
           GMWAFIFPL+C+PL C M+HM +LA K  +  +L+K     +    K    I  LFWK+D
Sbjct: 250 GMWAFIFPLSCVPLLCVMIHMWWLARKTEEWQELSKEKTFYQKHGLKD--TIVELFWKID 307

Query: 273 MIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPL 332
            +G+ +M    GC+LVP TLAGG  S+W  +H+I P V+G+V+ +P+ +LWE KF++ P+
Sbjct: 308 AMGVFIMTISLGCILVPLTLAGGTKSKWNNSHVIGPFVLGFVL-IPILVLWEYKFARDPI 366

Query: 333 TPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXX 392
            P+ L+KDRGV+++  I+ +I+F +YM  DY+YTVL+V V+ESVKSATRI+SL +FVS  
Sbjct: 367 IPYKLVKDRGVWASFAISFLIDFIYYMAADYLYTVLIVGVNESVKSATRISSLSTFVSTV 426

Query: 393 XXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFF 452
                     +  R KPFII G  +W +A GLL  YRG + SH+GIIG+LC+ G G   F
Sbjct: 427 GSPIFSLLITRFSRLKPFIICGCGLWMLAMGLLYHYRGGAESHSGIIGALCVWGVGTTLF 486

Query: 453 TYTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQT 512
           TY    S+QA T SH+ +A +TAL    Y I            WT  L  ++ K + +  
Sbjct: 487 TYPVNVSVQAAT-SHEHMATVTALNYTFYRIGSAVGAAVSGAIWTQTLYKQLLKRVGDAA 545

Query: 513 LAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRL 572
           LA EAY SP+ FI+T TW TP+R AVV+AYR VQ++  I+ L FC PLL  +L LR+ RL
Sbjct: 546 LATEAYASPYKFIVTYTWDTPERQAVVQAYRYVQRLETIVALVFCAPLLIFSLCLRDARL 605

Query: 573 EDVVALNELDEK---NVKEDDPVVDFLAKFIPSLRNK 606
            D VA + + E    + K+DDP+ ++        R K
Sbjct: 606 TDKVAHDNIAEGEYVDAKDDDPIYEWFKGATTRFRRK 642

>TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON} 
          Length = 669

 Score =  506 bits (1302), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 271/615 (44%), Positives = 382/615 (62%), Gaps = 17/615 (2%)

Query: 2   SLESSHSNQGEEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLF 61
           ++E+S+S+ G     +K   S +  +I S  E +     ++  E+    Y K YY V+L 
Sbjct: 58  TIETSNSS-GFSSKDEKYLASENIDEIPSDGEKTSTSRIIRETEIMKSVYDKWYYHVILL 116

Query: 62  FSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFG 121
           FS F+  Y YGLDGNIR               LLST+N I  V +AA QI +ARASD+FG
Sbjct: 117 FSAFVCGYGYGLDGNIRYIYTGYATSSYAEHSLLSTINVINAVASAASQIVYARASDVFG 176

Query: 122 RLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRL 181
           RL++ I++++FY VGTII+ QA +V R+ AG  FY +GY G +L++ +I +DFS+L WRL
Sbjct: 177 RLSLFIVSVVFYAVGTIIQCQAYDVQRYCAGSFFYNIGYVGVILVLLLILSDFSSLKWRL 236

Query: 182 LALFVPALPFIINTWISGDVTSAVG--GDWKWGIGMWAFIFPLACIPLGCCMLHMRYLAN 239
              F P  P+IINTWISG++TSA      W W IGMWAFIFPL+ IP+  C++HMR++A+
Sbjct: 237 FYQFAPTWPYIINTWISGNITSAANPLKHWSWDIGMWAFIFPLSSIPIILCLIHMRWMAS 296

Query: 240 KNSKDKLAKHVMVPKDKEW-KRYFFIDV---LFWKLDMIGLLLMVCFFGCVLVPFTLAGG 295
           K  + KL K     ++K + +++ F+     LFW+LD+IG+LLM    GC+LVP TLAGG
Sbjct: 297 KTKEWKLLK-----QEKSYIQQHTFVSAITDLFWRLDVIGVLLMGASLGCILVPLTLAGG 351

Query: 296 MNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINF 355
            +S+W   +II P  +G+V+ +P++  WE KFSK PL P  L+KDR V+S++ I+ +I+F
Sbjct: 352 TSSKWNHGNIIAPFALGFVL-IPIFTFWEWKFSKSPLIPSKLVKDRAVWSSMAISFLIDF 410

Query: 356 CWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGI 415
            +YM  DY+YTVL+V V+ESVKSATRI+SL SFVS            +  R KPFI+ G 
Sbjct: 411 IFYMAVDYLYTVLIVGVNESVKSATRISSLSSFVSTVGSPIFALLITRFTRLKPFIVAGC 470

Query: 416 SMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITA 475
           ++W ++ GLL  YRG ++SH GII SLC+ G G   FTY    S+QA   SH  +A +TA
Sbjct: 471 ALWMLSMGLLYHYRGGASSHNGIIASLCVWGVGTTLFTYPINVSVQAAV-SHADMATVTA 529

Query: 476 LYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDR 535
           L    Y I            WT  L  ++ K + + TLA  AY SP++FI+  TWGT  R
Sbjct: 530 LNYTMYRIGSAVGAAVSGAIWTQTLYKQLHKRMGDATLATAAYSSPYSFIVNYTWGTTVR 589

Query: 536 MAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEK---NVKEDDPV 592
             +V+AYR VQ++  I+ L F +PLL  +L LR+ RL D VA ++++E    N  + DP+
Sbjct: 590 DQMVEAYRYVQRLETIVALVFTVPLLLFSLTLRDARLTDNVASDDIEEGQHINKTDSDPI 649

Query: 593 VDFLAKFIPSLRNKK 607
            DFL+K    L  K 
Sbjct: 650 ADFLSKPFKGLFKKN 664

>YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}
           ARN1Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to ferrirubin, ferrirhodin, and related
           siderophores
          Length = 627

 Score =  504 bits (1297), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 264/615 (42%), Positives = 379/615 (61%), Gaps = 23/615 (3%)

Query: 4   ESSHSNQGEEEIAQKETYSVHSTDISSGSEISIKDAG--------VQNIEVYAEQYKKPY 55
           E  H   G E     ET++  ++D     ++S K           +Q  E+    Y K Y
Sbjct: 13  EKKHVFMGMEHELNPETHNDSNSDSYGLPQLSEKYNALRQNRSLIIQQTEIIGSAYNKWY 72

Query: 56  YRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFAR 115
            + +L  S F+  Y YGLDGNIR               LLST+N I  V++AA QI +AR
Sbjct: 73  LQAILLLSAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYAR 132

Query: 116 ASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFS 175
            SD+FGRL + I A++ YVVGTII+SQA +V R+ AG  FY  GY G +LI+ +I +DFS
Sbjct: 133 LSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIILSDFS 192

Query: 176 NLNWRLLALFVPALPFIINTWISGDVTSAVGG--DWKWGIGMWAFIFPLACIPLGCCMLH 233
           +L WRLL  FVP  PFIINTWI+G++TS      +W W +GMWAFIFPL+C+P+  CMLH
Sbjct: 193 SLKWRLLYQFVPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAFIFPLSCVPIVLCMLH 252

Query: 234 MRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVL---FWKLDMIGLLLMVCFFGCVLVPF 290
           M++ A K  +     H +  +   ++ + FI +L   FW LD++G+LLM C  GC+LVP 
Sbjct: 253 MQWRARKTPE----WHALKGQKSYYQEHGFIKILKQLFWMLDVVGVLLMGCSLGCILVPL 308

Query: 291 TLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIA 350
           TLAGG+ + W  + +I P V+G+V+ +P+  +WE +F++ P+ P+ L+KDR V+S++ I+
Sbjct: 309 TLAGGVKTTWNDSRLIGPFVLGFVL-IPILWIWEYRFARDPILPYRLVKDRAVWSSMGIS 367

Query: 351 TMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPF 410
            +I+F +YM  DY+YTV++VAV+ESVKSATRI +L SFVS            +  R KPF
Sbjct: 368 FLIDFIYYMAADYLYTVMIVAVNESVKSATRIATLSSFVSTVASPFFALLVTRCTRLKPF 427

Query: 411 IIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKL 470
           I+FG ++W VA GLL  +RG S SH+GIIG+LC+ G G   FTY    S+Q+   SH+ +
Sbjct: 428 IMFGCALWMVAMGLLYHFRGGSQSHSGIIGALCVWGVGTTLFTYPVTVSVQSAV-SHENM 486

Query: 471 AVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTW 530
           A +TAL    Y I            WT  L  +I K + +  LA  AY SP+TFI T TW
Sbjct: 487 ATVTALNYTLYRIGSAVGSAVSGAIWTQTLYKQILKRMGDVALATTAYESPYTFIETYTW 546

Query: 531 GTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEK---NVK 587
           GTP R A++ AY+ VQ++  I+ L FC+PL+  +L LR+ +L D VA+  +++    + K
Sbjct: 547 GTPQRNALMNAYKYVQRLETIVALVFCVPLIAFSLCLRDPKLTDTVAVEYIEDGEYVDTK 606

Query: 588 EDDPVVDFLAKFIPS 602
           ++DP++D+  K +PS
Sbjct: 607 DNDPILDWFEK-LPS 620

>KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C
          Length = 632

 Score =  501 bits (1289), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 264/622 (42%), Positives = 377/622 (60%), Gaps = 27/622 (4%)

Query: 8   SNQGEEEIAQKETYSVHSTDISSGSE---ISIKDAGVQNI------------EVYAEQYK 52
           S    E I +K T ++ S+  SS  E    +  D  +QN+            E+ +  Y 
Sbjct: 3   SRSSSEIIVEKNTAAIVSSKKSSDEEPMDYNEVDEELQNVLQTNKSIVIKKAEIISASYA 62

Query: 53  KPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIW 112
           K Y +++  F  FL  Y YGLD NIR               LLSTV  I  V++AA QI 
Sbjct: 63  KWYEKLIFLFCAFLCGYGYGLDSNIRYIYTGYATSSYSEHSLLSTVTVINAVVSAASQIV 122

Query: 113 FARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIAT 172
           +AR SD FGR  + ++AI+ Y +GTII+ QA +V R+ AG  FY  GY G +L++ +I +
Sbjct: 123 YARLSDAFGRFRLFVVAIVLYSMGTIIQCQAYDVQRYAAGSIFYNAGYVGVILVLLLILS 182

Query: 173 DFSNLNWRLLALFVPALPFIINTWISGDVTSAVG--GDWKWGIGMWAFIFPLACIPLGCC 230
           D S L WRL   FVP  P+IINTWISG++TSA     +W W +GMWAFIFPL+C+P+  C
Sbjct: 183 DMSTLRWRLFYQFVPTWPYIINTWISGNITSAANPIENWSWDVGMWAFIFPLSCLPILAC 242

Query: 231 MLHMRYLANKNS--KDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLV 288
           M+HM++ A K    KD   +     +    K    +  LFWK+D+IG+LLM    GC+LV
Sbjct: 243 MIHMQWRARKTQEWKDLKTQKTYYQQHGLMKS---LVSLFWKIDIIGVLLMAASLGCILV 299

Query: 289 PFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALI 348
           P TLAGG +S+W+ + II   V+G+V+ +P++ +WE KF+  P+ P+ L+KDRGV+++L 
Sbjct: 300 PLTLAGGTSSKWRDSRIIGVFVLGFVL-IPIFFIWEKKFATDPIVPYKLVKDRGVWASLG 358

Query: 349 IATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTK 408
           I+ +I+F +YM  DY+YTVL+VAV+ESV +ATRI+SLYSFVS            +  R K
Sbjct: 359 ISFLIDFIYYMAADYLYTVLIVAVNESVSAATRISSLYSFVSTVASPFVSLALTRFTRLK 418

Query: 409 PFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQ 468
           PFIIFG  +WF+A GLL  +RG ++SH+GIIG LC+ G G+ FFTY    S+QA   SH+
Sbjct: 419 PFIIFGCCLWFLAMGLLYHFRGGASSHSGIIGGLCVWGLGSTFFTYPVTVSVQAAV-SHE 477

Query: 469 KLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITN 528
           ++A ++AL    Y I            WT  L  ++   + + TLA  AYGSP+TFI+T 
Sbjct: 478 QMATVSALNYTFYRIGSAVGAAVSGAIWTQKLYKKLLSLMGDATLATAAYGSPYTFIVTY 537

Query: 529 TWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEK---N 585
           TWGTP+R A+V+AYR +Q++  ++ L FC+PL+  +L LR+ RL D VA +++      +
Sbjct: 538 TWGTPEREAMVEAYRYIQRLETVVALVFCVPLVAFSLCLRDSRLTDNVAHDDMSSGEFID 597

Query: 586 VKEDDPVVDFLAKFIPSLRNKK 607
            K DDP+ +F       +  KK
Sbjct: 598 TKSDDPLAEFFVGLWRRVTGKK 619

>Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL040C
           (REAL)
          Length = 627

 Score =  499 bits (1284), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 257/575 (44%), Positives = 366/575 (63%), Gaps = 15/575 (2%)

Query: 41  VQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNC 100
           +Q  E++   Y K Y +V L  S F+  Y YGLDGNIR               LLST+N 
Sbjct: 58  IQQTEIFGAAYNKWYLQVFLLLSAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINV 117

Query: 101 IKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGY 160
           I  V++AA QI +AR SD+FGRL + I A++ YVVGTII+SQA +V R+ AG  FY  GY
Sbjct: 118 INAVVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGY 177

Query: 161 TGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGG--DWKWGIGMWAF 218
            G +LI+ +I +DFS+L WRLL  F P  PFIINTWI+G++TS      +W W +GMWAF
Sbjct: 178 VGVILILLIILSDFSSLKWRLLYQFAPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAF 237

Query: 219 IFPLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDV---LFWKLDMIG 275
           IFPL+CIP+  CMLHM++ A K  +     H +  +   ++ + FI +   LFW LD+IG
Sbjct: 238 IFPLSCIPIVLCMLHMQWRAKKTPE----WHTLKGQKSYYQEHGFIKIIKQLFWMLDIIG 293

Query: 276 LLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPW 335
           +LLM C  GC+LVP TLAGG+ + W  + +I P V+G+V+ +P+  +WE +F++ P+ P+
Sbjct: 294 VLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVL-IPVLWIWEYRFARDPILPY 352

Query: 336 ALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXX 395
            L+KDR V+S++ I+ +I+F +YM  DY+YTV++VAV+ESVKSATRI++L SFVS     
Sbjct: 353 KLVKDRAVWSSMGISFLIDFIYYMAADYLYTVMIVAVNESVKSATRISTLSSFVSTVASP 412

Query: 396 XXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYT 455
                  +  R KPFI+FG S+W VA GLL  +RG S SH+GIIG+L + G G   FTY 
Sbjct: 413 FFALLVTRCTRLKPFIMFGCSLWMVAMGLLYHFRGGSQSHSGIIGALGVWGVGTTLFTYP 472

Query: 456 TQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAA 515
              S+Q+   SH+ +A +TAL    Y I            WT  L  +I K + +  LA 
Sbjct: 473 VTVSVQSAV-SHENMATVTALNYTLYRIGSAVGSAVSGAIWTQTLYKQILKRMGDVALAT 531

Query: 516 EAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDV 575
            AY SP+TFI T TWGTP R+A++ AY+ VQ++  I+ L FC+PL+  +L LR+ +L + 
Sbjct: 532 AAYDSPYTFIETYTWGTPQRVALMNAYKYVQRLETIVALVFCVPLIALSLCLRDPKLTNA 591

Query: 576 VALNELDEK---NVKEDDPVVDFLAKFIPSLRNKK 607
           VA+  +++    + K++DP++++  K IPS    K
Sbjct: 592 VAVEYIEDGEYVDTKDNDPILEWFEK-IPSKFTSK 625

>Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL040C
           (REAL)
          Length = 631

 Score =  498 bits (1282), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 273/627 (43%), Positives = 381/627 (60%), Gaps = 30/627 (4%)

Query: 7   HSNQGEE------EIAQKETYSVHSTDISSG-------SEISIK-DAGVQN-------IE 45
           H N G E      +I Q+     H+   SS         ++S K DA  QN        E
Sbjct: 7   HDNIGSEKKHVPLDIEQELNPEAHTDSHSSSYARDDTLPQMSGKYDALRQNRSLIIKQTE 66

Query: 46  VYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVI 105
           +    Y K Y + +L FS F+  Y YGLDGNIR               LLST+N I  V+
Sbjct: 67  IIGTAYNKWYLQAILLFSAFVCGYGYGLDGNIRYIYTGYATSSYSKHSLLSTINVINAVV 126

Query: 106 AAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAML 165
           +AA QI +AR SD+FGRL + I A++ YVVGTII+SQA +V R+ AG  FY  GY G +L
Sbjct: 127 SAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVIL 186

Query: 166 IVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGG--DWKWGIGMWAFIFPLA 223
           I+ +I +DFS+L WRLL  F P  PFIINTWI+G++TS      +W W +GMWAFIFPL+
Sbjct: 187 ILLIILSDFSSLKWRLLYQFAPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAFIFPLS 246

Query: 224 CIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFF 283
           CIP+  CMLHM++ A K  + +  K       +E      ++ LFWKLD+IG+LLM C  
Sbjct: 247 CIPIVLCMLHMQWRAGKTPEWQELKG-QKSYYQEHGLMKILEQLFWKLDVIGVLLMGCSL 305

Query: 284 GCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGV 343
           GC+LVP TLAGG+ + W  + +I P V+G+V+ +P+  +WE  +++ P+ P+ L+KDRGV
Sbjct: 306 GCILVPLTLAGGVKTTWNDSRLIGPFVLGFVL-IPILWVWEYSYARDPILPYKLVKDRGV 364

Query: 344 FSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIK 403
           +S++ I+ +I+F +YM  DY+YTV++VAV+ES+KSATRI++L SFVS            +
Sbjct: 365 WSSMGISFLIDFIYYMAADYLYTVMIVAVNESIKSATRISTLSSFVSVVASPFFGLLMTR 424

Query: 404 VRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQAT 463
             R KPFI+ G S+W +A GLL R+RG S SH+GIIG+LC+ G G   FTY    S+Q+ 
Sbjct: 425 CTRLKPFIMSGCSLWMLAMGLLYRFRGGSESHSGIIGALCVWGVGTTLFTYPVTVSVQSA 484

Query: 464 TRSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFT 523
             SH+ LA +TAL    Y I            WT  L  +I K + +  LAA AY SP+ 
Sbjct: 485 V-SHENLATVTALNYTMYRIGSAVGSAVSGAIWTQTLYKQILKRMGDVALAASAYDSPYV 543

Query: 524 FIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDE 583
           FI T TWGTP R+A++ AY+ VQ++  I+ L FC+PL+  +L LR+ RL D VA+  + +
Sbjct: 544 FIETYTWGTPQRVALMGAYKYVQRLETIVALVFCVPLIALSLCLRDPRLTDTVAVENIKD 603

Query: 584 K---NVKEDDPVVDFLAKFIPSLRNKK 607
               + K+ DP++++  K IPS    K
Sbjct: 604 GEYVDTKDSDPILEWFEK-IPSKFTSK 629

>KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON} 
          Length = 591

 Score =  492 bits (1266), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 241/582 (41%), Positives = 362/582 (62%), Gaps = 10/582 (1%)

Query: 12  EEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAY 71
           EE    + +YS+ + D+    E    + GV NIE+Y+E Y  P  R++LF S+FLV Y+Y
Sbjct: 13  EENKVNETSYSLEAHDVP---EDDYYNVGVTNIEIYSEFYNTPMKRIILFSSIFLVCYSY 69

Query: 72  GLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAIL 131
            LD  +R               L+S VNC   +++A G+++FAR++DIFGR ++  I ++
Sbjct: 70  SLDSTLRKTFKTDATNSFSEHSLVSFVNCFSAIVSAIGELFFARSADIFGRTSIFYICLV 129

Query: 132 FYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPF 191
           FYVVGTII + +  +++F AG C Y  G +G  ++++++ +DFS+LNWRL+A  +P LP 
Sbjct: 130 FYVVGTIIVATSKGISQFAAGYCIYSFGESGIDMVMQLLVSDFSHLNWRLVAGVIPMLPN 189

Query: 192 IINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSKDKLAKHVM 251
           +IN W SG + S    +W+WGIGM+A I P+ACIPL  C+ HMRY+A KN K++L +   
Sbjct: 190 VINAWASGTIVSDFSDNWQWGIGMFAIIVPVACIPLAVCLFHMRYMAKKNKKNELKRPWH 249

Query: 252 VPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVI 311
              +  W + F  + LFW+LD++GL+ +    GC+LVPFTL      +W  A  IVPEVI
Sbjct: 250 SNNELSWAQ-FIRETLFWRLDLVGLITLGASLGCILVPFTLTKKAGKKWAKASTIVPEVI 308

Query: 312 GWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVA 371
           GW V LPLYI+WE  ++K+PLTP  L++DRGV++AL+   +  F + M+ +YM TVL VA
Sbjct: 309 GWAVGLPLYIVWEKFYAKYPLTPLRLIRDRGVYAALVAVFLYEFIYVMEANYMVTVLQVA 368

Query: 372 VHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGD 431
            + +  +ATRI + Y FVS           + +R+TK  I+FG +++FV++GL IRYRG 
Sbjct: 369 FNNTSAAATRINNSYEFVSVLTAFILGFFVVFIRKTKRLILFGGTLFFVSYGLFIRYRGG 428

Query: 432 SASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXX 491
              +AG I +LC+ GF  GF  Y T+ S+QA+  SH+++A+ITAL+ A  ++        
Sbjct: 429 HGCYAGSIAALCVFGFANGFIKYPTRTSLQASAGSHKRMAMITALFTAIGSVGKAMAAAI 488

Query: 492 XXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCI 551
               W+ ++P  +S  I+N  +AA+AY SP T I T  W +  R  +++AYR V K+L I
Sbjct: 489 AGAIWSGLMPGALSSRISNSKVAAKAYSSPLTVIKTYGWNSTIRNEMIEAYRYVTKVLYI 548

Query: 552 IGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKEDDPVV 593
           + +C C+PLL A+  LR+ RLE+ VA +         DDP V
Sbjct: 549 VAICLCVPLLIASFLLRDRRLENKVAYDS------DSDDPSV 584

>NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score =  488 bits (1257), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 276/626 (44%), Positives = 378/626 (60%), Gaps = 38/626 (6%)

Query: 3   LESSHS-NQGEEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLF 61
           +E+ H  +  E++I   ET      DI+  S    K   ++  EV A  Y K YY V+L 
Sbjct: 19  IENVHVVSSKEKDIETNET----DDDITIRSPPPKKSLVIKQTEVMASVYDKWYYHVVLL 74

Query: 62  FSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFG 121
            S F+  Y YGLDGNIR               LLSTV  I  V++AA QI ++R SD FG
Sbjct: 75  VSAFICGYGYGLDGNIRYIYTGYATSSYAEHSLLSTVTVINAVVSAASQIVYSRLSDFFG 134

Query: 122 RLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRL 181
           R  + +IAI+ YVVGTII+SQA +V R+ AG  FY  GY G +LI+ +I +DFS+L WRL
Sbjct: 135 RFILFVIAIVLYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVLLILLLILSDFSSLKWRL 194

Query: 182 LALFVPALPFIINTWISGDVTSAVGG--DWKWGIGMWAFIFPLACIPLGCCMLHMRYLAN 239
              F P  PFIINTWISG++T A      W W +GMWAFIFPL+CIP+  CM+HM++ A+
Sbjct: 195 FYQFAPTWPFIINTWISGNITLAANPLVHWSWDVGMWAFIFPLSCIPMLLCMIHMQWKAS 254

Query: 240 KNSK--------DKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFT 291
           K  +            KH ++   KE         LFW+LD+IG+LLMV + GC+LVP T
Sbjct: 255 KTEEWKELKKEKSYYEKHGLLLTLKE---------LFWRLDIIGVLLMVAWLGCILVPLT 305

Query: 292 LAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIAT 351
           LAGG+ S+W    II P V+G+V+ +P++  WE  F++ PL P+AL+KDRGV++++ I+ 
Sbjct: 306 LAGGVKSKWNDGRIIGPFVLGFVL-VPIFAAWEYFFARDPLIPYALIKDRGVWASMGISF 364

Query: 352 MINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFI 411
           +I+F +YM  DY+YTVL+VAVHESVKSATRI+SL SFVS            +  R KPFI
Sbjct: 365 LIDFIFYMASDYLYTVLIVAVHESVKSATRISSLSSFVSTVASPFFALLLTRCSRLKPFI 424

Query: 412 IFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLA 471
           + G S+W ++ GLL  +RG   SH+GIIG+LC+ G G   FTY    S+Q+ T SH+ +A
Sbjct: 425 MVGCSLWMLSMGLLYHFRGGEQSHSGIIGALCVWGIGTTLFTYPVNVSVQSAT-SHENMA 483

Query: 472 VITALYLAAYNIXXXXXXXXXXXXWTNVL-PD---RISKAIANQ---TLAAEAYGSPFTF 524
            +TA+    Y +            WT  L PD   R+++ +      T+A EAY SP+TF
Sbjct: 484 TVTAINYTCYRLGSAIGAAVSGAIWTQKLYPDILKRVTEVVGATEAVTIATEAYSSPYTF 543

Query: 525 IITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEK 584
           I   TWGTP R AVV++YR +Q++  I+ L FC+PL+  +L LR+ +L D +A   + E 
Sbjct: 544 ITKYTWGTPVRDAVVESYRYIQRLETIVALVFCVPLIIFSLCLRDAKLTDEIAHENIKEG 603

Query: 585 NV--KED-DPVVDFLAKFIPSLRNKK 607
               KED D   D+L K     R+KK
Sbjct: 604 EYVSKEDSDVFFDWLKKVFG--RSKK 627

>SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score =  484 bits (1247), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 264/599 (44%), Positives = 372/599 (62%), Gaps = 14/599 (2%)

Query: 17  QKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGN 76
           +K+TY+  +         S K   ++  E+ A QY   +YR +L FS FL  Y YGLDG+
Sbjct: 22  EKQTYNELNEYGIPDKLKSTKSLVIRKTEILAAQYDTWFYRSILLFSAFLCGYGYGLDGS 81

Query: 77  IRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVG 136
           +R               LLST+  I  VI+AA QI +AR +D+FGRL + I A++FYVVG
Sbjct: 82  VRYIYTGYATNSYAEHSLLSTIAVINAVISAAAQIVYARLADVFGRLYLFITAVIFYVVG 141

Query: 137 TIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTW 196
           TII+SQA +V R+ AG  FY  GY G +L++ +I +DFS+L WRL   FVP  PFIINTW
Sbjct: 142 TIIQSQAYDVQRYAAGAVFYNTGYVGVVLVLLLILSDFSSLKWRLFYQFVPTWPFIINTW 201

Query: 197 ISGDVTSAVGG--DWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPK 254
           I+GD+TS      +W W I MWAFIFPL+ +P+ CCMLHMR  A K  +      V+  +
Sbjct: 202 IAGDITSRANPQENWSWDISMWAFIFPLSALPIICCMLHMRIKARKTPE----WQVLSEE 257

Query: 255 DKEWKRYFFIDVL---FWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVI 311
              ++ + FI  L   FWKLD+IG+L+M    GC+LVP TLAGG +S+W+ + II P V+
Sbjct: 258 KSFYQTHGFIQTLVQLFWKLDVIGVLIMTVSLGCILVPLTLAGGYSSKWQNSQIIGPIVL 317

Query: 312 GWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVA 371
           G+V+ +P+YI WE K++K P+ P+ LLKDRGV++AL I+ +I+F +YM  DY+Y VL++ 
Sbjct: 318 GFVL-IPMYIYWESKWAKEPMAPFKLLKDRGVWAALGISFLIDFIFYMAADYLYAVLLIG 376

Query: 372 VHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGD 431
           V++SVKSA+RI+SL SFVS            +  R KP+II G S+W +A GLL  +RG 
Sbjct: 377 VNQSVKSASRISSLSSFVSTVASPFFALIITRSTRLKPYIITGCSLWMLAMGLLYHFRGG 436

Query: 432 SASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXX 491
           S S++GI+G+LC+ G G   FTY    S+Q+ T SH+ +A +TAL    Y I        
Sbjct: 437 SESYSGIVGALCVWGIGTTMFTYPVNVSVQSVT-SHENMATVTALNYTLYRIGAAVGAAV 495

Query: 492 XXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCI 551
               WT  L   +   + +  LA  AY  P++FIIT+TW TP+R A+V++YR VQ++  I
Sbjct: 496 SGAIWTQTLYKDLLNRLDDAALAMSAYSEPYSFIITHTWNTPERDAMVQSYRYVQRLETI 555

Query: 552 IGLCFCIPLLCAALFLRNHRLEDVVALNELDEK---NVKEDDPVVDFLAKFIPSLRNKK 607
           + L F +PLL  + FLR+  L D VA + ++E    NV  +DP+ D+ +     LR KK
Sbjct: 556 VALVFTVPLLVFSFFLRDPPLTDKVAQDNIEEGEYINVNHNDPITDWFSSRFERLRGKK 614

>KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score =  476 bits (1225), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 272/621 (43%), Positives = 377/621 (60%), Gaps = 35/621 (5%)

Query: 12  EEEIA---QKETYSVHSTDISSGSEIS----------IKDAGVQNIEVYAEQYKKPYYRV 58
           E+E A   Q   Y + + D  S  E++           +   ++  E+ A QY   YYRV
Sbjct: 4   EKETATGVQSSAYPIEADDKDSHRELNEYGLPDKLRVTRHIVIKKTEILAAQYDSWYYRV 63

Query: 59  LLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASD 118
           +L F+ F+  Y YGLDGNIR               LLST+  +  VI AA Q+ +AR +D
Sbjct: 64  ILLFAAFICGYGYGLDGNIRYIYTGYATNAYSEHSLLSTIGVVNNVIGAASQLVYARLAD 123

Query: 119 IFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLN 178
            FGRL++ I AI+FY VGTII+SQA +V R+ AG  FY +GY G +L++ ++ +DFS+L 
Sbjct: 124 TFGRLSLFITAIVFYAVGTIIQSQAYDVQRYAAGAVFYNIGYVGVILVLLLMLSDFSSLR 183

Query: 179 WRLLALFVPALPFIINTWISGDVTSAVGGD--WKWGIGMWAFIFPLACIPLGCCMLHMRY 236
           WRLL   VP  PFIINTWISG++TSA   +  W W IGMWAFIFPL+C+PL  CM+HMR 
Sbjct: 184 WRLLYTIVPTWPFIINTWISGNITSAAKPETNWSWDIGMWAFIFPLSCVPLIACMIHMRI 243

Query: 237 LANKNSKDKLAKHVMVPKDKEWKRYFFID-------VLFWKLDMIGLLLMVCFFGCVLVP 289
            A K + + +A        K+ K YF  +        LFWKLD++G+LL++   GC+LVP
Sbjct: 244 KARK-TPEWIAL-------KQEKSYFQTNGLWDTLVELFWKLDVVGVLLLIATLGCILVP 295

Query: 290 FTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALII 349
            TLAGG NS+W   HII P V+G+V+ +P+ + WEM++++ PL P+ L+KDRGV+SAL I
Sbjct: 296 LTLAGGYNSKWNNPHIIGPFVLGFVL-VPILMFWEMRWARDPLVPYGLIKDRGVWSALAI 354

Query: 350 ATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKP 409
           + +  F + +   Y+Y +L+VAV ESVKSATRI+SL SFVS            + ++ KP
Sbjct: 355 SFLNYFIFALAAGYLYAILLVAVDESVKSATRISSLSSFVSVVWSPIFSLFITRQKKLKP 414

Query: 410 FIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQK 469
           +I+ G +MW V  GLL  YRG S +H+GIIG+LC+ G G+  +TY    S+Q+ T SH+ 
Sbjct: 415 YIVLGCAMWMVGIGLLYHYRGGSYAHSGIIGALCVWGAGSTMWTYPVNISVQSAT-SHEN 473

Query: 470 LAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNT 529
           LA +TAL    Y I            WT  L  ++ K + +  LAA AY SP+TFI++  
Sbjct: 474 LATVTALNYTLYRIGGAVGTAVSGAIWTQTLYKQLLKRLGDADLAAAAYASPYTFIVSYA 533

Query: 530 WGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELD--EKNVK 587
           WGTP R AVV AYR VQ+   I+ L FC PL+  A+ LR+  L D VA + L+  E  VK
Sbjct: 534 WGTPQREAVVGAYRHVQRYETIVALVFCAPLVIFAMCLRDPDLTDEVAHSGLEKGEYIVK 593

Query: 588 ED-DPVVDFLAKFIPSLRNKK 607
           +  DP+ D+ +     LR +K
Sbjct: 594 DQTDPISDWFSSKWSRLRERK 614

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score =  476 bits (1224), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 258/581 (44%), Positives = 354/581 (60%), Gaps = 25/581 (4%)

Query: 41  VQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNC 100
           ++  E+ A +Y    +R+LL F  F+  Y YGLD NIR               LLSTVN 
Sbjct: 79  IRQSELLAAEYDWWPFRILLLFCAFICGYGYGLDSNIRFIYTSYVTNSFSEHSLLSTVNV 138

Query: 101 IKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGY 160
           I  VI+AA QI +AR +D+FGRLT+ I A++FY +GT+I+SQ+ N+  + AG  FY +GY
Sbjct: 139 INAVISAASQIVYARLADVFGRLTLFITAVVFYSMGTVIQSQSYNIETYAAGSIFYNLGY 198

Query: 161 TGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVG--GDWKWGIGMWAF 218
            G +L++ +I +DFS+L WRL   F P  PFIINTWISG++TS      +W W IGMWAF
Sbjct: 199 VGVVLVLLLILSDFSSLKWRLFYQFAPTWPFIINTWISGNITSRANPQENWSWDIGMWAF 258

Query: 219 IFPLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYF-------FIDVLFWKL 271
           IFPL+C+PL CCMLHM + A +  + K+          E K YF       FI  LFWKL
Sbjct: 259 IFPLSCVPLICCMLHMWWKARRTEEWKILN--------EEKTYFKTHGLVSFIKELFWKL 310

Query: 272 DMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHP 331
           D IG  +M    GC+LVP TLAGG +S+W  + II P V+G VV LP+ I++E+K+++ P
Sbjct: 311 DTIGTFIMTVSLGCILVPLTLAGGTSSKWDDSQIIGPLVLG-VVLLPMLIVYELKWAREP 369

Query: 332 LTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSX 391
           + PW L+KDR V++++ I+ + +F +YM  DY+YTV++VAV ESVKSATRI+SL +FVS 
Sbjct: 370 ILPWKLIKDRAVWASMSISFLYDFIFYMAYDYLYTVMIVAVDESVKSATRISSLSAFVST 429

Query: 392 XXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGF 451
                      +V R KP+II G  +W VA GLL  +RG  +SH+GIIG LC+ G G   
Sbjct: 430 VFSPFFALYITRVTRLKPYIIAGCGLWMVAMGLLYHFRGGKSSHSGIIGGLCVWGVGTTM 489

Query: 452 FTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQ 511
           FTY    S+Q+ T SH+ +A +T+L    Y I            WT  L   I K + + 
Sbjct: 490 FTYPVNVSVQSAT-SHENMATVTSLNYTLYRIGSAVGIAVSGCIWTQNLYHEIFKRVKDA 548

Query: 512 TLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHR 571
            +A+ AY  P+ FI   TWGTP R  VV+AY  VQK+  ++GL FC PLL  +L LR+  
Sbjct: 549 KIASYAYEQPYNFIAEYTWGTPIRQQVVEAYMHVQKLETLVGLVFCAPLLLFSLCLRDPE 608

Query: 572 LEDVVALNELDEKN--VKEDDPVVDFLA----KFIPSLRNK 606
           L D +A N+L E     ++ D + D++     KF+P L  K
Sbjct: 609 LTDEIAHNDLGEGEYIARDKDYIFDWIEDKCRKFVPGLHPK 649

>KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 634

 Score =  472 bits (1214), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 251/587 (42%), Positives = 349/587 (59%), Gaps = 25/587 (4%)

Query: 35  SIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXL 94
           S K   ++  E+ AEQY    +RV+L FS FL  Y YGLDGN+R               L
Sbjct: 58  SSKSLTIRKTEILAEQYSSWQWRVVLLFSAFLCGYGYGLDGNLRSFYTTWATNSYSTHSL 117

Query: 95  LSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGC 154
           LST+  +  V+ AA QI +AR SD++GR T+ + AI+FYVVGTIIESQA +V R+ AG  
Sbjct: 118 LSTIGVVNAVMGAASQIVYARLSDVYGRFTLFVTAIVFYVVGTIIESQAHDVQRYAAGAV 177

Query: 155 FYQVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGGD--WKWG 212
           FY +GY G +LIV +I +DFS+L WRL   FVP  PFIINTWISG++      +  W W 
Sbjct: 178 FYNIGYVGVILIVLLILSDFSSLKWRLFYSFVPTWPFIINTWISGNIVDVAKPEQNWSWD 237

Query: 213 IGMWAFIFPLACIPLGCCMLHMRYLANK--------NSKDKLAKHVMVPKDKEWKRYFFI 264
           I MWAFIFPL+C+PL  CMLHM++ A +        + K     H +V    +       
Sbjct: 238 IAMWAFIFPLSCLPLLGCMLHMKWRARQTEAWKELSSQKTYYQTHGLVQSLVQ------- 290

Query: 265 DVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWE 324
             LFWKLD+IG+  M+   GC+LVP TLAGG++++W   HII P ++G+V+ +P +I WE
Sbjct: 291 --LFWKLDVIGVFFMIIILGCILVPLTLAGGISNKWNNPHIIAPFILGFVL-IPFFIAWE 347

Query: 325 MKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITS 384
            K+++ P+ P+ LL+DRG+++AL IA +INF + M   Y+YT+L+VAV+ESV SATRI+S
Sbjct: 348 SKWAREPIAPFKLLRDRGIWAALCIAFLINFIFTMAAGYLYTILMVAVNESVTSATRISS 407

Query: 385 LYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCL 444
           + +F S            +  R KPFII G S+W VA G+L  +R    S  GIIG+L +
Sbjct: 408 VSTFTSTVFSPFFALFITRFTRLKPFIIAGCSLWMVAMGILFHFRSGQNSDKGIIGALVV 467

Query: 445 LGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRI 504
            G G   FTY    S+Q+ T SH+ +A +TAL    Y I            WT +L  ++
Sbjct: 468 WGLGTTMFTYPVTVSLQSVT-SHENMATVTALSYTMYRIGSAVGSAVSGAIWTQLLYKQL 526

Query: 505 SKAI-ANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCA 563
            + +  + TLAA  YGSP T+I    WGTP R  VV+AYR VQK   ++ L F  PL   
Sbjct: 527 LQHLDGDATLAASFYGSPLTYIAQYPWGTPVRDGVVQAYRYVQKYEVLVALVFTAPLFVF 586

Query: 564 ALFLRNHRLEDVVALNELDEK---NVKEDDPVVDFLAKFIPSLRNKK 607
           +L LR+  L + VA   + +    +V++DDPV +++      +R K 
Sbjct: 587 SLCLRDPPLTNEVAHENIKQGEYVDVEDDDPVANWIHDKWSRIRRKS 633

>KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]
           {ON} similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter or YHL040C uniprot|P38731
           Saccharomyces cerevisiae YHL040C ARN1 Transporter,
           member of the ARN family of transporters that
           specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C,
          Length = 623

 Score =  471 bits (1211), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 251/565 (44%), Positives = 354/565 (62%), Gaps = 15/565 (2%)

Query: 41  VQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNC 100
           ++  E+ A+QY   Y++ +L FS+FL +Y YGLDG++R               LLST++ 
Sbjct: 51  LRKTEILAQQYDTWYWKAVLLFSVFLCSYGYGLDGSVRSVYTTYATNSYSTHSLLSTISI 110

Query: 101 IKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGY 160
           I  VI A+ Q++FAR SD+FGRLT+LI+A +FY VGTII+SQA +V R+ AG  FY VG 
Sbjct: 111 INLVIGASAQVFFARLSDVFGRLTLLIVATVFYSVGTIIQSQAYDVQRYAAGAVFYNVGL 170

Query: 161 TGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGG--DWKWGIGMWAF 218
            G +L V +I +DFS+L WRL   FVP+ PFIIN W+SG+V +A     +W W IGMWAF
Sbjct: 171 VGVVLQVILILSDFSSLRWRLFYTFVPSWPFIINMWVSGNVVNAANPLENWSWSIGMWAF 230

Query: 219 IFPLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVL---FWKLDMIG 275
           IFPL C+PL CC+LHMRY A   SK +  +H+ + K   ++ +  +  L   FWKLD++G
Sbjct: 231 IFPLTCLPLVCCILHMRYRA---SKTEAWRHLQLEK-TYYQSHGLLQTLIQLFWKLDVVG 286

Query: 276 LLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPW 335
           +LL+    GC+LVP TLAGG++ +W   H+I P V+G+V+ LP++++WE K++  P+ P+
Sbjct: 287 VLLLTVTLGCILVPLTLAGGVSQKWNNPHVIAPFVLGFVL-LPIFVVWESKWALDPIAPF 345

Query: 336 ALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXX 395
            LLKDRGV+SAL I  +I F + M   Y+YT+LV+AV ES  SATRITS+YSF +     
Sbjct: 346 ELLKDRGVWSALTIQFLIYFVYQMAVGYLYTILVIAVDESTTSATRITSVYSFTAAVASP 405

Query: 396 XXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYT 455
                  + +R KP+II G S+W VA G+L  +R    S  GIIG L L G  +  FTY 
Sbjct: 406 FFALVVTRSKRLKPYIITGCSLWMVAMGILYHFRSGKDSDKGIIGGLVLWGLTSTLFTYP 465

Query: 456 TQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAI-ANQTLA 514
              S+Q+ T SH+ +A +TAL    Y I            WT +L  ++ K +  + TLA
Sbjct: 466 VTVSLQSIT-SHENMASVTALNYTIYRIGGAVASAASGAIWTQLLYKKLLKEMNGDATLA 524

Query: 515 AEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLED 574
             AYGSPF FI+   WGTP R A+V++YR VQK   ++ L F +P+   ++FLR+  L D
Sbjct: 525 TAAYGSPFDFILDYPWGTPMRDAMVESYRYVQKYEVLVALIFTVPMFILSMFLRDPPLTD 584

Query: 575 VVALNELDEK---NVKEDDPVVDFL 596
             A   L E    N + DDP++ ++
Sbjct: 585 DQAQENLKEGEYINTEHDDPILAWM 609

>TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score =  464 bits (1195), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 252/602 (41%), Positives = 356/602 (59%), Gaps = 11/602 (1%)

Query: 4   ESSHSNQGEEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFS 63
           E    + GE++  Q +++     D +   + + +   ++  E+ A QY K Y+ + L F+
Sbjct: 22  EFQTDSDGEKKNIQNQSF--QDIDENDVPKTAKRAMVIRKTEIMAAQYNKWYHHLFLLFT 79

Query: 64  LFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRL 123
            F+  Y YGLDGNIR               LLSTV  I  V++A  QI+      +FGRL
Sbjct: 80  AFICGYGYGLDGNIRYIYTGYATSSYAEHSLLSTVTVINAVVSAVSQIYTPDFQIVFGRL 139

Query: 124 TML-IIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLL 182
            ++ ++AI+ Y VGTII+SQA +V R+ AG  FY  GY+G + I+ +I +DFS+L WRL 
Sbjct: 140 YIIFLVAIVLYSVGTIIQSQAYDVQRYAAGAIFYNAGYSGVLFILLIILSDFSSLKWRLA 199

Query: 183 ALFVPALPFIINTWISGDVTSAVG--GDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANK 240
             F P  PFIINTWISG++TSA     +W W IGM AFI PL+C+P   CM+HM + A K
Sbjct: 200 YQFAPTWPFIINTWISGNITSAANPIENWSWDIGMRAFIIPLSCLPFIACMIHMEWKARK 259

Query: 241 NSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEW 300
             + K         ++    +  +  LFW+LD+ GL+LM    GC+LVP TLAGG +S+W
Sbjct: 260 TPEWKELLKEKTFYEEHNGLWGTLVELFWRLDVAGLILMGSSLGCILVPLTLAGGTSSKW 319

Query: 301 KTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQ 360
              ++I P ++G+V+ +P + LWE  F++ PL P  L+KDRGV+SA+ I+ +I+F +YM 
Sbjct: 320 NHGNVIGPFILGFVL-IPFFALWEKFFARDPLLPAKLVKDRGVWSAMGISFLIDFIYYMA 378

Query: 361 GDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFV 420
            DY+YTVL+VAV ESVKSATRI+SL SFVS            +  R KP+I+ G S+W +
Sbjct: 379 ADYLYTVLIVAVDESVKSATRISSLSSFVSTVASPFFALYLTRCSRLKPWIMLGCSLWML 438

Query: 421 AFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAA 480
           A GLL  +RG   SH+GIIG+LC+ G G   FTY    S+QA   SH+ +A +TA     
Sbjct: 439 AMGLLYYFRGGRESHSGIIGALCVWGVGTTLFTYPVTVSVQAAV-SHENMATVTAANYTL 497

Query: 481 YNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGT-PDRMAVV 539
           Y I            WT  L  ++ K + +  LA  AY SP+TF     WGT P+R AVV
Sbjct: 498 YRIGSAIGAAVSGAIWTQTLYKQLYKHLQDIALATAAYSSPYTFTTNYAWGTPPEREAVV 557

Query: 540 KAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKN--VKED-DPVVDFL 596
           +AYR VQ++  ++ L FC+PL+  +L LR+ RL D VA   + E    VK D DP+ +F 
Sbjct: 558 QAYRYVQRLETVVALVFCVPLIAFSLCLRDARLTDEVAHGNIAEGEIIVKSDSDPISEFF 617

Query: 597 AK 598
            K
Sbjct: 618 VK 619

>SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 617

 Score =  447 bits (1150), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 248/589 (42%), Positives = 355/589 (60%), Gaps = 34/589 (5%)

Query: 37  KDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLS 96
           K   ++  E+ A QY   YYRV+L FS F+  + YGLD NIR               LLS
Sbjct: 43  KSLVIRKTEILAAQYDSWYYRVILLFSAFICGFGYGLDSNIRYIYTGYATSSYAQHSLLS 102

Query: 97  TVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFY 156
           TV  I  +++AA QI++AR SD+FGRL++ +++++FYV+GTII+SQA +V ++ AG  FY
Sbjct: 103 TVAIINNLLSAASQIFYARLSDVFGRLSLFVVSMVFYVIGTIIQSQAYDVQKYAAGAVFY 162

Query: 157 QVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGG--DWKWGIG 214
            +GY G  LI+ +I +D S+L WRL   + P  PFII TWISG++ S      +W WGIG
Sbjct: 163 NIGYVGLFLILVLILSDCSSLKWRLFYQYAPTWPFIIITWISGNIISRANPIENWSWGIG 222

Query: 215 MWAFIFPLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFF--------IDV 266
           MWAFIFPL C+P+  CMLHMR+ A K  +          +D   ++ FF        +  
Sbjct: 223 MWAFIFPLTCLPILFCMLHMRFKARKTPE---------WQDLSSQKSFFQTHGIVQALVQ 273

Query: 267 LFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMK 326
           LFWKLD++G+ +M    GC+LVP TLAGG +S+W+ + II P V+G+V+ +P++I WE K
Sbjct: 274 LFWKLDVVGIFIMTISLGCILVPLTLAGGSSSKWQNSEIIGPLVLGFVL-VPVFIYWESK 332

Query: 327 FSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLY 386
           ++K PL P+ LLKDRG+++++    +++F + M   Y+Y VL+VAV ES KSATRITSL 
Sbjct: 333 WAKDPLAPFELLKDRGIWASMCFNFLMDFVYCMAAGYLYPVLIVAVDESTKSATRITSLA 392

Query: 387 SFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLG 446
           SFVS            +  R KP+I+ G  MWF+A GLL  YR    SH+GIIG L LLG
Sbjct: 393 SFVSTVASPFMGYAVSRSTRLKPYIVSGCGMWFLATGLLYHYRSGLESHSGIIGGLVLLG 452

Query: 447 FGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISK 506
            G     Y    S Q+ T SH+ +A +TAL    Y I            WT  L + + K
Sbjct: 453 LGCTLSIYPINVSAQSLT-SHENMASVTALNYTVYRIGGAVGVAVSGAIWTQTLYNDLLK 511

Query: 507 AIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALF 566
            + + TLA  AY +P++F++T  W TP R AVV+AYR+VQ++  +I L F  PLL ++LF
Sbjct: 512 RLGDATLAMSAYSAPYSFVLTYGWDTPVRQAVVEAYREVQRLEVLIALIFTAPLLLSSLF 571

Query: 567 LRNHRLEDVVALNELDEKNVKE--------DDPVVDFLAKFIPSLRNKK 607
           LR+  L D     ++ ++N+K+        +DP+ D+L      L+ K+
Sbjct: 572 LRDPPLTD-----QVGQENIKDGEYVATGYNDPITDWLTGKFKFLKRKR 615

>KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score =  445 bits (1144), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 240/618 (38%), Positives = 354/618 (57%), Gaps = 22/618 (3%)

Query: 2   SLESSHSNQGEEEIAQKETYSVHST--DISSGSEISI-KDAGVQNIEVYAEQYKKPYYRV 58
           S  + + N G+  + Q E    H +  +   G ++ I K   ++  E+ A QY     + 
Sbjct: 13  SESTPNENYGKANVVQTEKEFSHDSKNEPELGDKLQITKRIVIRKAELMANQYDGWLLKS 72

Query: 59  LLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASD 118
           +  FS F+ A++YGLD  IR               LLSTV+ I   I+A  QI+FA  SD
Sbjct: 73  MFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLLSTVSVISLTISAVAQIFFAGLSD 132

Query: 119 IFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLN 178
           +FGRL+M I+AI+FYVVGT+I+SQA +V R+ AG  FY +G  G+M  V ++ +D S+L 
Sbjct: 133 VFGRLSMFIVAIMFYVVGTVIQSQAYDVQRYAAGSIFYYIGLVGSMFQVTLMLSDCSSLK 192

Query: 179 WRLLALFVPALPFIINTWISGDVTSAVGGD--WKWGIGMWAFIFPLACIPLGCCMLHMRY 236
           WRLL  FVPA P ++  WISG+V      +  W WGI MWAFIFP  C+P+  C+LHMR+
Sbjct: 193 WRLLYNFVPAWPALVTVWISGNVVHVANPEKNWSWGIAMWAFIFPATCLPIIGCLLHMRW 252

Query: 237 LANKNSKDKLAKHVMVPKDKEWKRYF-------FIDVLFWKLDMIGLLLMVCFFGCVLVP 289
               NS+ K        + +E K YF        +  LFWKLD++G+LL     GC+L+P
Sbjct: 253 KLRNNSEWK--------ELQEEKTYFQTHGLVQTLKQLFWKLDVVGVLLFSVSTGCILIP 304

Query: 290 FTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALII 349
            T+AGG ++ W++A +I P V+G  + +P +I WE K +  PL P+ +LKDRG+++ L+I
Sbjct: 305 LTIAGGASTHWRSAKVIAPLVLG-SLLVPFFIYWESKLALVPLAPFKMLKDRGIWAPLLI 363

Query: 350 ATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKP 409
             +I F + M   Y+YT+L+VA +ES  SATRITSLYSFV+            +  R KP
Sbjct: 364 TFLICFIYMMAAGYLYTILLVAGNESSLSATRITSLYSFVAAVFSPVVGIFVARFSRLKP 423

Query: 410 FIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQK 469
           F +FG S++FV   L   +RG + +  G+IG++ + G  + FF Y    S+Q  T SH+ 
Sbjct: 424 FAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVVWGITSCFFNYPINISMQTVT-SHEN 482

Query: 470 LAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNT 529
           +A +TA  L  + I            WT  L  R+ KA+ + TLA EAY  P +F++ + 
Sbjct: 483 MATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLKALGDPTLALEAYNMPLSFMLKHE 542

Query: 530 WGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKED 589
           WGTP R A+++AYR VQK   ++GL F  P+     FLR+  L +       D++ VK D
Sbjct: 543 WGTPARDAMIEAYRYVQKYEVLVGLIFVAPMFLLTFFLRDPPLTEDYGQKLEDDEYVKHD 602

Query: 590 DPVVDFLAKFIPSLRNKK 607
           DP+ D++A+   S +  +
Sbjct: 603 DPITDWIAERFSSFKKHE 620

>KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 620

 Score =  445 bits (1144), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 240/618 (38%), Positives = 354/618 (57%), Gaps = 22/618 (3%)

Query: 2   SLESSHSNQGEEEIAQKETYSVHST--DISSGSEISI-KDAGVQNIEVYAEQYKKPYYRV 58
           S  + + N G+  + Q E    H +  +   G ++ I K   ++  E+ A QY     + 
Sbjct: 13  SESTPNENYGKANVVQTEKEFSHDSKNEPELGDKLQITKRIVIRKAELMANQYDGWLLKS 72

Query: 59  LLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASD 118
           +  FS F+ A++YGLD  IR               LLSTV+ I   I+A  QI+FA  SD
Sbjct: 73  MFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLLSTVSVISLTISAVAQIFFAGLSD 132

Query: 119 IFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLN 178
           +FGRL+M I+AI+FYVVGT+I+SQA +V R+ AG  FY +G  G+M  V ++ +D S+L 
Sbjct: 133 VFGRLSMFIVAIMFYVVGTVIQSQAYDVQRYAAGSIFYYIGLVGSMFQVTLMLSDCSSLK 192

Query: 179 WRLLALFVPALPFIINTWISGDVTSAVGGD--WKWGIGMWAFIFPLACIPLGCCMLHMRY 236
           WRLL  FVPA P ++  WISG+V      +  W WGI MWAFIFP  C+P+  C+LHMR+
Sbjct: 193 WRLLYNFVPAWPALVTVWISGNVVHVANPEKNWSWGIAMWAFIFPATCLPIIGCLLHMRW 252

Query: 237 LANKNSKDKLAKHVMVPKDKEWKRYF-------FIDVLFWKLDMIGLLLMVCFFGCVLVP 289
               NS+ K        + +E K YF        +  LFWKLD++G+LL     GC+L+P
Sbjct: 253 KLRNNSEWK--------ELQEEKTYFQTHGLVQTLKQLFWKLDVVGVLLFSVSTGCILIP 304

Query: 290 FTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALII 349
            T+AGG ++ W++A +I P V+G  + +P +I WE K +  PL P+ +LKDRG+++ L+I
Sbjct: 305 LTIAGGASTHWRSAKVIAPLVLG-SLLVPFFIYWESKLALVPLAPFKMLKDRGIWAPLLI 363

Query: 350 ATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKP 409
             +I F + M   Y+YT+L+VA +ES  SATRITSLYSFV+            +  R KP
Sbjct: 364 TFLICFIYMMAAGYLYTILLVAGNESSLSATRITSLYSFVAAVFSPVVGIFVARFSRLKP 423

Query: 410 FIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQK 469
           F +FG S++FV   L   +RG + +  G+IG++ + G  + FF Y    S+Q  T SH+ 
Sbjct: 424 FAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVVWGITSCFFNYPINISMQTVT-SHEN 482

Query: 470 LAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNT 529
           +A +TA  L  + I            WT  L  R+ KA+ + TLA EAY  P +F++ + 
Sbjct: 483 MATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLKALGDPTLALEAYNMPLSFMLKHE 542

Query: 530 WGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKED 589
           WGTP R A+++AYR VQK   ++GL F  P+     FLR+  L +       D++ VK D
Sbjct: 543 WGTPARDAMIEAYRYVQKYEVLVGLIFVAPMFLLTFFLRDPPLTEDYGQKLEDDEYVKHD 602

Query: 590 DPVVDFLAKFIPSLRNKK 607
           DP+ D++A+   S +  +
Sbjct: 603 DPITDWIAERFSSFKKHE 620

>Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C
           (ARN1) - Product of gene unknown [contig 187] FULL
          Length = 610

 Score =  444 bits (1142), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 236/576 (40%), Positives = 335/576 (58%), Gaps = 24/576 (4%)

Query: 35  SIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXL 94
           S K   ++  E+ A  Y + Y+ V L F+ FL  Y YGLDGNIR               L
Sbjct: 35  STKSLNIRKTELMASCYDRWYHHVFLLFAAFLCGYGYGLDGNIRSVYTSYAAASYAAHPL 94

Query: 95  LSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGC 154
           +ST++ +  V++AA QI+FAR SD+FGRL++ + AI FYVVGTII+SQA ++ R+  G  
Sbjct: 95  ISTLSVVTGVMSAASQIFFARLSDVFGRLSLFVTAIAFYVVGTIIQSQAYDIQRYAVGSV 154

Query: 155 FYQVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVT--SAVGGDWKWG 212
           F+ +GY G +L++ +I +DFS+L WRLL  F P+ P IINTWI+G +T  S     W W 
Sbjct: 155 FWSIGYVGILLMLILIVSDFSSLRWRLLYQFAPSWPGIINTWIAGTITARSNPQEKWSWN 214

Query: 213 IGMWAFIFPLACIPLGCCMLHMRYLAN--------KNSKDKLAKHVMVPKDKEWKRYFFI 264
           IGMWAFI PL C+P+  CMLHMR+ A         +N +     H ++    E       
Sbjct: 215 IGMWAFIIPLTCLPMILCMLHMRFKARRTEQWAELRNERSYYQTHGLIKTLIE------- 267

Query: 265 DVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWE 324
             LFWK+D++G+LLM    GCVL P TLAGG  S+W+   +I P V+G+V+ LP++++WE
Sbjct: 268 --LFWKVDVVGILLMTASIGCVLAPLTLAGGTGSKWQNPRVISPFVLGFVL-LPIFLIWE 324

Query: 325 MKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITS 384
            K+++ P+ P+ L+KDR V+++L    +I F + M   Y+Y +L+V V+ES+KSAT IT 
Sbjct: 325 KKWARDPIIPYDLIKDRAVWASLNSQFLIGFIYMMAAGYIYNILIVGVNESIKSATTITI 384

Query: 385 LYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCL 444
           L SFV+            +  R K +I+ G  +W +A GL   YRG   +H GI+ ++ +
Sbjct: 385 LSSFVATAASPPFCLWITRCTRMKGYIVAGCGLWMLAMGLFYHYRGGEFAHGGIVAAMVV 444

Query: 445 LGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRI 504
            G G     Y    S+Q+ T SH  +A++TAL    Y I            WT  L   +
Sbjct: 445 WGLGDVLLIYPITVSVQSAT-SHDNMAMVTALNYTTYRIGLSTGSAISGAIWTQTLYKEL 503

Query: 505 SKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAA 564
            K + + TLA  AY  PF FI T TWGTP+R AVV+AYR VQ+   I+ L F +PLL   
Sbjct: 504 FKRLGDATLAVSAYSDPFKFITTYTWGTPEREAVVQAYRHVQRYETIVALVFTVPLLIFV 563

Query: 565 LFLRNHRLEDVVALNEL-DEKNVKED--DPVVDFLA 597
           LFLR+  L D VA   + D + V +D  DP+  + A
Sbjct: 564 LFLRDPPLTDEVAHGSIKDGEYVAKDHEDPIFSWFA 599

>KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]
           {ON} similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 607

 Score =  441 bits (1135), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 242/616 (39%), Positives = 348/616 (56%), Gaps = 25/616 (4%)

Query: 6   SHSNQGEEEIAQKETYSVHSTDISSGSEI-SIKDAGVQNIEVYAEQYKKPYYRVLLFFSL 64
           S  N        K    V    ++ G  + + K   ++  E+ A QY + Y+  ++ FS 
Sbjct: 2   SKDNASSAHADLKNEVYVDVEKVTPGCTLKTTKSLVIRKTEIMAAQYDRWYHHAIILFSA 61

Query: 65  FLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRLT 124
           F+  Y YGLDG++R               L+ST+  +  +I+AA QI FAR SD+FGRL+
Sbjct: 62  FICGYGYGLDGSVRYVYTSYAVSSYSDHPLISTITVVTAIISAASQIVFARLSDVFGRLS 121

Query: 125 MLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLAL 184
           + I A+LFY VGTII+SQAT+V ++ AG  F+  GY G +LI+ +I +DFS+L WRL+  
Sbjct: 122 LFITALLFYAVGTIIQSQATDVQKYAAGAIFWSTGYVGLLLILILILSDFSSLRWRLVYQ 181

Query: 185 FVPALPFIINTWISGDVTSAVGGD--WKWGIGMWAFIFPLACIPLGCCMLHMRYLAN--- 239
           F P+ P+IINTW +G VT+       W W I MWAFI PL+ +P+  CMLHMR+ A    
Sbjct: 182 FAPSWPYIINTWFAGTVTARANPQEHWSWDIAMWAFIVPLSALPMIFCMLHMRFKARKTE 241

Query: 240 -----KNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAG 294
                K+ K     H ++    E         LFWKLD++G+LLM    GC+L P TLAG
Sbjct: 242 QWAAIKDEKSFFQSHGLIRTLVE---------LFWKLDIVGVLLMTISVGCILAPLTLAG 292

Query: 295 GMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMIN 354
           G+ S+W   H+I P V+G+V+ LPL+++WE K +K+P+ P+ L+KDR V+ AL    +I 
Sbjct: 293 GVKSKWSNPHLIGPLVLGFVL-LPLFMIWESKAAKYPVVPYGLIKDRAVWGALGCQFLIG 351

Query: 355 FCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFG 414
           F +     Y+YT+L+VAV+ESVKSAT I+SL SFVS            +  + K +II G
Sbjct: 352 FIYNAVAGYIYTILIVAVNESVKSATVISSLSSFVSTVASTFFSLYITRCTKLKGYIIGG 411

Query: 415 ISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVIT 474
             +W +A GL   YRG   +H+GI+G++ + G G     Y T  S+Q+ T SH  +A +T
Sbjct: 412 CGIWMLAMGLFYHYRGGEFAHSGIVGAMVIWGLGDTLLIYPTTISVQSAT-SHDNMATVT 470

Query: 475 ALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPD 534
           AL    Y I            W+  L   +   + +   A+ AY +PF FI+T TWGTP+
Sbjct: 471 ALNYTLYRIGLATGAAVSGAIWSQTLYKALLSRLQSVEQASAAYSTPFEFILTYTWGTPE 530

Query: 535 RMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEK---NVKEDDP 591
           R A+V AYR VQ+   I+ L F +PLL   L LR+  L D VA  ++D+    +   DDP
Sbjct: 531 RNAMVDAYRHVQRYESIVALVFTVPLLFFGLCLRDPPLTDKVAQEDIDDGEFLDKNHDDP 590

Query: 592 VVDFLAKFIPSLRNKK 607
           + ++L      L NK 
Sbjct: 591 IAEWLVGKYRRLANKN 606

>Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C
           (ARN2) - 1:1 [contig 275] FULL
          Length = 618

 Score =  439 bits (1130), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 235/610 (38%), Positives = 352/610 (57%), Gaps = 25/610 (4%)

Query: 2   SLESSHSN-QGEEEIAQKE--TYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRV 58
           +L+  HS   G+  +A+K+    + H   ++   +++ K   ++  E+ A QY   + + 
Sbjct: 12  ALQDDHSEIDGKTNVAEKQCDKDATHQHGLTDKLQMT-KRIVIRKTELMANQYDNWFLKS 70

Query: 59  LLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASD 118
           L  FS F+ A++YGLD  IR               LLSTV+ I   I+A  QI+FA  SD
Sbjct: 71  LFLFSAFICAFSYGLDSIIRNIYMTYAMNSYSTHSLLSTVSVISLTISAVAQIFFAGLSD 130

Query: 119 IFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLN 178
           +FGRL+M I+AI+FYVVGTII+SQA +V R+ AG  FY +G  G+M  + +I +D S+L 
Sbjct: 131 VFGRLSMFIVAIMFYVVGTIIQSQAYDVQRYAAGSIFYYIGLVGSMFEITLILSDCSSLK 190

Query: 179 WRLLALFVPALPFIINTWISGDVTSAVGG--DWKWGIGMWAFIFPLACIPLGCCMLHMRY 236
           WRL   FVPA P ++  WISG+V S      +W WGI MWAFIFP +C+P+  C+LHMR+
Sbjct: 191 WRLFYSFVPAWPALVTVWISGNVVSVANPLENWSWGIAMWAFIFPASCLPIIGCLLHMRW 250

Query: 237 LANKN--------SKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLV 288
               N         K     H +V   K+         LFWKLD++G+LL     GC+LV
Sbjct: 251 KLRNNPEWIELQEEKTYFQTHGLVQTLKQ---------LFWKLDVVGVLLFSISTGCILV 301

Query: 289 PFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALI 348
           P TLAGG +++W++A +I P V+G+++ +P++I WE K +  PL P+ +LKDRG+++ L+
Sbjct: 302 PLTLAGGASTQWRSAKVIAPFVLGFLL-VPVFIYWESKLALVPLAPFKMLKDRGIWAPLV 360

Query: 349 IATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTK 408
           I  +I + + M   Y+YT+LVVA +ES  SATRITSLYSFV+            +  R K
Sbjct: 361 ITFLICYIYMMAAGYLYTILVVAGNESPLSATRITSLYSFVAAVFSPVVGIFVARFTRLK 420

Query: 409 PFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQ 468
           PF +FG S++FV   L   +RG + +  G+IG++ + G  + FF Y    S+Q  T SH+
Sbjct: 421 PFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVIWGITSCFFNYPINISMQTVT-SHE 479

Query: 469 KLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITN 528
            +A +TA  L  + I            WT  L  R+ K + +  +A EAY  P +F++ +
Sbjct: 480 NMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLKTLGDPNMAIEAYSMPLSFVLKH 539

Query: 529 TWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKE 588
            WGT  R  +V+AYR VQ+   ++GL F  P+     FLR+  L +       D + +K+
Sbjct: 540 EWGTSAREGMVEAYRYVQRYEVLVGLIFVAPMFLLTFFLRDPPLTEDYGQKLDDNEYLKQ 599

Query: 589 DDPVVDFLAK 598
           DDP+ D+LA+
Sbjct: 600 DDPITDWLAE 609

>TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON} 
          Length = 621

 Score =  436 bits (1120), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 236/578 (40%), Positives = 343/578 (59%), Gaps = 13/578 (2%)

Query: 37  KDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLS 96
           K   ++  E+ A+QY   + + L  FS FL ++ YGLDGNIR               L+S
Sbjct: 50  KSLVIRKAELMAKQYDTWFLKSLFLFSAFLCSFGYGLDGNIRGIYMTYAMNSYSTHSLIS 109

Query: 97  TVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFY 156
           TV  I  VI+A  Q+ +A  SD+FGRL++ I++I+FYVVGTII+SQA +V R+ AG  FY
Sbjct: 110 TVGVISMVISAVAQVIYAGLSDVFGRLSLFIVSIVFYVVGTIIQSQAYDVQRYAAGSVFY 169

Query: 157 QVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDV--TSAVGGDWKWGIG 214
            VG  G ML V ++ +D S+L WRL   FVPA P II TW+SG+V  T+    +W W I 
Sbjct: 170 SVGLVGVMLQVILVLSDNSSLKWRLFYTFVPAWPSIITTWVSGNVIETANPEDNWSWNIA 229

Query: 215 MWAFIFPLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDV---LFWKL 271
           MWAFIFPL+CIPL  CMLHMR+   K   +   K +   K   ++ +  I     LFWKL
Sbjct: 230 MWAFIFPLSCIPLIACMLHMRW---KVRNEPEWKELQTEK-TYYQSHGLIQTVVQLFWKL 285

Query: 272 DMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHP 331
           D++G++L+    GC+LVP TLAGG++++W++A +I P V+G+V+ + ++I WE K +  P
Sbjct: 286 DVVGIILLTVGTGCILVPLTLAGGVSTQWQSAKLIAPFVLGFVL-IAIFIYWESKLALAP 344

Query: 332 LTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSX 391
           + P+ +LKDRG+++ L I  +I F + M   Y+YT+L+VAV E+  SATRITSLYSFVS 
Sbjct: 345 IAPFKMLKDRGIWAPLWIMFLIAFVYQMAAGYLYTILMVAVDETDLSATRITSLYSFVSA 404

Query: 392 XXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGF 451
                      +  R KP+++ G S++FV  GL  RYR    +H G+IG++ + G  +  
Sbjct: 405 IFAPVLGFIVARSSRLKPYMVLGCSLYFVTMGLFYRYRVGKDAHQGVIGAMVVWGICSCL 464

Query: 452 FTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQ 511
           F Y    SIQ+ T SH+ +A +TAL    ++I            WT +L  ++ + I + 
Sbjct: 465 FDYPVTVSIQSVT-SHENMATVTALSYTIFSIGGAVAASVSGAIWTQLLYPKLLEYIGDA 523

Query: 512 TLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHR 571
            LA  AY SP TF +   WGTP R A+V+AY+ VQK   +I L F  P+      LR+  
Sbjct: 524 DLAEAAYSSPLTFYLDYPWGTPIRDAMVEAYKHVQKYEVLIALVFTAPMFILTFCLRDPS 583

Query: 572 LEDVVA--LNELDEKNVKEDDPVVDFLAKFIPSLRNKK 607
           L D VA  LN+ +      DDP+ +++      LR+++
Sbjct: 584 LTDDVAQKLNDGEYVETSHDDPISEWVTSRFSKLRHRE 621

>SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score =  429 bits (1104), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 236/606 (38%), Positives = 345/606 (56%), Gaps = 23/606 (3%)

Query: 5   SSHSNQGEEEIAQKETYSVHSTDISSGSEI--SIKDAGVQNIEVYAEQYKKPYYRVLLFF 62
           SS +N     +  +E +S  + +    ++     K   ++  E+ A QY     + L  F
Sbjct: 17  SSETNGKTNVVETEEQFSKEADNEHELADKFHVTKRIVIRKSELMANQYDNWVLKSLFLF 76

Query: 63  SLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGR 122
           S F+ +++YGLD  IR               LLSTVN I   I+A  QI+FA  SD+FGR
Sbjct: 77  SAFICSFSYGLDSIIRNIYMTYAMNNYETHSLLSTVNVISMTISAVAQIFFAGLSDVFGR 136

Query: 123 LTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLL 182
           L++ I+ I+FYVVGTII+SQA +V R+ AG  FY +G  GAM  V ++ +D S+L WRL 
Sbjct: 137 LSIFIVTIVFYVVGTIIQSQAYDVQRYAAGSIFYNIGLVGAMFQVTLMLSDSSSLKWRLF 196

Query: 183 ALFVPALPFIINTWISGDVTSAVG--GDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANK 240
             FVPA P ++  WISGDV +      +W WGI MWAFIFP  C+P+  C+LHMR+   K
Sbjct: 197 YNFVPAWPAVVTVWISGDVINVANPKQNWSWGIAMWAFIFPATCLPIIGCLLHMRW-KLK 255

Query: 241 NSKDKLAKHVMVPKDKEWKRYFF--------IDVLFWKLDMIGLLLMVCFFGCVLVPFTL 292
           N  +         KD + K+ +F        +  LFWKLD +G+LL     GC+LVP T+
Sbjct: 256 NDPEW--------KDLQEKKTYFQTHGLVQTLKQLFWKLDAVGVLLFSVSTGCILVPLTI 307

Query: 293 AGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATM 352
           AGG++++W++A II P V+G V+ L ++I WE K +  PL P+ +LKDRG+++ L++  +
Sbjct: 308 AGGVSTQWRSAKIIAPIVLGSVLVL-VFIYWESKLALVPLAPFKMLKDRGIWAPLLLMFL 366

Query: 353 INFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFII 412
           + F + M  DY+YT+L+VA +ES  SATRITSLYSFV+            +  R KPF  
Sbjct: 367 VCFVYVMPADYLYTILLVAGNESSLSATRITSLYSFVTAVLSAAAGILVTRFPRLKPFAF 426

Query: 413 FGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAV 472
           FG +++FV   L   +RG   +  G+IG++ + G  + FF Y    S+Q  T SH+ +A 
Sbjct: 427 FGCALYFVTMALFYCFRGGEDTGKGVIGAMVVWGVASCFFDYPINISMQTVT-SHENMAT 485

Query: 473 ITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGT 532
           +TAL LA + I            WT  L  R+ K + +  +A EAY  P +F++ + WGT
Sbjct: 486 VTALGLAIFRIGGAVGAAVSGAIWTQTLYPRLLKTLGDPDMAIEAYDMPLSFMLEHEWGT 545

Query: 533 PDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKEDDPV 592
           P R A+V +YR VQK   ++GL F  P+      LR+  L +       D + VK DDP+
Sbjct: 546 PVREAMVDSYRYVQKYEVLVGLVFVAPMFLLTFCLRDPPLTEDYGQRLEDNEYVKHDDPI 605

Query: 593 VDFLAK 598
            D++AK
Sbjct: 606 TDWIAK 611

>Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C
           (ARN2) - Triacetylfusarinine C transporter [contig 246]
           FULL
          Length = 619

 Score =  429 bits (1103), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 239/616 (38%), Positives = 357/616 (57%), Gaps = 24/616 (3%)

Query: 4   ESSHSNQGEEEIAQKETYS--VHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLF 61
           E S +N G+  I +K+     VH  ++    +++ K   ++  E+ A+QY   + + +  
Sbjct: 16  EVSQTN-GKTIIVEKQCSKDVVHEHELPDKLQVT-KSIIIRKSELMAKQYDSWFSKSVFL 73

Query: 62  FSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFG 121
            + F+ ++AYGLD  IR               LLSTVN +  +I+A GQI+FA  SD+FG
Sbjct: 74  LAAFICSFAYGLDSIIRDIYMTYAMDDYAEHSLLSTVNVVSLMISAVGQIFFAGLSDVFG 133

Query: 122 RLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRL 181
           RL++ ++AI+FYVVGTII+SQA +V R+ AG  FY +G  GA+  V +I +D S+L WRL
Sbjct: 134 RLSLFVVAIIFYVVGTIIQSQAYDVGRYVAGSIFYNIGLVGAIFQVTIILSDCSSLKWRL 193

Query: 182 LALFVPALPFIINTWISGDV--TSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLAN 239
              FVPA P  +  WISG+V   +    +W WGIGMW FIFP +C+PL  CMLHMR+   
Sbjct: 194 FYNFVPAWPAFVTVWISGNVIHIANPSENWSWGIGMWGFIFPASCLPLIACMLHMRW--- 250

Query: 240 KNSKDKLAKHVMVPKDKEWKRYF-------FIDVLFWKLDMIGLLLMVCFFGCVLVPFTL 292
           K   D+  K +     +E K YF        +  LFWKLD+ G+LL+    GC+LVP T+
Sbjct: 251 KVKNDREWKEL-----QEEKSYFQTHGVVQSLVQLFWKLDVAGVLLLTACTGCILVPLTI 305

Query: 293 AGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATM 352
           AGG++++W++A +I P V+G+ + +P+++ WE + +  PL P+ +LKDRG+++ L I  +
Sbjct: 306 AGGVSAQWRSAKVIAPFVLGFAL-VPVFLYWESRIALVPLAPFKMLKDRGIWAPLAIMFL 364

Query: 353 INFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFII 412
           I F + M   Y+YTVL+VA +ES  SATRITSLYSFV+            +  R KP+ +
Sbjct: 365 ICFIYQMAAGYLYTVLLVAANESDLSATRITSLYSFVAAIFSPILGVLVARSTRLKPYTL 424

Query: 413 FGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAV 472
            G S++FV  GL   YRG   +  GIIG++ + G  +  + Y    S+Q  T SH+ +A 
Sbjct: 425 VGCSLYFVTMGLFYHYRGGEDAGKGIIGAMVVWGISSCLYDYPISISMQTVT-SHEMMAT 483

Query: 473 ITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGT 532
           +TAL L  + I            WT  L  ++ K + +  +AA+AY  P TFI    WGT
Sbjct: 484 VTALNLTIFRIGGAVGAAVSGAIWTQALYPKLLKLLGDPEMAAKAYDEPLTFIPDYEWGT 543

Query: 533 PDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKE-DDP 591
             R A V+AYR VQK   ++GL F  P+     FLR+  L +    N  D++ VKE DDP
Sbjct: 544 SVRDATVEAYRYVQKYEVLVGLIFVAPMFVLTFFLRDPSLTEEYGQNLEDDEYVKENDDP 603

Query: 592 VVDFLAKFIPSLRNKK 607
           + D++ +    L+ ++
Sbjct: 604 INDWIMERFSRLKKQE 619

>KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 619

 Score =  428 bits (1101), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 225/571 (39%), Positives = 338/571 (59%), Gaps = 8/571 (1%)

Query: 41  VQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNC 100
           ++  E+ A+QY   + + L  F++F+ ++AYGLD  IR               LLSTVN 
Sbjct: 53  IRKAELMAKQYDSWFLKSLFLFTVFICSFAYGLDSIIRDIYMTYAMNAYETHSLLSTVNV 112

Query: 101 IKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGY 160
           I  VI+A GQI+FAR SD+FGRL++ I++I+ YVVGT+I+SQA +V R+ AG  FY VG 
Sbjct: 113 ISMVISAVGQIFFARLSDVFGRLSLFIVSIVLYVVGTVIQSQAYDVQRYAAGSVFYNVGL 172

Query: 161 TGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVG--GDWKWGIGMWAF 218
            GAM  V +I +D S L WRL   FVPA P II  WISG+V        +W WGI MWAF
Sbjct: 173 VGAMFQVTLILSDCSTLKWRLFYNFVPAWPAIITVWISGNVVHVANPLENWSWGIAMWAF 232

Query: 219 IFPLACIPLGCCMLHMRY-LANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLL 277
           IFP++CIP   C+LHMR+ + N +   +L +     +     + F    LFW+LD++G++
Sbjct: 233 IFPVSCIPFIACILHMRWKVRNSHEWRELQEEKSFYQTHGLVQTFV--QLFWRLDVVGVI 290

Query: 278 LMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWAL 337
           L+  F GC+ VP T+AGG+++EW++  +I P V+G+ + +P ++ WE + ++ PL P+ +
Sbjct: 291 LLSVFTGCICVPLTVAGGVSTEWRSGKVIAPFVLGFSL-IPAFVYWESRLARFPLAPFLM 349

Query: 338 LKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXX 397
           LKDRG+++ L I  +I F + M  +Y+YT+L+VA +ES  SA RITSLYSFV+       
Sbjct: 350 LKDRGIWAPLWIYFLIAFIYEMAAEYLYTILLVAANESDLSAIRITSLYSFVAAIFSPIV 409

Query: 398 XXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQ 457
                +  R KP+ + G S++FV  GL   YRG + +  G+IG++ + G  +  + Y   
Sbjct: 410 GLLVARSSRLKPYTVVGCSLYFVTMGLFYHYRGGNDAGKGVIGAMVVWGITSCLYDYPIS 469

Query: 458 ASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEA 517
            SIQ  T SH+ LA ++AL    + I            WT  L  ++ KA+ +  +A  A
Sbjct: 470 VSIQTVT-SHENLANVSALSSTIFRIGGAVGAAVSGAIWTQTLYPKLLKALGDAGMAEAA 528

Query: 518 YGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVA 577
           + SP  FI    WGTP R A V+A++ VQK   ++GL F +P+     FLR+  L +   
Sbjct: 529 FNSPLDFITDYDWGTPVREATVEAFQYVQKYEVLVGLIFVVPMFVMTFFLRDPPLNEEFG 588

Query: 578 LNELDEKNVKE-DDPVVDFLAKFIPSLRNKK 607
            N   E+ VKE DDP+ D++A+ +   + + 
Sbjct: 589 QNLNGEEYVKENDDPINDWIAERLSRFKKQD 619

>SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score =  427 bits (1099), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 236/596 (39%), Positives = 340/596 (57%), Gaps = 24/596 (4%)

Query: 13  EEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYG 72
           E+   KE  S H   ++   +I+ K   ++  E+ A QY   + + L  FS F+ A++YG
Sbjct: 30  EKQFTKEAESEH--KLADKLQIT-KRIVIRKSELMANQYDNWFLKSLFLFSAFICAFSYG 86

Query: 73  LDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILF 132
           LD  IR               LLSTV+ I   I+A  QI+FA  SD+FGRL++ I+AI F
Sbjct: 87  LDSIIRSVYMTYAMNDYQTHSLLSTVSVISLTISAVAQIFFAGLSDVFGRLSIFIVAIAF 146

Query: 133 YVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPFI 192
           YVVGTII+SQA +V R+ AG  FY +G  GAM  V ++ +D S+L WRL   FVPA P +
Sbjct: 147 YVVGTIIQSQAYDVQRYAAGSIFYNIGLVGAMFQVTLMLSDSSSLKWRLFYNFVPAWPAL 206

Query: 193 INTWISGDVTSAVG--GDWKWGIGMWAFIFPLACIPLGCCMLHMRY-LAN-------KNS 242
           +  WISG+V        +W WGI MWAFIFP AC+P+  C+LHMR+ L N       +  
Sbjct: 207 VTVWISGNVIHLANPKQNWSWGIAMWAFIFPAACLPIIGCLLHMRWKLRNDPEWKDLQEE 266

Query: 243 KDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKT 302
           K     H +V   K+         LFWKLD++G+LL     GC+L+P T+AGG ++ W++
Sbjct: 267 KTYFQTHGLVQTLKQ---------LFWKLDVVGVLLFSVSTGCILIPLTVAGGASTHWRS 317

Query: 303 AHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGD 362
           A +I P V+G  V +P +I WE K +  PL P+ +LKDRG+++ L+I  +I F + M   
Sbjct: 318 AKVIAPIVLG-SVLVPAFIYWESKLALVPLAPFKMLKDRGIWAPLLITFLICFIYMMAAG 376

Query: 363 YMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAF 422
           Y+YT+L+VA +ES  SATRITSLYSFV+            +  R KPF +FG S++FV  
Sbjct: 377 YLYTILLVAGNESSLSATRITSLYSFVAAVFSPVVGIFVARFSRLKPFAVFGCSLYFVTM 436

Query: 423 GLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYN 482
            L   +RG   +  G+IG++ + G  + FF Y    S+Q  T SH+ +A +TAL L  + 
Sbjct: 437 ALFYHFRGGVDTGKGVIGAMVIWGITSCFFNYPINISMQTVT-SHENMATVTALGLTIFR 495

Query: 483 IXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAY 542
           I            WT  L  R+ KA+ + T+A EAY  P +F++ + WGT  R A+V +Y
Sbjct: 496 IGGAVGAAVSGAIWTQTLYPRLLKALGDPTMATEAYNMPLSFMLKHEWGTAARDAMVDSY 555

Query: 543 RDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKEDDPVVDFLAK 598
           R VQ+   ++GL F  P+      LR+  L +       D + VK DDP+ D++A+
Sbjct: 556 RYVQRYEVLVGLIFVAPMFVLTFLLRDPPLTEDYGQRLEDNEYVKHDDPITDWIAE 611

>YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}
           ARN2Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to the siderophore triacetylfusarinine C
          Length = 620

 Score =  425 bits (1092), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 242/616 (39%), Positives = 344/616 (55%), Gaps = 31/616 (5%)

Query: 4   ESSHSNQGEEEIAQKETYSVH-----STDISSGSEISIKDAGVQNI-----EVYAEQYKK 53
           E + S+Q + +  +K    +        D S   E+  K  G +++     E+ A++Y  
Sbjct: 6   EDNRSSQTKRKNTEKNCNELMVDEKMDDDSSPRDEMKDKLKGTKSLIIRKSELMAKKYDT 65

Query: 54  PYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWF 113
              + +  FS F+  +AYGLD +IR               L+STV+ I  +I+A  Q+ F
Sbjct: 66  WQLKAIFLFSAFICTFAYGLDSSIRGTYMTYAMNSYSAHSLISTVSVIVLMISAVSQVIF 125

Query: 114 ARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATD 173
              SDIFGRLT+ +++I+ Y+VGTII+SQA +V R+ AG  FY VG  G ML V ++ +D
Sbjct: 126 GGLSDIFGRLTLFLVSIVLYIVGTIIQSQAYDVQRYAAGAVFYYVGLVGVMLQVVLMLSD 185

Query: 174 FSNLNWRLLALFVPALPFIINTWISGDVTSAVGG--DWKWGIGMWAFIFPLACIPLGCCM 231
            S+L WRL    +P+ P II TW+SG V  A     +W W I MWAFIFPL CIPL  CM
Sbjct: 186 NSSLKWRLFYTLIPSWPSIITTWVSGSVVEAANPLENWSWNIAMWAFIFPLCCIPLILCM 245

Query: 232 LHMRYLANKNSKDKLAKHVMVPKDKEWKRYF-------FIDVLFWKLDMIGLLLMVCFFG 284
           LHMR+        K+   V   + ++ K Y+        +  LFWKLD++G+LL     G
Sbjct: 246 LHMRW--------KVRNDVEWKELQDEKSYYQTHGLVQMLVQLFWKLDVVGVLLFTAGVG 297

Query: 285 CVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVF 344
           C+LVP TLAGG+++ W+ + II P V+G+V+ +P +I WE + +  P  P+ LLKDRGV+
Sbjct: 298 CILVPLTLAGGVSTNWRNSKIIGPFVLGFVL-VPGFIYWESRLALVPFAPFKLLKDRGVW 356

Query: 345 SALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKV 404
           + L I   I F + M   Y+YT+LVVAV ES  SATRI +LYSFV+            + 
Sbjct: 357 APLGIMFFICFVYQMAAGYLYTILVVAVDESASSATRIINLYSFVTAVVAPFLGLIVTRS 416

Query: 405 RRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATT 464
            R K +IIFG S++F+  GL  RYR    +  GII  + + G  +  F Y T  SIQ+ T
Sbjct: 417 SRLKSYIIFGGSLYFITMGLFYRYRSGQDADGGIIAGMVIWGLSSCLFDYPTIVSIQSVT 476

Query: 465 RSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTF 524
            SH+ +A +TAL    + I            WT  L  ++   + +  LA  AYGSP TF
Sbjct: 477 -SHENMATVTALNYTVFRIGGAVAAAISGAIWTQSLYPKLLHYMGDADLATAAYGSPLTF 535

Query: 525 IITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEK 584
           I++N WGTP R A+V+AYR VQK   I+ L F  P+      +R+ RL +  A    D +
Sbjct: 536 ILSNPWGTPVRSAMVEAYRHVQKYEVIVALVFSAPMFLLTFCVRDPRLTEDFAQKLPDRE 595

Query: 585 NV--KEDDPVVDFLAK 598
            V  KEDDP+ D++AK
Sbjct: 596 YVQTKEDDPINDWIAK 611

>KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 624

 Score =  417 bits (1071), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 223/608 (36%), Positives = 344/608 (56%), Gaps = 12/608 (1%)

Query: 7   HSNQGE----EEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFF 62
           H  +G      E+ +     V  + +  G +   K   ++  E+ A QY   Y +VL   
Sbjct: 20  HRKEGAAEKINEMDEDSKKGVQFSGVCDGMK-QTKSLVIRKTEIMASQYNTWYSQVLFLS 78

Query: 63  SLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGR 122
             FL AY Y LD +IR               LLST++ I  +I+A  Q++FA  SD+FGR
Sbjct: 79  CAFLCAYGYSLDSSIRYVYMTYATNSYNTHSLLSTISIINMMISAVAQLFFAGLSDVFGR 138

Query: 123 LTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLL 182
           L ++I+AILFYVVGT+I+SQA ++ R+ AG  FY +G  G ML V +   D S+L WRLL
Sbjct: 139 LRLMIVAILFYVVGTVIQSQAYDIQRYAAGSVFYNIGVVGVMLQVSLFLADNSSLKWRLL 198

Query: 183 ALFVPALPFIINTWISGDVTSAVGG--DWKWGIGMWAFIFPLACIPLGCCMLHMRYLANK 240
             FVPA P IIN W+SG++  A     +W W I MWAFI PL+C+PL CC++HMR+ A+K
Sbjct: 199 YSFVPAWPAIINMWVSGNIVKAANPLVNWSWNIAMWAFILPLSCVPLLCCVVHMRWKASK 258

Query: 241 NSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEW 300
             + +  +  +    K    +  ++V FWK+D++GLLL+    GC+LVP T+AGG++ +W
Sbjct: 259 TPEWQELESELTFYQKHGFVHTIVEV-FWKVDIVGLLLLTASMGCILVPLTIAGGISEQW 317

Query: 301 KTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQ 360
               II P V+G V  +PL I WE  ++K P  P+ LLKDRG+++ + I  ++ F + M 
Sbjct: 318 NNGKIIGPLVLG-VFLVPLTIYWESNWAKVPFAPFLLLKDRGIWAPMSIMFLVCFIYQMA 376

Query: 361 GDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFV 420
             Y+YT+L+V+++++  SATRI +LYSFV+            +  R K F++ G  ++F+
Sbjct: 377 AGYLYTILLVSMNQTELSATRIMNLYSFVAGIYSPIFGFVVARTGRLKSFMLVGCCLYFL 436

Query: 421 AFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAA 480
             GL  RYRG   + +GIIG++ + G  +  +TY    S Q+ T SH+ +A +TA+ L  
Sbjct: 437 VMGLFYRYRGGLGAESGIIGAMVVWGIASCMYTYPVTTSAQSVT-SHENMATVTAMLLTI 495

Query: 481 YNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVK 540
           + I            WTN+L  ++ + + +  LA+ AY +P TFI+++ W T  R A++ 
Sbjct: 496 FRIGGAVGASVSGAIWTNLLYPKLLQNLGDVELASAAYTAPLTFIVSHPWNTEVRTAMID 555

Query: 541 AYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVA--LNELDEKNVKEDDPVVDFLAK 598
           AYR VQK   ++GL F  P+L     LR+  L D     L E      + +DP+ ++ + 
Sbjct: 556 AYRHVQKYEVLVGLIFVAPMLVLTFCLRDPELTDDYGQKLAEGQCVQTEGEDPIAEWFSD 615

Query: 599 FIPSLRNK 606
               L+ +
Sbjct: 616 RFKKLKRR 623

>TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON} 
          Length = 732

 Score =  411 bits (1057), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 230/581 (39%), Positives = 334/581 (57%), Gaps = 21/581 (3%)

Query: 41  VQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNC 100
           ++ IE+    Y   Y+  LL F  F+ +Y Y LD  +R               L+ST+N 
Sbjct: 97  IKEIEIMKSVYDTWYFHALLLFGAFICSYGYSLDSRVRRVYKTYAASSYKKHSLVSTINV 156

Query: 101 IKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGY 160
           I +V +A  Q+ ++RASDIFGRL++L++AI+ YVVGTII+SQA ++ R+ AG  FY +GY
Sbjct: 157 IDSVASATSQVVYSRASDIFGRLSLLLVAIICYVVGTIIQSQAYDIQRYCAGSFFYNLGY 216

Query: 161 TGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVG--GDWKWGIGMWAF 218
            G  L++ +I +D+S+L WR     + A P IIN WISG +         W W IGMWAF
Sbjct: 217 VGVSLLMTLILSDYSSLKWRFFYQAILAWPNIINDWISGIIVDRANPIKHWSWDIGMWAF 276

Query: 219 IFPLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYF-----FIDVLFWKLDM 273
           IFPL+CIP+ CC++HM++LA++  + K  K     K K + +Y+      ID +FW+ D+
Sbjct: 277 IFPLSCIPILCCLIHMQWLASQTDEWKQLK-----KGKSYFKYYGYKDSLID-MFWRFDV 330

Query: 274 IGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLT 333
           +G++L+  F G +L+P TLAGG  S W    +I P VIG  V +P + +WE  F+KHP+ 
Sbjct: 331 VGVILLAAFIGLILIPLTLAGGTKSRWSEGKLIAPFVIG-CVMVPCFAIWEKWFAKHPIM 389

Query: 334 PWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXX 393
           PW L+KDR +++AL ++ +  F + +  DYMY++L+VAV ES+KSAT I  ++SFVS   
Sbjct: 390 PWRLIKDRSIWAALTLSLVYKFVFAVAQDYMYSLLLVAVDESIKSATTIGLIHSFVSSVG 449

Query: 394 XXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFT 453
                     V R KPFI  G  ++ ++ GLL  YRG   +H+GIIG+LC++G     F 
Sbjct: 450 SPFFSYGTTFVGRLKPFIFLGTLLYMLSLGLLYYYRGGKWAHSGIIGALCVVGGLQLLFF 509

Query: 454 YTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTL 513
            T    I   + S   +A +TAL L   NI            WT  L   + K + N+TL
Sbjct: 510 ITPLTVITQASVSSADMANVTALILTFDNIGTGIGAAVSGAIWTQTLYKELFKRMKNKTL 569

Query: 514 AAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLE 573
           A +AY SP +FI   +WGTP R  +V++YR VQ+   I+ + FC PL+     LR+  L 
Sbjct: 570 AKKAYSSPLSFIANYSWGTPVRNIMVESYRSVQRYEIIVAISFCAPLVLLTFALRDINLN 629

Query: 574 DVVALNELDEKNVK--EDDPVVDFLAK-----FIPSLRNKK 607
                +  D K+VK  + DP+ DF A      F  S R KK
Sbjct: 630 RSTDADLEDGKHVKMTDSDPIFDFFANIFNKIFHSSPRGKK 670

>NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON} 
          Length = 452

 Score =  395 bits (1015), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 212/447 (47%), Positives = 289/447 (64%), Gaps = 11/447 (2%)

Query: 4   ESSHSNQGEEEIAQKETYSVHSTDISSGSEISIKDAGV-QNIEVYAEQYKKPYYRVLLFF 62
           E +H +    +I  KE  S +    SS  + ++K + V +  E+ +  Y K Y+ V+L F
Sbjct: 11  EKNHLSSKGNDIFTKEIESQNDDTQSSVPDFAVKRSLVIKKTEIMSAVYDKWYHHVILLF 70

Query: 63  SLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGR 122
           S F+  YAYGL+ NIR               LLSTVN I  V++AA QI ++R SD FGR
Sbjct: 71  SAFVCGYAYGLECNIRYIYTGYATSSYAEHSLLSTVNVINAVVSAASQIIYSRLSDFFGR 130

Query: 123 LTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLL 182
           LT+ IIAI+ YVVGTII+SQA +V R+ AG  FY  GY G +LI+ +I +DFS+L WRL 
Sbjct: 131 LTLFIIAIVLYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGIILILLLILSDFSSLKWRLF 190

Query: 183 ALFVPALPFIINTWISGDVTSAVGG--DWKWGIGMWAFIFPLACIPLGCCMLHMRYLANK 240
             F P  PFIINTWISG+VTS+      W W +GMWAFIFPLACIP+  CM+HM++ A+K
Sbjct: 191 YQFAPTWPFIINTWISGNVTSSANPLVHWSWDVGMWAFIFPLACIPMIGCMIHMQWKASK 250

Query: 241 NSKDKLAKHVMVPKDKEWKRYFFIDV---LFWKLDMIGLLLMVCFFGCVLVPFTLAGGMN 297
             +     H +  +   ++   F      LFWKLD+IG LL     GC+LVP TLAGG N
Sbjct: 251 TPE----WHALRSEKSFYQANGFYKTMTELFWKLDIIGTLLFTACLGCILVPLTLAGGTN 306

Query: 298 SEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCW 357
           S+W  + +I P V+G+V+ +P+  +WE K+++ PL P+ L++DRGV++AL I+ +I+F +
Sbjct: 307 SKWNNSRVIGPFVLGFVL-IPILGVWEYKWARDPLIPYKLVRDRGVWAALGISFLIDFIF 365

Query: 358 YMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISM 417
           YM  DY+YTV+VVAVHESVKSATRI++L SFVS            +  R KPFIIFG S+
Sbjct: 366 YMAADYLYTVMVVAVHESVKSATRISTLSSFVSTVASPFFALLMTRCTRLKPFIIFGCSL 425

Query: 418 WFVAFGLLIRYRGDSASHAGIIGSLCL 444
           W ++ GLL  +RG   SH+GIIG+LC+
Sbjct: 426 WMLSMGLLYNFRGGEQSHSGIIGALCV 452

>Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C
           (REAL)
          Length = 610

 Score =  390 bits (1003), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 211/597 (35%), Positives = 337/597 (56%), Gaps = 14/597 (2%)

Query: 1   MSLESSHSNQGEEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLL 60
           M+  +   +  E+ +  + + S    D    +  +++ + +   E+ A Q+  P YR L+
Sbjct: 1   MNANAKSVSNSEKCVTNESSRSFEDED---ANPANVEFSKLGESEIIAVQFDTPKYRALM 57

Query: 61  FFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIF 120
             + FL  + Y LD  +R               LLST+  I  V++   Q+ F+R SD F
Sbjct: 58  IATAFLCGFGYSLDHTLRSTYTGYATNSYAEHSLLSTIQVINAVVSVGSQVVFSRLSDYF 117

Query: 121 GRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWR 180
           GR+ + + A + YV+GTI++SQA +V+ + AG  FY  G  G  L++ +I +DFS+L WR
Sbjct: 118 GRVELFVAATILYVIGTIVQSQAYSVSIYAAGAVFYNSGNVGVTLVLLLILSDFSSLKWR 177

Query: 181 LLALFVPALPFIINTWISGDVTSAVG--GDWKWGIGMWAFIFPLACIPLGCCMLHMRYLA 238
           +L  +VP  PFII  WISG++ +A     DW W I MWAFIFPL+ +P+ C +++M Y +
Sbjct: 178 ILYQYVPYWPFIIIPWISGNIVTAANPEKDWSWDIAMWAFIFPLSALPMICLLVYMMYKS 237

Query: 239 NKNSKDK-LAKHVMVPKDKEW-KRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGM 296
           +K  + K L +   + K++ + K   F   LFW+LD IG++L+    GCVLVP TLA G+
Sbjct: 238 SKTPEWKALKERTHIKKNQGFLKNTVF---LFWELDSIGIILITVSLGCVLVPLTLANGV 294

Query: 297 NSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFC 356
           + +W ++ II   V G V+   +++ WE  ++K+PL P+ LL DRG+++ L +A    F 
Sbjct: 295 SQKWHSSKIIGTLVFGGVL-FCIFVFWETAYAKNPLLPFKLLGDRGIWAPLGVAFFNYFT 353

Query: 357 WYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGIS 416
           +++  D++Y VL+V+++ES  +ATRI +L  FV             K RR K  ++ G +
Sbjct: 354 FFIACDFLYPVLLVSMNESSTTATRILNLPDFVGATLSPFYGILVAKARRLKFSVVGGCA 413

Query: 417 MWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITAL 476
            W ++ GL  +YRG S SH G I +  ++G      + +   S+QA T +H ++AVIT++
Sbjct: 414 AWMISMGLFYQYRGGSESHGGAIAASVIMGMSGLLCSNSVIVSLQAMT-THGRMAVITSI 472

Query: 477 YLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRM 536
           Y     +            WT ++P+++ KA +N TLA  AY SP+TFI    WG+P+R+
Sbjct: 473 YFTFSKVGAAVGASVSGAVWTQIMPNQLRKAFSNDTLADAAYESPYTFIYEYPWGSPERI 532

Query: 537 AVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKN--VKEDDP 591
           AVV+AYR VQ+I+  IGL   IP     LF+R+  L D     E  E    + +D+P
Sbjct: 533 AVVEAYRYVQRIMMTIGLVCTIPFFAFTLFMRDPELIDKSTHEEFTEDGLALSKDEP 589

>KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 639

 Score =  379 bits (973), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 205/567 (36%), Positives = 321/567 (56%), Gaps = 16/567 (2%)

Query: 41  VQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNC 100
           ++ +E+  +QY   +   +  F+ FL      L+  +R               LLST+  
Sbjct: 65  IRKMEIMRKQYTSVFAICVFLFTAFLAGVGTDLNSQLRNNYTTYATNSYRSHSLLSTIGV 124

Query: 101 IKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGY 160
           + ++I+A     +AR SD+FGR+ + + A+LF+VVGTII+SQA NV ++ AG  FY +G 
Sbjct: 125 VSSIISAGALTVYARLSDVFGRIRLYLSAMLFFVVGTIIQSQANNVQKYAAGTVFYSLGT 184

Query: 161 TGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVG--GDWKWGIGMWAF 218
            G  +++ +I +DFS+L WRL   F P  P +   WI+G +   +     W WGIGMWAF
Sbjct: 185 AGIQVMMFIIMSDFSSLKWRLFFTFAPTWPNLFIPWITGSIVDRLDPVERWSWGIGMWAF 244

Query: 219 IFPLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVL---FWKLDMIG 275
           I+PL+ +P    +L +RY A+K  + K+    +  +   ++ +  I  L   FWK+D++G
Sbjct: 245 IYPLSSVPFVAYLLLVRYKASKTEEWKM----LSSEKTYYETHGIIQTLVQLFWKVDVVG 300

Query: 276 LLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCL-PLYILWEMKFSKHPLTP 334
           LLL V F GC+LVP TLAGG++S+W    I+ P ++G+  CL P +ILWE K+++ P+ P
Sbjct: 301 LLLFVAFLGCILVPLTLAGGVSSQWSNGKILGPFILGF--CLVPAFILWETKYARLPIAP 358

Query: 335 WALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXX 394
           + +LKDRG++SALII+ +    +Y+   Y+ T+L+VAV++S   A  I +++S V     
Sbjct: 359 FKMLKDRGIWSALIISMLAKTVYYLAAGYLLTILMVAVNQSRGMAAVIMNVWSVVGCGFS 418

Query: 395 XXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTY 454
                  ++VRR KPFII G  +W V+ GLL  YR    S  GIIG++ L G G+   T 
Sbjct: 419 PFFSYFVVRVRRLKPFIIIGCGIWMVSMGLLYYYRSGEHSKGGIIGAMVLWGLGSTMITR 478

Query: 455 TTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLA 514
           TT  S Q+ T +H+ +A ITA+ LA   I            WT  L  ++ + I +  +A
Sbjct: 479 TTVISSQSIT-AHENMATITAIMLAISRIGGGIGSAVSGAIWTQTLYAKLVETIGDPEIA 537

Query: 515 AEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLED 574
            + Y SP + I    WGTP R A+V+AYR VQ+   ++ +   IPL  A+L LR+  L D
Sbjct: 538 KKVYQSPLSAIRVYAWGTPTRDAIVEAYRHVQRFEVLVAMILVIPLFIASLCLRDPELTD 597

Query: 575 VVALNELDEKN---VKEDDPVVDFLAK 598
            VA  ++ +     V  +D + ++ + 
Sbjct: 598 EVAHTDIKDGEFIAVDGNDAIANWFSN 624

>YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}
           GEX2Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; expressed at a very low
           level; almost identical to paralog Gex1p; potential role
           in resistance to oxidative stress and modulation of the
           PKA pathway
          Length = 615

 Score =  363 bits (931), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 202/600 (33%), Positives = 323/600 (53%), Gaps = 14/600 (2%)

Query: 14  EIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGL 73
           EI ++E +S   T   + +   +K+      E+ + Q+    Y++LL  + F+  +   L
Sbjct: 21  EIIERERHSNDDTYSMTSTFFKLKEN-----EIMSAQFDSLKYKILLISTAFVCGFGISL 75

Query: 74  DGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFY 133
           D  +R               LLSTV  I  V++   Q+ ++R SD FGRL + ++A +FY
Sbjct: 76  DYTLRSTYTGYATNSYSEHSLLSTVQVINAVVSVGSQVVYSRLSDHFGRLRLFLVATIFY 135

Query: 134 VVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPFII 193
           ++GTII+SQAT +  + AG  FY  GY G  L++ +I +DFS+L WR+   +    P+II
Sbjct: 136 IMGTIIQSQATRLTMYAAGSVFYNCGYVGTNLLLTLILSDFSSLKWRMFYQYASYWPYII 195

Query: 194 NTWISGDVTSAVG--GDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSKDKLAKHVM 251
             WISG++ +A     +W W I MWAFI+PL+ +P+   +L+M+Y ++K ++ +  K   
Sbjct: 196 IPWISGNIITAANPQKNWSWNIAMWAFIYPLSTLPIIFLILYMKYKSSKTAEWRSLKE-Q 254

Query: 252 VPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVI 311
             K++    +  +  LFWKLD++G+LL+    GC+LVP TLA   + +W  + II   V 
Sbjct: 255 ARKERTGGLFENLVFLFWKLDIVGILLITVSLGCILVPLTLANETSQKWHNSKIIATLVS 314

Query: 312 GWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVA 371
           G  +   +++ WE KF+K PL P+ LL DRG+++ L +     F +++  DY+Y VL+V+
Sbjct: 315 GGCLFF-IFLYWEAKFAKSPLLPFKLLSDRGIWAPLGVTFFNFFTFFISCDYLYPVLLVS 373

Query: 372 VHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGD 431
           + ES  SA RI +L  FV+            K R+ K  +I G + W V  GL  +YRG 
Sbjct: 374 MKESSTSAARIVNLPDFVAATASPFYSLLVAKTRKLKLSVIGGCAAWMVCMGLFYKYRGG 433

Query: 432 SASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXX 491
           S SH G+I +  ++G      + +    +QA T +H ++AVIT +      +        
Sbjct: 434 SGSHEGVIAASVIMGLSGLLCSNSVIVILQAMT-THSRMAVITGIQYTFSKLGAAIGASV 492

Query: 492 XXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCI 551
               WT  +P+++ K + N TLA  AY SP+TFI    WG+P+R AVV++YR VQ+I+  
Sbjct: 493 SGAIWTQTMPNQLYKNLGNDTLAEIAYASPYTFISDYPWGSPERDAVVESYRYVQRIIMT 552

Query: 552 IGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNV----KEDDPVVDFLAKFIPSLRNKK 607
           +GL   +P     +F+RN  L D     E  E  +     E++      A F  +  NKK
Sbjct: 553 VGLACTVPFFTFTMFMRNPELIDKATHEEFTEDGLVVLPDEENIFSQIKALFRHNRSNKK 612

>YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}
           GEX1Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; imports glutathione from
           the vacuole and exports it through the plasma membrane;
           has a role in resistance to oxidative stress and
           modulation of the PKA pathway
          Length = 615

 Score =  362 bits (928), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 201/600 (33%), Positives = 323/600 (53%), Gaps = 14/600 (2%)

Query: 14  EIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGL 73
           EI ++E +S   T   + +   +K+      E+ + Q+    Y++LL  + F+  +   L
Sbjct: 21  EIIERERHSNDDTYSMTSTFFKLKEN-----EIMSAQFDSLKYKILLISTAFVCGFGISL 75

Query: 74  DGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFY 133
           D  +R               LLSTV  I  V++   Q+ ++R SD FGRL + ++A +FY
Sbjct: 76  DYTLRSTYTGYATNSYSEHSLLSTVQVINAVVSVGSQVVYSRLSDHFGRLRLFLVATIFY 135

Query: 134 VVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPFII 193
           ++GTII+SQAT +  + AG  FY  GY G  L++ +I +DFS+L WR+   +    P+II
Sbjct: 136 IMGTIIQSQATRLTMYAAGSVFYNCGYVGTNLLLTLILSDFSSLKWRMFYQYASYWPYII 195

Query: 194 NTWISGDVTSAVG--GDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSKDKLAKHVM 251
             WISG++ +A     +W W I MWAFI+PL+ +P+   +L+M+Y ++K ++ +  K   
Sbjct: 196 IPWISGNIITAANPQKNWSWNIAMWAFIYPLSALPIIFLILYMKYKSSKTAEWRSLKE-Q 254

Query: 252 VPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVI 311
             K++    +  +  LFWKLD++G+LL+    GC+LVP TLA   + +W  + II   V 
Sbjct: 255 ARKERTGGLFENLVFLFWKLDIVGILLITVSLGCILVPLTLANETSQKWHNSKIIATLVS 314

Query: 312 GWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVA 371
           G  +   +++ WE KF+K PL P+ LL DRG+++ L +     F +++  DY+Y VL+V+
Sbjct: 315 GGCLFF-IFLYWEAKFAKSPLLPFKLLSDRGIWAPLGVTFFNFFTFFISCDYLYPVLLVS 373

Query: 372 VHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGD 431
           + ES  SA RI +L  FV+            K R+ K  +I G + W V  GL  +YRG 
Sbjct: 374 MKESSTSAARIVNLPDFVAATASPFYSLLVAKTRKLKLSVIGGCAAWMVCMGLFYKYRGG 433

Query: 432 SASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXX 491
           S SH G+I +  ++G      + +    +QA T +H ++AVIT +      +        
Sbjct: 434 SGSHEGVIAASVIMGLSGLLCSNSVIVILQAMT-THSRMAVITGIQYTFSKLGAAIGASV 492

Query: 492 XXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCI 551
               WT  +P+++ K + N TLA  AY SP+TFI    WG+P+R AVV++YR VQ+I+  
Sbjct: 493 SGAIWTQTMPNQLYKNLGNDTLAEIAYASPYTFISDYPWGSPERDAVVESYRYVQRIIMT 552

Query: 552 IGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNV----KEDDPVVDFLAKFIPSLRNKK 607
           +GL   +P     +F+R+  L D     E  E  +     E++      A F  +  NKK
Sbjct: 553 VGLACTVPFFAFTMFMRDPELIDKATHEEFTEDGLVVLPDEENIFSQIKALFRHNRSNKK 612

>Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C -
           Hypothetical ORF [contig 245] FULL
          Length = 611

 Score =  358 bits (918), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 205/597 (34%), Positives = 322/597 (53%), Gaps = 27/597 (4%)

Query: 13  EEIAQKETYSVHSTDISSGSE-----ISIKDAG--------VQNIEVYAEQYKKPYYRVL 59
           +++   E   +  +D+  GS      ++  D G        V+ +E+  +       RV 
Sbjct: 6   KKVLDDEAIGLECSDLDGGSSSEKPSLTKGDKGRQQYDYMKVKEMEIIKDVCSGNLARVF 65

Query: 60  LFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDI 119
           L  S FL  +AY LD   R               LLST+  I +V+    QI FAR SD+
Sbjct: 66  LLASAFLCGFAYYLDMVTRSVYTTYAANSYEKHSLLSTIQVINSVVGVGAQISFARLSDV 125

Query: 120 FGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNW 179
           FGRL M ++  + YVVGTII+SQA +V  +  G  FY  G+ G  L++ ++ +D S L W
Sbjct: 126 FGRLQMFVVGTILYVVGTIIQSQAHDVKVYAVGAIFYNTGFVGVSLLLILVLSDMSPLRW 185

Query: 180 RLLALFVPALPFIINTWISGDVTSAVG--GDWKWGIGMWAFIFPLACIPLGCCMLHMRYL 237
           RL   F  + P II +WISGD+  A     +W W IGMWAFIFPL+ +P    + +  ++
Sbjct: 186 RLFYQFTASFPCIIISWISGDIVEAANPMKNWSWDIGMWAFIFPLSSLPFITYLFYATHI 245

Query: 238 ANKNSKDKLAKHVMVPKDKEWKRYFFIDV--LFWKLDMIGLLLMVCFFGCVLVPFTLAGG 295
           ++K  K K  ++    K +  KR   + V  +F ++D++G +L+    G +LVP TLAGG
Sbjct: 246 SSKTKKWKDLRN----KVETHKRNIILVVKDIFNQIDIVGTVLVTAALGLILVPLTLAGG 301

Query: 296 MNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINF 355
           ++  W    II   VIG +  L +++ WE KF+K+   P+ LLKDRGV+++++ A +   
Sbjct: 302 VSERWHEPGIIATLVIG-IALLLVFLFWEAKFAKNAALPFNLLKDRGVWASIVAAFLEKM 360

Query: 356 CWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGI 415
            + M  DY+Y VL+V+V+E+ KSATRI  L +F++           + V+R K F I G 
Sbjct: 361 IYAMISDYLYPVLLVSVNETNKSATRIVWLPTFMACLCSVFFGLLVVSVQRLKVFTICGT 420

Query: 416 SMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITA 475
            +W ++ GL  ++RG  +SH+GIIG+  +LGFG+  FT +   ++QA   SH  +A IT 
Sbjct: 421 FLWIISIGLFYQFRGGESSHSGIIGASIVLGFGSAIFTQSIIVTLQAMA-SHDNMASITG 479

Query: 476 LYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDR 535
           LY     +            WT  +  ++ K + +  L    + SP+ FI +  WGT +R
Sbjct: 480 LYFMFAQVGAATGASISGAIWTQTMYKQLLKQLKDSDLTMAVFASPYEFIASYAWGTKER 539

Query: 536 MAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKEDDPV 592
             V++AYR VQK+  ++ L   +PLL + LF ++ +L D V+ +   E    +DDP+
Sbjct: 540 DLVIQAYRHVQKVTMLVSLILTVPLLVSVLFTKDRKLSDSVSSDASHE----DDDPM 592

>KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON}
           similar to uniprot|P25596 Saccharomyces cerevisiae
           YCL073C and similar to uniprot|P36173 Saccharomyces
           cerevisiae YKR106W
          Length = 627

 Score =  340 bits (871), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/591 (33%), Positives = 319/591 (53%), Gaps = 18/591 (3%)

Query: 17  QKETYSVHSTDISS------GSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYA 70
           ++E + V   DI S       S++      V+ +E+ +        R  L  S FL  + 
Sbjct: 31  KEEKFDVTEHDIESVADSNKSSKLGSGFLKVKEMEIMSSTCSGKSARAALLASAFLCGFG 90

Query: 71  YGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAI 130
           Y LD   R               LLST+  I +VI+ A QI FA+ SDIFGRL + ++  
Sbjct: 91  YYLDYITRSVYTGYATSSYNEHALLSTIQVINSVISIAAQIIFAQLSDIFGRLQLFLVGT 150

Query: 131 LFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVPALP 190
           + Y+VGTII+ +A ++  +  G  FY  GY G  +++ ++ +D S   WRLL  F  + P
Sbjct: 151 VLYIVGTIIQCEARDIRTYAVGAAFYNSGYVGVSILLIIVLSDLSPSKWRLLFQFATSWP 210

Query: 191 FIINTWISGDVTSAV--GGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSKDKLAK 248
            II  WISGD+  +     +W++ IGMWAF+FP++ +P    ++ + Y   + SK    K
Sbjct: 211 CIIICWISGDIVQSANPAKNWRFDIGMWAFLFPISALPF---IIFLLYFTRQASKTAEWK 267

Query: 249 HVMVP-KDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIV 307
            +    K+   +  ++I  ++  +D++G  L+    GC+LVP TLAGG++ +W    II 
Sbjct: 268 EIQGDNKEPSVRIVYWIKSIYSNIDVVGTSLVTVSLGCILVPLTLAGGISDDWNKPGIIA 327

Query: 308 PEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTV 367
             V+G+V  +  ++ W++KF+K+ + P+ LLKDRGV+++L  A +    +    DY+Y V
Sbjct: 328 TIVVGFVSFM-FFLAWDIKFAKNAVLPFKLLKDRGVWASLAAALLEKLIYATISDYLYPV 386

Query: 368 LVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIR 427
           L+V+V+ES KSATRI  L +FV+           ++ +R K + I G+ +W ++ GL   
Sbjct: 387 LLVSVNESSKSATRILWLPTFVACTGSIFFGLLVVRTKRLKIYSIIGVCLWILSIGLFYH 446

Query: 428 YRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXX 487
           YRG ++SH+GIIG+  +LG G+  FT +   ++Q  T SH+ +A IT LY     I    
Sbjct: 447 YRGGASSHSGIIGASVVLGTGSAIFTQSLIVNLQTMT-SHKNMASITGLYFMFAQIGSAS 505

Query: 488 XXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQK 547
                   WT  +  ++ K + + +LAA A+ SP+ FI    WGTP+R  ++ AYR+VQK
Sbjct: 506 GASISGAIWTQTMYKQLYKRLEDSSLAATAFSSPYEFIELYPWGTPERTQMIYAYREVQK 565

Query: 548 ILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKEDDPVVDFLAK 598
              ++ L    PL    LF ++ +L D    N   E    ++DP++ ++ K
Sbjct: 566 KTMLVSLVLTGPLFLLILFTKDRKLGD----NVTAETTQSDEDPMLTWILK 612

>KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} similar
           to uniprot|P36173 Saccharomyces cerevisiae YKR106W
          Length = 644

 Score =  338 bits (866), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 207/614 (33%), Positives = 321/614 (52%), Gaps = 17/614 (2%)

Query: 4   ESSHSNQGEEEIAQKETYSVHSTDISSGSEISIK---DAGVQNIEVYAEQYKKPYYRVLL 60
            S    QG     +K T    +  +    EI+ +      ++ +E+ +   K+ +++ +L
Sbjct: 24  RSCKKEQGIIHDIEKMTVVEETQPVGPNLEITARFSTKRKMKELEIVSSFCKEWHFQSIL 83

Query: 61  FFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIF 120
             +  +  ++Y LD  +R               LL+T+N I +V++ A Q++FAR SD F
Sbjct: 84  LVTAIVCGFSYNLDAVLRSTYTGYATNSFSQHSLLATINVINSVVSIASQLFFARLSDHF 143

Query: 121 GRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWR 180
           GRL +     L Y+VGTI++SQ+ NV+ +  G  FY  GYTG  L++ ++ +DFS L WR
Sbjct: 144 GRLQLFGFCTLMYIVGTILQSQSKNVSIYAGGAVFYNAGYTGVRLLMTIMMSDFSTLGWR 203

Query: 181 LLALFVPALPFIINTWISGDVTSAVG--GDWKWGIGMWAFIFPLACIPLGCCMLHMRYLA 238
              +  P   +II TW+SG++        +W W I MWAFIFPL  IPL   +++M Y A
Sbjct: 204 YFMIASPDWCYIIITWVSGNIIEISNPLENWSWDIAMWAFIFPLTTIPLVGFLVYMFYKA 263

Query: 239 NKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNS 298
           ++  + K  + V     K+     +I  +FW LD+ G+LL+    GC+L+P T++GG   
Sbjct: 264 SRTDEWKELRSV----TKKMPTPVYIKEVFWNLDIPGVLLIAISLGCILIPLTVSGGETE 319

Query: 299 EWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWY 358
           EWK +  I    +G  V  P+++LWE K +K P+     LKDRGV++ L  +  ++  + 
Sbjct: 320 EWKDSRNIGVLCLG-SVLFPIFLLWEGKIAKRPVLALTYLKDRGVWAPLAASFFMSNAYL 378

Query: 359 MQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMW 418
           +  DY+Y VL+V  ++S  ++ RIT L SF              + +  K   I G   +
Sbjct: 379 IATDYLYAVLLVGFNQSESASQRITWLPSFAGVVITPFTGLLITRWKHLKVLTITGCIFY 438

Query: 419 FVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYL 478
           ++AFGL  RYRG S + AGII     +GFG+G  TY    S+QA + SH K+A++TAL+ 
Sbjct: 439 YIAFGLFYRYRGGSTNVAGIIVGTIFMGFGSGISTYPLMVSLQAVS-SHTKIAIVTALFY 497

Query: 479 AAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQ-TLAAEAYGSPFTFIITNTWGTPDRMA 537
               +            WT V+   ISK +  +  +A  AY SP+TF+    W T  RMA
Sbjct: 498 TFEQVGRAVGSSISGAIWTQVMFKEISKRLPEEPEVALAAYASPYTFVTKYGWETSQRMA 557

Query: 538 VVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDV-VALNELDEKNV---KEDDPVV 593
           VV AY  VQKIL ++ L    PL   A+ +R+  L    VAL+  D+ +V   K +D + 
Sbjct: 558 VVGAYMHVQKILLLVALLMLCPLFLMAIMMRDAELSTSDVALSSSDDSHVIISKHEDKIY 617

Query: 594 DFLAKFIPSLRNKK 607
           +   KF  S   KK
Sbjct: 618 EAFCKFF-SFSTKK 630

>KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 458

 Score =  308 bits (790), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 168/440 (38%), Positives = 251/440 (57%), Gaps = 6/440 (1%)

Query: 110 QIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEV 169
           Q+  AR SD FGRL + + + + Y+  +I+ES A N++ + AG   Y VG+    +++ V
Sbjct: 2   QLILARLSDYFGRLEIFLTSTVLYIARSIVESPAYNISAYGAGAVLYNVGFCCVNIVLLV 61

Query: 170 IATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVG--GDWKWGIGMWAFIFPLACIPL 227
           + +DFS+L WR+L  F P    ++  WISGDV +++G    W WGIG WAF FPLA +P 
Sbjct: 62  VMSDFSSLKWRVLYQFAPTWGCVVIPWISGDVVNSIGPIKHWSWGIGFWAFSFPLASLPF 121

Query: 228 GCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVL 287
            CCM++M Y   K+ + KL          E K    +  +F ++D IG L+     GCVL
Sbjct: 122 ICCMVYMIYTTRKSDQWKLFNQ--EKPLNEAKLLTRVMRIFHQVDFIGTLIFSVALGCVL 179

Query: 288 VPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSAL 347
           VP TLAGG +S+W  +  IVP V+G V+ +  YI+WE   + +P  P+ LLKDRG++  +
Sbjct: 180 VPLTLAGGYSSKWSHSDSIVPLVVGSVLFV-FYIVWESFMASYPALPFKLLKDRGIWIPI 238

Query: 348 IIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRT 407
           +   +++  +Y   DYMY VL+VA++ES KSAT I SL  FV+               R 
Sbjct: 239 LAGFLMDLVYYFSCDYMYPVLMVAINESTKSATNIASLPLFVTTVASPFFAVLLRWTGRL 298

Query: 408 KPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSH 467
           K + I G ++W V+ GL  RYR    SH G++ ++ LLG G  F  +    ++QA    H
Sbjct: 299 KWYAIGGFAIWMVSLGLFFRYRCGEGSHDGMVAAVVLLGLGRTFTQFPLLTTMQARA-PH 357

Query: 468 QKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIIT 527
            K+A +T L+    ++            WT  +P ++ K + +  LA  AY SP+TFII+
Sbjct: 358 TKMATVTGLFHVWGSVGSVVGASISGAVWTQKMPKKLLKMLGSNGLATAAYASPYTFIIS 417

Query: 528 NTWGTPDRMAVVKAYRDVQK 547
             WGT +R+AVV AY++VQK
Sbjct: 418 YPWGTSERLAVVLAYKNVQK 437

>Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106W
           (REAL)
          Length = 440

 Score =  303 bits (775), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 164/439 (37%), Positives = 257/439 (58%), Gaps = 10/439 (2%)

Query: 140 ESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISG 199
            S   +V+ + AG  FY  GY G  LI+ +I +DFS L WR+   +    P+II  W+SG
Sbjct: 8   NSLCKHVSIYAAGAVFYNCGYVGVSLILTLILSDFSTLKWRIFYQYSSYWPYIIIPWVSG 67

Query: 200 DVTSAVGGD--WKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKE 257
           ++ +A   +  W W I MWAFIFPL+ +PL C +++++  + K  + K  K     +   
Sbjct: 68  NIITAAKPEKNWTWDIAMWAFIFPLSSLPLYCLIIYLKMKSVKTPEWKALKE----RAHS 123

Query: 258 WKRYFFIDV--LFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVV 315
            KR FF ++  LFW+LD+IG++L+    GC+LVP TLA G + +W+++ II   V G V+
Sbjct: 124 VKRGFFKNIIFLFWELDVIGIVLITVSTGCILVPLTLAAGASEKWRSSKIIGTLVSGGVL 183

Query: 316 CLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHES 375
            L +++ WE  ++ +PL P+ LLKDRG+++ L +A    F +Y+  D++Y VL+V+++ES
Sbjct: 184 FL-IFMFWEASYAHNPLLPFKLLKDRGIWAPLGVAFFNYFTFYIACDFLYPVLLVSMNES 242

Query: 376 VKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASH 435
             SA RI +L  FV+            K +R K  +I G + W ++ GL  R+RG   SH
Sbjct: 243 STSAARILNLPDFVASTASPFYSLLIAKSKRLKISVIVGCATWMLSMGLFYRFRGGYGSH 302

Query: 436 AGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXX 495
            G+I +  ++GF     + +    +QA T +H ++AV+T ++     I            
Sbjct: 303 GGVISASVIMGFSGLLCSNSVIVLLQAMT-THSRMAVMTGIHYTFSRIGAAVGASVSGGV 361

Query: 496 WTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLC 555
           WT  +P R+ K + N TLAAEAY SP++FI +  WGT +R AVV+AY+ VQ+I+ I+GL 
Sbjct: 362 WTQTMPSRLYKLLGNDTLAAEAYESPYSFIDSYPWGTVERYAVVEAYKYVQRIMMIVGLI 421

Query: 556 FCIPLLCAALFLRNHRLED 574
             IPL   +LF+R+  L D
Sbjct: 422 CTIPLFAFSLFMRDPELID 440

>YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}
           ENB1Endosomal ferric enterobactin transporter, expressed
           under conditions of iron deprivation; member of the
           major facilitator superfamily; expression is regulated
           by Rcs1p and affected by chloroquine treatment
          Length = 606

 Score =  233 bits (594), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 149/540 (27%), Positives = 264/540 (48%), Gaps = 20/540 (3%)

Query: 57  RVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARA 116
           +  L  +LFL  Y  GL G I                 + ++N +K+++A+   + +AR 
Sbjct: 63  KTALLVALFLQGYCTGLGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYARI 122

Query: 117 SDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSN 176
           SD FGR+   I A++ Y +G II +     +   AG    Q GY+G  L+   +  D S 
Sbjct: 123 SDRFGRIECWIFALVLYTIGEIISAATPTFSGLFAGIVIQQFGYSGFRLLATALTGDLSG 182

Query: 177 LNWRLLALFVPALPFIINTWISGDVTSAVGGD-----WKWGIGMWAFIFPLACIPLGCCM 231
           L  R  A+ +  +P IINTW+SG++ S+V G+     W+WG G++  I P++ + L    
Sbjct: 183 LRDRTFAMNIFLIPVIINTWVSGNIVSSVAGNVAPYKWRWGYGIFCIIVPISTLILVLPY 242

Query: 232 LHMRYLANKNSK---DKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLV 288
           ++ +Y++ ++ K    KL +     +   WK   F D     +++IG++L   F   VL+
Sbjct: 243 VYAQYISWRSGKLPPLKLKEKGQTLRQTLWK---FAD----DINLIGVILFTAFLVLVLL 295

Query: 289 PFTLAGGMNSEWKTAHIIVPEVIGWVVCLP-LYILWEMKFSKHPLTPWALLKDRGVFSAL 347
           P T+AGG  S+W+  HII   V+G   CL  ++++WE+KF+K+P  P   L D  ++ AL
Sbjct: 296 PLTIAGGATSKWREGHIIAMIVVGG--CLGFIFLIWELKFAKNPFIPRVYLGDPTIYVAL 353

Query: 348 IIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRT 407
           ++  +      ++ +Y+ TVL+VA  ES  SA RI  LY+F+                  
Sbjct: 354 LMEFVWRLGLQIELEYLVTVLMVAFGESTLSAQRIAQLYNFLQSCTNIVVGIMLHFYPHP 413

Query: 408 KPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSH 467
           K F++ G  +  +  GLL +YR      +G+IG+  ++G   G   +     + A+T +H
Sbjct: 414 KVFVVAGSLLGVIGMGLLYKYRVVYDGISGLIGAEIVVGIAGGMIRFPMWTLVHAST-TH 472

Query: 468 QKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIIT 527
            ++A +T L ++ Y I            WT  L   + + + + +L    Y SP  ++  
Sbjct: 473 NEMATVTGLLMSVYQIGDAVGASIAGAIWTQRLAKELIQRLGS-SLGMAIYKSPLNYLKK 531

Query: 528 NTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVK 587
              G+  R+ ++++Y  +Q++L I+ + F         FLR   +    +L+  + +  K
Sbjct: 532 YPIGSEVRVQMIESYSKIQRLLIIVSISFAAFNAVLCFFLRGFTVNKKQSLSAEEREKEK 591

>TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score =  206 bits (523), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 153/540 (28%), Positives = 260/540 (48%), Gaps = 20/540 (3%)

Query: 57  RVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARA 116
           ++ L  +LFL  Y  GL G I                 + ++N +K+V+AAA  + +AR 
Sbjct: 61  KIALLIALFLQGYCTGLGGQISQSIQTYAANAFKKQPQIGSINTVKSVVAAAVAVPYARL 120

Query: 117 SDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSN 176
           SD FGR+   I A++ Y VG II +         AG    Q GY+G  L+   +  D S 
Sbjct: 121 SDRFGRIECWIFALVLYTVGDIISAATPTFGGLFAGVVIQQFGYSGFRLLATALTADISG 180

Query: 177 LNWRLLALFVPALPFIINTWISGDVTSAVGG-----DWKWGIGMWAFIFPLACIPLGCCM 231
           L  R  A+ +  +P IINTW+SG++  ++ G     +W+WG G++  I P + + L    
Sbjct: 181 LRDRTFAMNIFLIPVIINTWVSGNIVDSLAGVKVPYEWRWGYGIFCIIVPFSTLLLILPY 240

Query: 232 LHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKL----DMIGLLLMVCFFGCVL 287
            + +YLA +  + +L +     + + WK+        WKL    ++IG++L   F   VL
Sbjct: 241 AYAQYLAWR--EGRLPQFEFRKQGQSWKQ------ALWKLTEDVNLIGIVLFTAFLVLVL 292

Query: 288 VPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSAL 347
           +P TLAGG +++WK  HII   V+G   C  L+ +WE+  +K P  P   L D  ++ AL
Sbjct: 293 LPLTLAGGASTKWKEGHIIAMIVVGG-CCGILFFVWELWLAKKPFIPRVYLGDATIYVAL 351

Query: 348 IIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRT 407
           ++         ++ +Y+ TVL+VA  ES  SA RI  LY+F+                  
Sbjct: 352 LMEFAWRLALQIELEYLITVLMVAFGESKLSAQRIGQLYNFLQSCTNVVVGIMLHFYPHP 411

Query: 408 KPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSH 467
           KPFI+ G  +  +  GLL +YR      +G+IG+  ++G       +     + A+T SH
Sbjct: 412 KPFIVAGSLLGVLGMGLLYKYRVAYDGISGLIGAEVVVGIAGSMVRFPMWTLVHAST-SH 470

Query: 468 QKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIIT 527
           +++AV T L ++ Y I            WT  L   + K + ++   A  Y SP +++  
Sbjct: 471 EEMAVATGLLMSVYQIGNAVGASIAGAIWTQRLAKELIKRLGSKVGLA-VYNSPLSYLTK 529

Query: 528 NTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVK 587
              G+  R  ++++Y ++Q++L I+ + F         FL  + + +  +  + + +  K
Sbjct: 530 YPLGSEVRNEILESYSEIQRLLIIVSISFAALNAVLCFFLPGYTVSEKQSFTQEEREKKK 589

>Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)
          Length = 605

 Score =  205 bits (521), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 145/541 (26%), Positives = 259/541 (47%), Gaps = 22/541 (4%)

Query: 57  RVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARA 116
           ++ L  +LFL  Y  GL G I                 + ++N +K+++A+   + +AR 
Sbjct: 62  KITLLVALFLQGYCTGLGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYARM 121

Query: 117 SDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSN 176
           SD FGR+   + A++ Y VG II +     A   AG    Q GY+G  L+   +  D S 
Sbjct: 122 SDRFGRIECWMFALVLYTVGEIISAATPTFAGLFAGIVIQQFGYSGFRLLATALTGDLSG 181

Query: 177 LNWRLLALFVPALPFIINTWISGDVTSAVGG-----DWKWGIGMWAFIFPLACIPLGCCM 231
           L  R  A+ +  +P IINTW+SG++ S+V G     +W+WG G++  I P + + L    
Sbjct: 182 LRDRTFAMNIFLIPVIINTWVSGNIVSSVAGHTTPYNWRWGYGIFCIIVPFSTLMLVLPY 241

Query: 232 LHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWK----LDMIGLLLMVCFFGCVL 287
            + +Y+  +N    L  + +  K +  ++        WK    +++IG++L   F   +L
Sbjct: 242 AYAQYIGWRNG--TLPPYKLREKGQNLRQ------TLWKIVEDINLIGVILFSAFLVLLL 293

Query: 288 VPFTLAGGMNSEWKTAHIIVPEVIGWVVCLP-LYILWEMKFSKHPLTPWALLKDRGVFSA 346
           +P T+AGG  S+W+  +II   V+G   CL  ++++WE++F+K+P  P   L D  ++ A
Sbjct: 294 LPLTIAGGATSKWREGYIIAMIVVGG--CLGFIFLIWELRFAKNPFIPRVYLGDPTIYVA 351

Query: 347 LIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRR 406
           L++  +      ++ +Y+ TVL+VA  ES  SA RI  LY+F+                 
Sbjct: 352 LLMEFVWRLSLQIELEYLVTVLMVAFGESKLSAQRIAQLYNFLQSCTNIVVGIILHFYPH 411

Query: 407 TKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRS 466
            K F++ G  +  +  GLL +YR      +G+IG+  ++G   G   +     + A+T +
Sbjct: 412 PKLFVVAGSLLGVLGMGLLYKYRVVYDGISGLIGAEIVVGIAGGMIRFPMWTLVHAST-T 470

Query: 467 HQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFII 526
           H ++A +T L ++ Y I            WT  L   + + + +  L    Y SP  ++ 
Sbjct: 471 HNEMATVTGLLMSVYQIGDAVGASIAGAIWTQCLAKELIQRLGSN-LGMSIYKSPLNYLK 529

Query: 527 TNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNV 586
               G+  R  +V++Y  +Q++L I+ + F         FLR   +    + +  + +  
Sbjct: 530 KYPIGSEVRDQMVESYSKIQRLLIIVSISFAAFNAVLCFFLRGFTVNKKQSFSTEEREKE 589

Query: 587 K 587
           K
Sbjct: 590 K 590

>Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)
          Length = 534

 Score =  195 bits (495), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 146/543 (26%), Positives = 252/543 (46%), Gaps = 22/543 (4%)

Query: 5   SSHSNQGEEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAE----QYKKPYYRVLL 60
           S + N  ++  A     +    D S+GS I   DA  + +  Y             + +L
Sbjct: 2   SKNDNLDDKSTAGYSEKAETEDDKSTGSGIRRIDAVNRVLSDYGSFTAFGVTFSTLKTVL 61

Query: 61  FFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIF 120
             +LFL  Y  GL G I                 + ++N +K+++++   + +AR SD F
Sbjct: 62  LVALFLQGYCTGLGGQISQSIQTYAANGFGKHSQVGSINTVKSIVSSVVAVPYARMSDRF 121

Query: 121 GRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWR 180
           GR+   I A++ Y VG II +   N     AG    Q GY+G  L+   +  D S L  R
Sbjct: 122 GRIECWIFALVLYTVGEIISAATPNFGGLFAGIVIQQFGYSGFRLLATALTGDLSGLRDR 181

Query: 181 LLALFVPALPFIINTWISGDVTSAVGGD-----WKWGIGMWAFIFPLACIPLGCCMLHMR 235
             A+ +  +P IINTW+SG++ S++ G      W+WG G++  I P + + L     + +
Sbjct: 182 TFAMNIFLIPVIINTWVSGNIVSSLAGSVAPYKWRWGYGIFCIIVPFSTLILVLPYAYAQ 241

Query: 236 YLANKNS---KDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTL 292
           Y++ +N      KL +     +   WK  F  D+     ++IG++L   F   VL+P T+
Sbjct: 242 YISWRNGTLPPFKLKEKGQNLRQTIWK--FAEDI-----NLIGIILFTAFLVLVLLPLTI 294

Query: 293 AGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATM 352
           AGG  S+W+  +II   V+G  +   ++++WE++F+K+P  P   L D  ++ AL++  +
Sbjct: 295 AGGATSKWREGYIIAMIVVGGFLGF-IFLIWELRFAKNPFIPRVYLGDPTIYVALLMEFV 353

Query: 353 INFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFII 412
                 ++ +Y+ TVL+VA  ES  SA RI  LY+F+                  K F++
Sbjct: 354 WRLGLQIELEYLVTVLMVAFGESTLSAQRIGQLYNFLQSCTNIVVGIILHFYPHPKVFVV 413

Query: 413 FGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAV 472
            G  +  +  GLL +YR      +G+IG+  ++G   G   +     + A+T +H+++A 
Sbjct: 414 AGSLLGVLGMGLLYKYRVVYDGISGLIGAEIVVGIAGGMIRFPMWTLVHAST-THKEMAT 472

Query: 473 ITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGT 532
           +T L ++ Y I            WT  L   + + +    L    Y SP  ++     G+
Sbjct: 473 VTGLLMSVYQIGDAVGASIAGAIWTQRLAKELIQRLGYD-LGMSIYKSPLNYLKKYPIGS 531

Query: 533 PDR 535
             R
Sbjct: 532 EVR 534

>Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score =  179 bits (454), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 157/622 (25%), Positives = 274/622 (44%), Gaps = 47/622 (7%)

Query: 1   MSLESSHSNQGEEEIAQKETYSVH-------STDISSGSEISIKDAGVQNIEVYAEQYKK 53
           ++ +    ++  ++ A+K+  SV+       S+  S   E  +K  GV  IEV  E+   
Sbjct: 15  LNFQEKLHDEARKDAAEKDLISVNGCLQQVSSSITSCNGEKIVKTRGVTRIEVVREKMST 74

Query: 54  PYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWF 113
               +L   S+FL ++   LD                   +LST+    +VI A  + + 
Sbjct: 75  KVIWIL-GLSIFLTSWVAALDATTTYNYQPYATSSFNRHSMLSTLTIANSVIGAVCKPFI 133

Query: 114 ARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATD 173
           A+ SD+  R     + +L YV+G +I + + N++ +  G  F  VG +G  L+  VI  D
Sbjct: 134 AKISDLSSRPVTYFVVLLLYVIGFVITACSPNISAYVIGSVFIAVGQSGISLMNMVIIAD 193

Query: 174 FSNLNWRLLALFVPALPFIINTWISGD-VTSAVGGDWKWGIGMWAFIFPLACIPLGCCML 232
            + L WR     + ++P+++ TWISG  V   +  +W+WG GM+A I P+A  P    M 
Sbjct: 194 TTTLKWRSFFTSLLSVPYLVTTWISGYIVEDIINSNWRWGYGMFAIITPVALTPAILVMA 253

Query: 233 HMRYLANKNSK-----DKLAK---HVMVPKDKEWKRYF-FIDVLFWKLDMIGLLLMVCFF 283
           ++ + ANK  +     D LAK    V   + + +K Y+  + V   ++D  GL+L+   F
Sbjct: 254 YLEHSANKAGEIPIGFDPLAKKKVEVTEARIRGFKVYWELLKVSLIEIDAFGLILLGFAF 313

Query: 284 GCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGV 343
             +L+P +L       W    +I  EV+G ++ +  Y+++E+ F+  PL P  +L +R  
Sbjct: 314 SLILLPCSLYSYAEGGWNNPSMIAMEVVGGILLIS-YVVFEVFFAPFPLLPKRVLMNR-- 370

Query: 344 FSALIIATMINFCWYMQG--------DYMYTVLVVAVHESVKSATRITSLYSFVSXXXXX 395
               I   +I+F + M G         Y + VL ++  + V  +   T    F       
Sbjct: 371 --TFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRDWVYLSNTTTMGLCFFGVVWGA 428

Query: 396 XXXXXXIKVRRTKPFIIFGISMWFVAFGLLIR-YRGDSASHAG-IIGSLCLLGFGAGFFT 453
                     R K F + GI++  +  GL +   + D +   G ++ +L +  FG     
Sbjct: 429 LFR----GFHRYKIFQVVGIAIKLIGMGLYVACSKKDGSPGIGLVVAALVVTNFGDAANV 484

Query: 454 YTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTL 513
             TQ + QA        A I+ L L + +I            WT+ LP  + K + ++  
Sbjct: 485 MGTQVAAQAAVPHQDMAATISVLSLYS-SIGAAVGTAITSAVWTDQLPGALFKYVPDKEK 543

Query: 514 AAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLE 573
           A  A+    T I    WG+ +R   + AY++V   L  +GL     +   ALF  N+ L 
Sbjct: 544 AV-AFFESLTSIWEEPWGSINREGAISAYQEVNYTLFCMGLGVSSIMFVVALFQTNYYLG 602

Query: 574 DVVALNELDEKNVKEDDPVVDF 595
                   D++N  E + + D+
Sbjct: 603 --------DQQNCVEGEQIEDY 616

>Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score =  176 bits (445), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 154/622 (24%), Positives = 270/622 (43%), Gaps = 47/622 (7%)

Query: 1   MSLESSHSNQGEEEIAQKETYSVHST--DISSGS-----EISIKDAGVQNIEVYAEQYKK 53
           ++++  +  + + + A+K   S+  +   I+S +     E  IK  GV  IEV  E+   
Sbjct: 15  LNVQEKYHEEAKSDAAEKNLVSIDGSLKQITSATSCYDGEKIIKTRGVTRIEVVREKMST 74

Query: 54  PYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWF 113
              R +L  S+FL +    LD                   +LST+    +VI A  + + 
Sbjct: 75  RV-RWILGLSIFLTSAVAALDATTTYNYQPYATSSFNRHSMLSTLTIANSVIGAVCKPFI 133

Query: 114 ARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATD 173
           A+ SD+  R     + +L YV+G +I + +  +A +  G  F  +G +G  L+  VI  D
Sbjct: 134 AKISDLSSRPVTYFVVLLLYVIGFVITACSPTIAAYVVGSVFIAIGQSGISLMNMVIIAD 193

Query: 174 FSNLNWRLLALFVPALPFIINTWISGD-VTSAVGGDWKWGIGMWAFIFPLACIPLGCCML 232
            + L WR     + ++P+++ TWISG  V   +  +W+WG GM+A I P+A  P    M 
Sbjct: 194 TTTLKWRSFFTSLLSVPYLVTTWISGYIVEDIINSNWRWGYGMFAIITPVALTPAILVMA 253

Query: 233 HMRYLANKNSK-----DKLAKHVMVPKDKE---WKRYF-FIDVLFWKLDMIGLLLMVCFF 283
           ++ + ANK  +     D L+K  +   +     ++ Y+  + V   ++D  GL+L+   F
Sbjct: 254 YLEHQANKTGEIPVGSDPLSKKRIEVTESHVSGFREYWELVKVSLIEIDAFGLILLGFAF 313

Query: 284 GCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGV 343
             +L+P +L       W    +I  EV+G +  +  Y+++E+ F+  PL P  +L +R  
Sbjct: 314 SLILLPCSLYSYAEGGWNNPSMIAMEVVGGIFLIS-YVVFEVFFAPFPLLPKRVLMNR-- 370

Query: 344 FSALIIATMINFCWYMQG--------DYMYTVLVVAVHESVKSATRITSLYSFVSXXXXX 395
               I   +I+F + M G         Y + VL ++    V  +   T    F       
Sbjct: 371 --TFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRNWVYLSNTTTMGLCFFGVVWGA 428

Query: 396 XXXXXXIKVRRTKPFIIFGISMWFVAFGLLI--RYRGDSASHAGIIGSLCLLGFGAGFFT 453
                     R K F + GI++  +  GL +    +  S     ++ +L +  FG     
Sbjct: 429 LFR----GFHRYKIFQVVGIAIKLIGMGLYVTCSKKEGSPGIGLVVAALVVTNFGDAANV 484

Query: 454 YTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIANQTL 513
             TQ + QA        A I+ L L + +I            WT+ LP  +SK + ++  
Sbjct: 485 MGTQVAAQAAVPHQDMAATISVLSLYS-SIGAAVGTAITSAIWTDRLPGALSKYVPDREK 543

Query: 514 AAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLE 573
           AA A+    T +    WG+ +R   + AY++V   L  +GL     +   ALF  N+ L 
Sbjct: 544 AA-AFFESLTTVWEEPWGSANREGAIDAYQEVNYTLFCMGLGVSAIMFIVALFQTNYYLG 602

Query: 574 DVVALNELDEKNVKEDDPVVDF 595
                   D++N  E +   D+
Sbjct: 603 --------DQQNCVEGEQREDY 616

>Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON}
           YEL065W (REAL)
          Length = 637

 Score =  172 bits (437), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 150/570 (26%), Positives = 247/570 (43%), Gaps = 32/570 (5%)

Query: 36  IKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLL 95
           IK  GV  IEV  E+       +L   S+ L A+   LD                   +L
Sbjct: 58  IKTRGVTRIEVVKEKMSTKVTWILAA-SILLTAWIAALDATTTYNYQPYATSSFNRHSML 116

Query: 96  STVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCF 155
           ST+    +VI A  + + A+ SD+  R     + ++ YV+G II + +  +A +  G  F
Sbjct: 117 STLTIANSVIGAVCKPFIAKISDLSSRPVTYFVVLILYVIGFIITACSPTIAAYVVGSVF 176

Query: 156 YQVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGD-VTSAVGGDWKWGIG 214
             VG +G  L+  VI  D ++L WR     + ++P+++ TWISG  V + +  +W+WG G
Sbjct: 177 IAVGQSGINLMNMVIVADTTSLKWRSFITSLLSVPYLVTTWISGYIVQNIISSNWRWGYG 236

Query: 215 MWAFIFPLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKE--------WKRYF-FID 265
           M+A I P+A  P    M ++ + ANK  +  +    +  K +E        +K Y+  + 
Sbjct: 237 MFAIITPVALTPAILVMAYLEHEANKTGEIPIGSDPLTEKKREIRESGISGFKGYWQLLK 296

Query: 266 VLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEM 325
               ++D  GL+L+   F  +L+P +L       WK   +I  EVIG +  +  Y+++E+
Sbjct: 297 TSLIEIDAFGLILLGFAFSLILLPCSLYSYAEGGWKNPSMIAMEVIGGIFLIS-YVIFEV 355

Query: 326 KFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQG--------DYMYTVLVVAVHESVK 377
            F+  PL P  +L +R      I   +I+F + M G         Y + VL ++    V 
Sbjct: 356 FFAPFPLLPKRVLVNR----TFICCVVIDFIYQMGGYFSLLFFTSYTFVVLNLSYKNWVY 411

Query: 378 SATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIR-YRGDSASHA 436
            +   T    F                 R K F + GI++  +  GL +   + D +   
Sbjct: 412 LSNTTTMGLCFFGVVWGVLFRY----FHRYKIFQVVGIAIKLIGMGLYVACSKKDGSPGI 467

Query: 437 G-IIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXX 495
           G I+ +L +  FG       TQ + QA        A I+ L L + +I            
Sbjct: 468 GLIVAALIVTNFGDAANVMGTQVAAQAAVPHQDMAATISVLSLYS-SIGAAVGTAITSAV 526

Query: 496 WTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLC 555
           WTN LP  + K + ++  A   + S  T I    WG+ +R   + AY++V   L  +GL 
Sbjct: 527 WTNELPGALLKYVPDKEKAITFFES-LTLIWQEPWGSENREGAIAAYQEVNYTLFCMGLG 585

Query: 556 FCIPLLCAALFLRNHRLEDVVALNELDEKN 585
               +   ALF  N  L D     E ++K 
Sbjct: 586 VSSIMFIVALFQTNFYLGDQQNCVEGEQKE 615

>TDEL0A03210 Chr1 (574153..575907) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  132 bits (331), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 116/479 (24%), Positives = 206/479 (43%), Gaps = 20/479 (4%)

Query: 110 QIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEV 169
           QI   ++ DI+GR       +L   +GTI+ +   NV  + A   FY VGY G    + +
Sbjct: 117 QIALCQSIDIWGRAQGFAFMVLSITIGTIMMAGCNNVKTYCAAQVFYWVGYNGIDFTITI 176

Query: 170 IATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGG--DWKWGIGMWAFIFPLACIPL 227
              D + L  R   L   +  +I   W  G    ++     ++WG G+WA I P+ C PL
Sbjct: 177 FIADTTKLKNRAFILAYTSSCYIATVWAYGPAAESILNTIGFRWGFGIWAIIIPVVCSPL 236

Query: 228 GCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFW--KLDMIGLLLMVCFFGC 285
              + +         + K  K  ++PK ++  R F+  V+F+  + D+IG+ ++      
Sbjct: 237 FGLLYYY--------QQKAVKVGLIPKREKSGRTFWQSVVFYGKEFDVIGIFILALGLAL 288

Query: 286 VLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFS 345
            L+ F L     +EW++  II   +IG ++ +   I WE  F+     PW LL +R V  
Sbjct: 289 FLLGFNLYSYQKNEWRSPLIICFLIIGGLLIISFGI-WEY-FAPVSFIPWELLTNRTVIF 346

Query: 346 ALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVR 405
              +A  +   +Y+   Y +       + S   AT IT++YS  S               
Sbjct: 347 TYSMAAAMYCSFYIWDSYFFR-HHCRFNLSTARATYITNIYSIGSCFCALVVGVIIRCYG 405

Query: 406 RTKPFIIF-GISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATT 464
           R K   +F G+ +  +  GL+I+YR   ++   I+     + FG G      Q ++ A +
Sbjct: 406 RLKSIALFWGVPITMLGCGLMIKYRSPDSNLGLIVMCQLFIAFGGGALVICEQMTVMAVS 465

Query: 465 RSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISKAIAN--QTLAAEAYGSPF 522
            + Q +  + A+      I            WT + P ++++ +    Q      YGS  
Sbjct: 466 -AQQHIPAVLAMEAMVIAIGEAVGQTIAGAMWTGIFPKKLAEYLPADVQDQLLSIYGS-L 523

Query: 523 TFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNEL 581
           T  I+   GT  R A+ ++Y D Q+++CI   C     + + L  +   ++++  +  L
Sbjct: 524 TVQISYPRGTAAREAIDRSYGDTQRLMCIAATCIYATCIFSTLLWKEVNVKEIKQVKGL 582

>NCAS0I00100 Chr9 complement(4805..5296) [492 bp, 163 aa] {ON} 
          Length = 163

 Score =  107 bits (267), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/161 (38%), Positives = 88/161 (54%), Gaps = 5/161 (3%)

Query: 451 FFTYTTQASIQATTRSHQKLAVITALYLAAYNIXXXXXXXXXXXXWTNVL-PDRISKAIA 509
            FTY    S QA T SH+ +A +TAL    Y I            WT  L P+ + +   
Sbjct: 1   MFTYPVTVSCQAAT-SHEHMATVTALTYTVYRIGSAVGSAISGCIWTQKLYPEILKRLGG 59

Query: 510 NQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRN 569
           N ++A  AY SP+TFI T TWGT +R AVV+AY+ VQK+  ++ L FC PLL  +L LR+
Sbjct: 60  NVSMATAAYASPYTFITTYTWGTSEREAVVEAYKYVQKLETVVALVFCAPLLMFSLCLRD 119

Query: 570 HRLEDVVALN-ELDEKN--VKEDDPVVDFLAKFIPSLRNKK 607
            +L D VA + E+ E     K++DP+ D+    +   +  K
Sbjct: 120 AKLTDKVAHDGEIPEGEYTTKDEDPIADWFKACVGKFKKSK 160

>Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W
           (REAL)
          Length = 168

 Score = 92.4 bits (228), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 42/125 (33%), Positives = 68/125 (54%)

Query: 41  VQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNC 100
           ++  E+ + Q+    YR+L+  + FL  + + LD  +R               LLST+  
Sbjct: 41  IEESELISSQFNSLTYRILILSTAFLCGFGFSLDATLRSTYTGYATNSYAEHSLLSTIQV 100

Query: 101 IKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGY 160
           I  V++   Q+ F+R SD FGRL +  +A + Y++GTI++SQA +V+ + AG  FY  GY
Sbjct: 101 INAVVSVGSQVVFSRLSDYFGRLELFTVASILYIIGTIVQSQAYSVSIYAAGAVFYNCGY 160

Query: 161 TGAML 165
            G  L
Sbjct: 161 VGVSL 165

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 73.2 bits (178), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 77/347 (22%), Positives = 148/347 (42%), Gaps = 31/347 (8%)

Query: 114 ARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATD 173
            R ++I G    L+I+++ + +G++I + +  +     G      G +G   +  V+ T 
Sbjct: 64  GRLAEILGTTECLMISVVIFEIGSLISALSNTMGTLIGGRVIAGFGGSGIESLAFVVGTS 123

Query: 174 FSNLNWRLLALFVPALPFIINTWISGDVTSAVGG------DWKW------GIGMWAFIFP 221
               N+R + +   A+ ++I    +  V   +GG       W+W       IG +AFI  
Sbjct: 124 IVQENYRGIMITALAVSYVI----AEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAFISL 179

Query: 222 LACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVC 281
             C   G   L  ++L +K +     K+  + K   WK+ F   +L +KLDMIG++L   
Sbjct: 180 AFCCASGGKWLSKKWLLSKINSITSYKYYEIFKASFWKKVF--QILVFKLDMIGIILSSA 237

Query: 282 FFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVC----------LPLY-ILWEMKFSKH 330
            F  +++  +  GG N  W ++ II    +G ++           LPL  + ++ K+++ 
Sbjct: 238 GFTLLMLGLSF-GGNNFAWNSSIIISFFTLGPILLILFCAYDFHILPLLGVHYKSKYAR- 295

Query: 331 PLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVS 390
           PL  W +  + G+F++ I      F + +Q  Y+  +  + +  +   A+      S  +
Sbjct: 296 PLLTWKIASNAGIFTSSITGFFSCFAYELQSAYLVQLYQLVLKRNSMLASIHLWELSIPA 355

Query: 391 XXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAG 437
                       K    KP I+FG+    V  G+     G+ +   G
Sbjct: 356 MITTMATAYLNAKYGIIKPAIVFGVLCGIVGSGIFTLINGEISQSIG 402

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 76/343 (22%), Positives = 141/343 (41%), Gaps = 24/343 (6%)

Query: 114 ARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATD 173
            R ++I G    L+I+++ + +G++I + + ++A   +G      G +G   +  V+ T 
Sbjct: 64  GRLAEILGTKECLMISVIVFEIGSLISALSNSMATLISGRVVAGFGGSGIESLAFVVGTS 123

Query: 174 FSNLNWRLLALFVPALPFIINTWISGDVTSAVGG--DWKW------GIGMWAFIFPLACI 225
               N R + +   A+ ++I   +   +  A      W+W       IG +AFI    C 
Sbjct: 124 IVRENHRGIMITALAISYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAFIILAFCN 183

Query: 226 PLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGC 285
             G     M +L +K  K     +  + K   WK  F  +VL +KLDM+G++L    F  
Sbjct: 184 TSGEPHQKM-WLPSKIKKIMNYDYGELLKASFWKNTF--EVLVFKLDMVGIILSSAGFTL 240

Query: 286 VLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSK-----------HPLTP 334
           +++  +  GG N  W +  II    +G ++ L L+  ++  F              PL  
Sbjct: 241 LMLGLSF-GGNNFPWNSGIIICFFTVGPILLL-LFCAYDFHFLSLSGLHYDNKRIKPLLT 298

Query: 335 WALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXX 394
           W +  + G+F++ I   +  F + +Q  Y+  +  +   +    A+      S  +    
Sbjct: 299 WNIASNCGIFTSSITGFLSCFAYELQSAYLVQLYQLVFKKKPTLASIHLWELSIPAMIAT 358

Query: 395 XXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAG 437
                   K    KP I+FG+    V  GL     G+ +   G
Sbjct: 359 MAIAYLNSKYGIIKPAIVFGVLCGIVGSGLFTLINGELSQSIG 401

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 79/343 (23%), Positives = 139/343 (40%), Gaps = 24/343 (6%)

Query: 114 ARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATD 173
            R ++I G    L+I+++ + VG++I + + ++    +G      G +G   +  V+ T 
Sbjct: 64  GRLAEILGTNECLMISVIIFEVGSLISALSNSMGTLISGRLIAGFGGSGIESLAFVVGTS 123

Query: 174 FSNLNWRLLALFVPALPFIINTWISGDVTSAVGG--DWKW------GIGMWAFIFPLACI 225
               N R   +   A  ++I   +   +  A      W+W       IG +A I    C 
Sbjct: 124 IVQENHRGTMITALATSYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGAFALIILAFCN 183

Query: 226 PLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGC 285
             G  +  +  L+   S     K+  V K   WK+ F   V  +KLDMIG+ L    F  
Sbjct: 184 TSGESLPKVSLLSKIKSIMSY-KYDEVFKASFWKKAF--KVFVFKLDMIGVTLSSAGFTL 240

Query: 286 VLVPFTLAGGMNSEWKTAHIIVPEVIGWVVC----------LPLYIL-WEMKFSKHPLTP 334
           +++  +  GG N  W ++ II    +G ++           LPL  L +E K +K PL  
Sbjct: 241 LMLGLSF-GGNNFAWNSSTIISLFTVGPILLILFCAYDFHFLPLLGLRYENKRTK-PLLT 298

Query: 335 WALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXXX 394
           W++  + G+F++ +      F + +Q  Y+  +  + +      A+      S  +    
Sbjct: 299 WSIASNSGIFTSSVTGFFSCFAYELQSAYLVQLYQLVLKRKPTLASIHLWELSIPAIIAT 358

Query: 395 XXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAG 437
                   K    KP I+FG+    V  GL     G S+   G
Sbjct: 359 MAIAYLNAKYGIIKPAIVFGVLCGIVGSGLFTLINGKSSQSIG 401

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 118/281 (41%), Gaps = 37/281 (13%)

Query: 111 IWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVI 170
           +W  RA+ I G  + ++++I+ + VG+++ + A ++     G     VG +G   +  +I
Sbjct: 97  VW-GRAASIIGFKSSMLLSIIIFEVGSLVSALANSMNMLIGGRVISGVGGSGLQTLCFLI 155

Query: 171 ATDFSNLNWRLLALFVPALPF----IINTWISGDVTSAVGGDWKW------GIGMWAF-I 219
            +   N   R +A+ V +  F    I+  ++ G  T+ V   W+W       IG  AF +
Sbjct: 156 ISTLVNERSRGMAISVLSCSFAVASIVGPFLGGAFTTHV--TWRWCFYINLPIGGLAFLV 213

Query: 220 FPLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYF-FIDVLFWKLDMIGLLL 278
           F L+  P G        + N     +   HV      + K Y+   + L +K D +G  L
Sbjct: 214 FVLSYNPNGG-----NSIKNFTKAVRSISHVDFGGLLKAKSYYNTFEKLVFKFDFVGFAL 268

Query: 279 MVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSK--------- 329
               F  +L+  T  GG    W +  II   VIG V+ +  ++     F++         
Sbjct: 269 CSAGFCLILLGLTF-GGNEYSWGSGTIIAYLVIGIVLSIAFFLYDFFVFNRFKAPRENMV 327

Query: 330 -HPLTPWALLKDRGVFSALIIATMINF--CWYMQGDYMYTV 367
             PL  W ++   GV    I AT +NF  C       +Y V
Sbjct: 328 YRPLVSWNVISKPGV----ITATAVNFTICLMYNAQVIYIV 364

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 115/486 (23%), Positives = 193/486 (39%), Gaps = 48/486 (9%)

Query: 1   MSLESSHSNQGEEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLL 60
           MS  S HS + +++  QK  ++V      + SE         N++   E  K     V L
Sbjct: 5   MSNPSLHSKEAKQQHEQKRQFAVDQKFAHTSSEHDETSIPEDNVKKNVELSKGSILYVSL 64

Query: 61  F---FSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARAS 117
                SLFL A    +   I                L +  +    ++     IW   A+
Sbjct: 65  VAVALSLFLAALDVMIVSTIIEEVAKQLGSYSEIGWLFTGYSLPNALLVL---IWGRIAT 121

Query: 118 DIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNL 177
            I  + TML  AI+ + +G++I + A+++     G     +G  G   +  VI +     
Sbjct: 122 PIGFKATMLF-AIVIFEIGSLISALASSMNMLIGGRVIAGIGGCGIQSLSFVIGSTLVEE 180

Query: 178 NWR--LLALFVP--ALPFIINTWISGDVTSAVGGDWKWGI-------GMWAFIFPLACIP 226
           + R  L+A+     A+  ++  ++ G  TS+V   W+W         G+  F+F L   P
Sbjct: 181 SKRGMLIAILSSSFAIASVVGPFLGGVFTSSV--TWRWCFYINLPIGGLAFFLFVLFYNP 238

Query: 227 -LGCCMLHMRYLANKNSK-----DKLAKHVMVPKD----KEWKRYFFIDVLFWKLDMIGL 276
            L      M+ +    S+      K+A H +  K+      WK+  FI+++F   D+I L
Sbjct: 239 GLHTFRETMKNIPRIPSQFVKVVRKVAHHSLKVKNFNKSNSWKK-LFIELVFM-YDVIEL 296

Query: 277 LLMVCFFGCVLVPFTLAGGMNSEWKTAH----------IIVPEVIGWVVCLPLYILWEMK 326
           +L    F  +L+ FT  GG    W +            +++  +I      P + L +  
Sbjct: 297 VLCSAGFTSILLAFTF-GGNRYAWNSTSIIILFIVGIILVISAIIYDFFVFPKFNLVKAT 355

Query: 327 FSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESV-KSATR-ITS 384
            S  PL  W  +K  GVF+  I   ++   +  Q  Y+     +  ++S  K+A   IT 
Sbjct: 356 PSYQPLMLWRNIKKPGVFTVNIALFLLCAGYISQFTYIVQYFQLIYNDSAWKAAVHLITC 415

Query: 385 LYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCL 444
           + S V             K R+ KP I+    +  V  GLL     +++S A  IG L L
Sbjct: 416 VISTV--ITAIVCGVITDKTRQIKPIIVISSILGVVGAGLLTLLNNNASSSAH-IGLLIL 472

Query: 445 LGFGAG 450
            G   G
Sbjct: 473 PGIAFG 478

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 84/354 (23%), Positives = 146/354 (41%), Gaps = 38/354 (10%)

Query: 111 IWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVI 170
           +W   A    G  T ++ AI+ + +G++I + A ++     G     +G +G   +  VI
Sbjct: 112 LWGRIAFSFLGFKTAMLSAIVIFEIGSLICALANSMDMLIGGRVIAGIGGSGIQSLSFVI 171

Query: 171 ATDFSNLNWR-LLALFVPA---LPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIP 226
            +   +   R  +  F+ A   +  +I  +I G  TS V   W+W    W        +P
Sbjct: 172 GSTLVSPRGRGFIIAFMSASFGIASVIGPFIGGAFTSHV--TWRWC--FWI------NLP 221

Query: 227 LGCCMLHM-RYLANKNSKDK--LAKHVMVPKDKEWKRYFFIDVL---FWKLDMIGLLLMV 280
           +G   L +  ++ N   K +  L  H +    ++ K+  F D+L    +KLD+I  +L+ 
Sbjct: 222 VGAVALVIFTWVYNPTGKKQVLLTIHDLKELSEKVKKVRFKDLLKHLLFKLDIIEFMLIS 281

Query: 281 CFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIG-----------WVVCLPLYILWEMKFSK 329
               C+L+ FT  GG   +W +  II+  VIG           +V+   L I+       
Sbjct: 282 AGIVCILLAFTF-GGNRFKWGSYSIILLFVIGGCLVIVALVYDFVIFPNLQIVKANYIQY 340

Query: 330 HPLTPWALLKDRGVFSALIIATMINFC-WYMQGDYMYTVLVVAVHESVKSATRITSLYSF 388
            PL  W  L+ RG+F+A +  T   FC  YM     Y      ++ S      I  +   
Sbjct: 341 QPLISWKNLRIRGIFTASM--TTFFFCIGYMSQTVYYVQFFQLIYNSSPWKASIHLIAVM 398

Query: 389 V-SXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGL--LIRYRGDSASHAGII 439
           + +            K    KP  + G+ +  +  GL  L+    +SA H G++
Sbjct: 399 IPTVLTAVVCGFLNGKFGYVKPITVAGMCLAVIGAGLLTLLDNHSNSAQHIGLL 452

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 84/378 (22%), Positives = 142/378 (37%), Gaps = 74/378 (19%)

Query: 114 ARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATD 173
            R S + G    +I  I+ +  G++I + A ++    +G     VG +G   +  VI   
Sbjct: 100 GRLSAVLGPRISVISCIILFETGSLISALAKSMNMLISGRVIAGVGGSGLQTLSLVIGCQ 159

Query: 174 FSNLNWRLLALFVPALPF----IINTWISGDVTSAVGGDWKW---------GIGMWAFIF 220
             N   R L L +    F    I+  ++ G  T+ V   W+W         G+ +  FIF
Sbjct: 160 LVNEKSRPLVLSLLNCTFAVASIVGPFLGGAFTTHV--TWRWCFYINLPIGGLAIAIFIF 217

Query: 221 PLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMV 280
                P G  +L       K S+    K ++  +         +D L +  D++  +L  
Sbjct: 218 FYN--PEGADLLE------KGSQT--FKKLLSYRRANLSLKQLLDQLLFGFDIVSFVLFT 267

Query: 281 CFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKH--------PL 332
             +   L+  T  GG    WK+  I++  +I  V+ + L ++++ +   H        PL
Sbjct: 268 AGWLLFLLALTF-GGQTHPWKSG-IVISFIIVGVLLIALSLIYDFRLFDHIKTMDTFRPL 325

Query: 333 TPWALLKDRGVFSA------LIIATMINFCWYMQ-------------GDYMYTVLVVAVH 373
             W L+  R + +A        IA  +   + +Q             G ++  +LV  V 
Sbjct: 326 LSWHLMSQRAILNANFTGFFSTIAYNVQMIYSVQFFQLVYGFSAWKAGLHLIPILVSTVV 385

Query: 374 ESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSA 433
            S+ S   I                    K    KP ++FG +M  +  GL+I     S 
Sbjct: 386 FSIASGVIIK-------------------KTGHIKPLLVFGSAMGVLGSGLMILLNNTST 426

Query: 434 SHAGIIGSLCLLGFGAGF 451
            H   IG L L G   GF
Sbjct: 427 KHTQ-IGVLILPGVALGF 443

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 88/372 (23%), Positives = 151/372 (40%), Gaps = 40/372 (10%)

Query: 111 IWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVI 170
           IW   A+ I  + TML  AI+ + VG++I + A ++     G     VG  G   +  VI
Sbjct: 130 IWGRIATPIGFKRTMLF-AIVIFEVGSLISALANSMNVLIGGRVIAGVGGCGIQSLSFVI 188

Query: 171 ATDFSNLNWRLLALFVPALPF----IINTWISGDVTSAVGGDWKWGI-------GMWAFI 219
            ++    + R + + + +  F    ++  ++ G  TS V   W+W         G+  F+
Sbjct: 189 GSNLVEESNRGVLIAILSCSFAIASVVGPFLGGVFTSRV--TWRWCFYINLPIGGLTFFL 246

Query: 220 FPLACIPLGCCMLH-MRYLANKNSK---------DKLAKHVMVPKDKEWKRYFFIDVLFW 269
           F + C P        +R +    S+           L+K   + K   WK    +  L +
Sbjct: 247 FLMFCNPDPHTFQETVRNILRIPSQLIEFVRKVGHHLSKVKELGKRTSWK--ILLTELVF 304

Query: 270 KLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCL----------PL 319
             D+I  +L    F  +L+ FT  GG    W +A IIV  VIG ++ +          P 
Sbjct: 305 MYDIIEFVLCTAGFTSILLAFTF-GGNRYAWDSAEIIVLFVIGVILVILAAVYDFFVFPK 363

Query: 320 YILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESV-KS 378
           + + +      PL  W  +K  G+F+  I   ++   +  Q  Y+     +  ++S  K+
Sbjct: 364 FDVVKTAPRYQPLMSWRNIKRPGIFTVNIALFLLCTGYISQFTYIVQYFQLIYNDSAWKA 423

Query: 379 ATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGI 438
           A  + +     +            K R+ KP I+    +  V  GLL     +SAS++  
Sbjct: 424 AVHLVACI-IPTVITSVVCGVITDKTRQIKPIIVISSILGVVGAGLLTLLN-NSASNSAH 481

Query: 439 IGSLCLLGFGAG 450
           IG L L G   G
Sbjct: 482 IGLLILPGIAFG 493

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/347 (19%), Positives = 134/347 (38%), Gaps = 30/347 (8%)

Query: 114 ARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATD 173
            R + + G    L+ +I+ +  G+++ + AT++     G      G +G   +V  + T 
Sbjct: 63  GRIASLVGLKNSLVASIVIFEAGSLLAALATSMGMLIGGRVIAGFGGSGIETLVFAVGTR 122

Query: 174 FSNLNWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLH 233
             +   R   + +  + +++       +  A      W    W F      IP+G   L 
Sbjct: 123 MVDEKHRARVVTILGIAYMLAEGAGPFIGGAFAEHVSW---RWCFFIN---IPIGGVALA 176

Query: 234 M----RYLANKNSKDKLAKHVMVPKDKEWKRYF-------FIDVLFWKLDMIGLLLMVCF 282
           +       A +   + L  +    +   WK+ F        + +  ++LD++GLLL    
Sbjct: 177 ILCWGYNPAGRTPINALNHYWKSYRKCSWKKVFRLTSLTKVVKLFIYQLDIVGLLLSSGG 236

Query: 283 FGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEM-----------KFSKHP 331
           F  +++  T  GG    W +A II    IG +  L +++L++                 P
Sbjct: 237 FALIMLALTF-GGNKFAWNSASIICMFTIG-IALLGIFMLYDFVVLPYIGRRLENGEAMP 294

Query: 332 LTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSX 391
           L PW+L  +  + ++ +     +F + +Q  Y+     +  +E    A+      S  + 
Sbjct: 295 LVPWSLACNMPILTSSMAGFFNSFAFELQSIYLVQYYQLVTNEGPVFASIHLWQMSVPAL 354

Query: 392 XXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGI 438
                      K    KP I+ G+   F+  GLL  +  ++++ A I
Sbjct: 355 ITVIVSAAINEKFGIVKPIIVTGVVFGFIGSGLLTLFGSNTSTGASI 401

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 86/375 (22%), Positives = 152/375 (40%), Gaps = 33/375 (8%)

Query: 114 ARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATD 173
            R + + G  T L++++L + +G++I + + ++    AG      G +G   +V ++ T 
Sbjct: 99  GRMASLLGLKTCLMLSVLIFEIGSLIAAVSNSMGMLIAGRVVAGAGGSGIQSLVYIVGTS 158

Query: 174 FSNLNWRLLALFVPALPFIINTWISGDVTSAVG--GDWKWGI-------GMWAFIFPLAC 224
             +   R + + V    F+ +      +  A+     W+W         G  AF+  L  
Sbjct: 159 LVSERSRGMVIMVLTFAFVGSNAGGPILGGALNEHASWRWCFFINLPIGGAAAFMLFLCY 218

Query: 225 IPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFG 284
            P G  +L    L +K    +  ++  V   K W     +D+  ++ D+IG  L    F 
Sbjct: 219 NPSGKPLLST--LTSKLEAARDYRYSNVCTRKFWAHA--LDLGVFRFDIIGFALSSAGFV 274

Query: 285 CVLVPFTLAGGMNSEWKT----AHIIVPEVIGWVVCLPLYILW-----EMKFSKH--PLT 333
            +L+  T  G   S W +    A++ V  V+  V CL  +++       + +S    PL 
Sbjct: 275 LLLLGLTFGGRKYS-WSSGTTIAYLTVGPVLIVVFCLYDFLVLPVLARSLAYSSEVTPLV 333

Query: 334 PWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXX 393
           PW ++   GVF+    +    F + MQ  Y+     V  +ES  +A+      S  +   
Sbjct: 334 PWPVISKPGVFATSFASFFNFFAYNMQIIYLVQFYQVVHNESPTNASTHMWALSIPALVV 393

Query: 394 XXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFT 453
                    K    KP  + G +   +  GLL   +G + S   I    C+L  GAGF  
Sbjct: 394 IIVLGRINKKFGILKPVAVIGAACGTIGAGLLTLLKGSTTSGQSI--GYCILA-GAGF-- 448

Query: 454 YTTQASIQATTRSHQ 468
               A +Q+T  S Q
Sbjct: 449 ---SAVMQSTLLSAQ 460

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 94/399 (23%), Positives = 156/399 (39%), Gaps = 42/399 (10%)

Query: 111 IWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVI 170
           IW  R + I G    LI+AIL +  G++I + A+++     G     VG +G   +  VI
Sbjct: 91  IW-GRFASIIGFQHSLILAILIFEAGSLIAALASSMNMLIFGRVVAGVGGSGLQTLCFVI 149

Query: 171 ATDFSNLNWRLLALFVPALPF----IINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIP 226
                    R L + + +  F    I+   I G  T+ V   W+W      F   L    
Sbjct: 150 GCTMVGERSRPLVISILSCAFAVAAIVGPIIGGAFTTHV--TWRW-----CFYINLPIGG 202

Query: 227 LGCCMLHMRYLANKNS-----KDKLAKHVMVPKDK-----EWKRYFFIDVLFWKLDMIGL 276
           L   M  + Y A         KD +         K      +KR   ++ + +K D  G 
Sbjct: 203 LAIIMFLLTYKAENKGILQQIKDAIGTISSFTFSKFRHQVNFKR--LMNGIIFKFDFFGF 260

Query: 277 LLMVCFFGCVLVPFTLA-GGMNSEWKTAHIIVPEVIGWVVCLPLYILWEM----KFSKHP 331
            L  C  G VL    L  GG    W +  +I   V+G V+     ++++     KF+  P
Sbjct: 261 AL--CSAGLVLFLLGLTFGGNKYSWNSGQVITYLVLG-VLLFIFSLVYDFFLFDKFNPEP 317

Query: 332 --LTPWALLKDRGVFS-ALIIATMINF--CWYMQGDYMYTVL---VVAVHESVKSATRIT 383
             ++   LL  R V   A+II  M+ F  C    G  +Y+V    ++    + K+   + 
Sbjct: 318 DNISYRPLLLRRLVAKPAIIIVNMVTFLLCTGYNGQMIYSVQFFQLIFASSAWKAGLHLI 377

Query: 384 SLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLC 443
            +    +            K+   KP +IFG  +  +  GL+     ++++ +  IG L 
Sbjct: 378 PIV-ITNVIAAIASGVITKKLGLVKPLLIFGGVLGVIGAGLMTLMT-NTSTKSTQIGVLL 435

Query: 444 LLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYN 482
           L GF  GF    +  S Q      +  A +  + + A+N
Sbjct: 436 LPGFSLGFALQASLMSAQLQITKDRPEAAMDFIEVTAFN 474

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 104/514 (20%), Positives = 187/514 (36%), Gaps = 60/514 (11%)

Query: 114 ARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATD 173
            R + I G  T L  +I+ + +G++I + + ++     G      G +G   +V V+ T 
Sbjct: 63  GRLASILGLKTSLTFSIVIFEIGSLIVAVSNSMGMIIGGRVVAGCGGSGIQSLVFVVGTS 122

Query: 174 FSNLNWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLH 233
                 R + + V  L F +   +   +  A   +  W    W F   L    +   ML 
Sbjct: 123 LVEERNRGMVITVLGLAFAVAFAVGPVIGGAFTENVSW---RWCFYINLPIGGVALTMLT 179

Query: 234 MRYLANKNSKDKLAKHVMVPKDKEWKRYFF---IDVLFWK---------LDMIGLLLMVC 281
             Y    N+ +K  +  +    ++ + Y +   +   FW+         LD IG  L   
Sbjct: 180 FSY----NTTEKSVQETLTYNCRQLQTYRYGQWVTASFWRRAYNFLMFDLDFIGFALSST 235

Query: 282 FFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWV----------VCLPLYILWEMKFSKHP 331
            F   ++  T  GG    W +  II    +G +          V L  +  W  K    P
Sbjct: 236 GFVLFMLGLTF-GGNTYAWNSGTIISFLTVGAILVLFWLVFDFVLLYKWAAWCRKREATP 294

Query: 332 LTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSX 391
           L   +L    G+F++ I      F + MQ  Y+  +  +  +    +A+     +   + 
Sbjct: 295 LLRRSLCFRPGIFTSSIANLFTCFGFNMQTVYIVQLYQLVFNSGPTAASMHLWAFLIATM 354

Query: 392 XXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGF 451
                           KP I+FG +   V  GL+   R ++++   +IG   L G   G 
Sbjct: 355 VSVIIIGKAAAIFGLIKPAIVFGATCGLVGSGLMTLVR-NTSTTGNVIGYCILPGAAFGS 413

Query: 452 FTYTT----QASIQATTRSHQKLAV-ITALYLAAYNIXXXXXXXXXXXXWTNVLPDRISK 506
               T    Q  +     + Q + +  TAL     ++            +TN + +++  
Sbjct: 414 IMQGTLLSAQVQVDHDDENFQTMFIEATALNTFVKSLGFSFGGVVATMIFTNSVKNQLRS 473

Query: 507 AIAN-------QTLAA---EAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCF 556
             A        + L A   + Y  P         G+   +  VKA +DV  +   +G C+
Sbjct: 474 TSAGVAAFSSVEALIAYRGQNYDGP---------GSTLSLMFVKAIKDV--MYAALG-CY 521

Query: 557 CIPLLCAALFLRNHRLEDVVALNELDEKNVKEDD 590
            I  + A+LF  N RL  + + N+  E   +E  
Sbjct: 522 GIVFI-ASLFTSNRRLR-LPSKNDGVEATAQEKS 553

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 265 DVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWE 324
           ++  + +D IG  L V   G VL+ F       S W  A+IIV  VI  VV L ++I++E
Sbjct: 260 NIQHFSMDWIGSALGVI--GLVLMNFVWNQAPISGWDQAYIIVLLVIS-VVFLVVFIIYE 316

Query: 325 MKFSKHPLTPWALLKDR 341
            +F+K PL P A+LKDR
Sbjct: 317 NRFAKSPLLPRAVLKDR 333

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 91/391 (23%), Positives = 159/391 (40%), Gaps = 55/391 (14%)

Query: 114 ARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATD 173
            R + I G  + ++ AI+ + +G++I   A ++     G     VG +G   +  VI ++
Sbjct: 134 GRIASIIGFKSCMLAAIIIFEIGSLISGVANSMNMLIGGRVIAGVGGSGIQSLAFVIGSN 193

Query: 174 FSNLNWRLLALFVPALPF----IINTWISGDVTSAVGGDWKW------GIGMWAF-IFPL 222
             +   R L +   +  F    +I  ++ G  T+     W+W       +G  AF +F +
Sbjct: 194 LVDERRRGLIIACMSSAFAVASVIGPFLGGAFTTHA--TWRWCFYINLPVGGVAFALFVV 251

Query: 223 ACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKD-KEWKRY-FFIDVLFWKLDMIGLLLMV 280
              P    +  +  L++        + + V K+ K W  +   +  L ++ D+I  +   
Sbjct: 252 FYNPQRKSLEGISILSSLKEFCNTLRQITVIKNLKNWPTWKSIVYSLVFRFDIIEFIFCS 311

Query: 281 CFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEM----KFSK------- 329
             F  VL+ FT  GG    W +A IIV  VIG ++ L + +L++     +F         
Sbjct: 312 AGFVLVLLAFTF-GGNQYNWSSASIIVMFVIG-IILLIVSLLYDFVIFPRFKAVKENSLY 369

Query: 330 HPLTPWALLKDRGVF----------SALIIAT--MINFCWYMQGDYMYTVLVVAVHESVK 377
            PL  W++    G+F          +A I  T  +I F   ++G+  +   V  +   V 
Sbjct: 370 QPLIKWSIFSHPGIFTANAALFFECTAYICQTVYIIQFFQLVRGNTAWKAAVHLIATVVP 429

Query: 378 SATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAG 437
             T IT+  S ++            K    K     G+    V  GLL     +S+S A 
Sbjct: 430 --TVITTFSSGIANS----------KFGLVKHVTFIGVVTSLVGAGLLTLLDNNSSS-AK 476

Query: 438 IIGSLCL--LGFGAGFFTYTTQASIQATTRS 466
            IG L L  +GFGA   +    A IQ   ++
Sbjct: 477 HIGLLILPGIGFGATMQSTMIGAQIQLDKKA 507

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 66/339 (19%), Positives = 130/339 (38%), Gaps = 26/339 (7%)

Query: 114 ARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATD 173
            R + + G    L+ +I+ +  G+++   A ++            G +G   +V  + T 
Sbjct: 63  GRIASLVGLKCSLMASIVIFEAGSLMAGAANSMGMLIGARVISGFGGSGIESLVYGVGTS 122

Query: 174 FSNLNWRLLALFVPALPFII----NTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLG- 228
                 R   + V  + +++      ++ G +   V   W+W   +   I  +A   LG 
Sbjct: 123 IVEEKHRARVITVLGIAYMLAEGAGPFVGGGLAEHV--SWRWCFYVNLPIGGVALAALGW 180

Query: 229 ----CCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFG 284
                     R LA    + +   +  + + + W+R     ++ ++LD+ GL L    F 
Sbjct: 181 GYNPAGRAPGRALARFWVRARAFPYGTLLQAQFWRRA--AALMVFRLDIPGLALSSGGFA 238

Query: 285 CVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEM-----------KFSKHPLT 333
            V++  T  GG    W++A I+   V G    L L++L++             +   PL 
Sbjct: 239 LVMLALTF-GGNQYAWRSATIVCMFVFG-AALLALFMLYDFVVLPRVGARIAGYEPLPLV 296

Query: 334 PWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSXXX 393
           PW L  +  V ++ +      F + +Q  Y+     + V++    A+      S  +   
Sbjct: 297 PWRLAANVPVLTSSLCGFFNCFAFELQSIYLVQYYQLVVNKGPTLASVHLWQMSLPALVS 356

Query: 394 XXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDS 432
                    +    KP ++ G+ M FV  GLL   R D+
Sbjct: 357 VIASAVVNERFGVVKPLVLAGVVMGFVGSGLLTLVRSDT 395

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 52/242 (21%), Positives = 99/242 (40%), Gaps = 22/242 (9%)

Query: 13  EEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYG 72
           EEI Q+E  +     I+   +    D   +     AE+      RV++  S++L  +   
Sbjct: 70  EEIGQQEEVANGYGSITDPHD---GDNKSERPVSTAEEISGARLRVIML-SMYLGIFLAA 125

Query: 73  LDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILF 132
           +D  I                 +S +     + +A  Q  + + SDIFGR  +L+   + 
Sbjct: 126 IDNTIVSTTSAHVASEFNQLSKVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVA 185

Query: 133 YVVGTIIESQATN-----VARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVP 187
           +++G ++   + +     +ARF AG     VG  G   +  +  TD   L  R +   + 
Sbjct: 186 FLIGCLMCGLSKSFWWLVIARFVAG-----VGGGGLTSMSSITITDLVPLRERAMYQGIC 240

Query: 188 ALPFIINTWISGDVTSAVGGDWKWGIGMWAFIF----PLACIPLGCCMLHMRYLANKNSK 243
            + + + T   G     VGG +    G W   F    PL+ I L   +LH++  + + ++
Sbjct: 241 NVFYGLGTACGG----IVGGWFSDNKGGWRMAFLIQVPLSAISLLVIILHLKLPSKRATR 296

Query: 244 DK 245
           ++
Sbjct: 297 NQ 298

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 47/78 (60%), Gaps = 3/78 (3%)

Query: 270 KLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSK 329
           K+D +G +L V  FG +++ F         W++A+IIV  V+ +   L +++++E+K++K
Sbjct: 270 KMDWLGSVLGV--FGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCA-LVIFVVYEVKYAK 326

Query: 330 HPLTPWALLKDRGVFSAL 347
            PL P A+  +RG+   L
Sbjct: 327 TPLIPKAISSNRGMLMIL 344

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 40/77 (51%)

Query: 106 AAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAML 165
           +A  Q  + + SDIFGR  ++II+ LF+++G +I   + N+    AG     +G  G   
Sbjct: 109 SATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVAGRFIAGIGGGGVTS 168

Query: 166 IVEVIATDFSNLNWRLL 182
           +  + A+D   L  R L
Sbjct: 169 LGSITASDIVPLRSRAL 185

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 72/346 (20%), Positives = 134/346 (38%), Gaps = 30/346 (8%)

Query: 8   SNQGEEE-----IAQKETYSVHSTDISSGSEISIKDAGVQNIE-VYAEQYKKPYYRVLL- 60
           +NQ E++     I Q   Y   +T  S  SE   +DAG   +    + ++  P  R+L+ 
Sbjct: 30  ANQIEQQDHLLDIEQGRAYG-STTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILII 88

Query: 61  FFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIF 120
            FS+FL  +   LDG I                  S +     + ++  Q  + + SD  
Sbjct: 89  MFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRL 148

Query: 121 GRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWR 180
           GR  +L+ +   + +G +I   + ++    AG     +G  G   +  +I +D   L  R
Sbjct: 149 GRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDR 208

Query: 181 LLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANK 240
            +   +    F + T  SG +  A   DW+    +   I  L+ I L    L +   A+ 
Sbjct: 209 AVYQGLCNFVFGLGT-ASGGLVGAYFRDWRLAFILQCPISVLSGI-LIVVYLELPPRASA 266

Query: 241 NSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEW 300
           ++KD  +  +                   +LD  G   ++ F    L   T + G +S  
Sbjct: 267 SNKDCWSARLR------------------RLDWAGATSLIAFL--FLFMLTSSMGGSSVA 306

Query: 301 KTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSA 346
             + +        +V   +++  E++ +  P+ P   L+DR V  +
Sbjct: 307 YGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGS 352

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 51/89 (57%), Gaps = 6/89 (6%)

Query: 269 WKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFS 328
           +K+D IG  + V  FG +L  F       + W +A+IIV  ++  VV L  +I +E++F+
Sbjct: 244 YKMDWIGSAIGV--FGLILFNFVWNQAPIAGWGSAYIIVLLIVA-VVALIAFITYEIRFA 300

Query: 329 KHPLTPWALLKDRGVFSALIIATMINFCW 357
           K PL P ++L +R +   ++I + + F W
Sbjct: 301 KQPLLPHSVLFNRKL---MMILSSLFFGW 326

>TBLA0D05810 Chr4 complement(1441639..1443363) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 69/181 (38%), Gaps = 20/181 (11%)

Query: 4   ESSHSNQGEEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYR-VLLFF 62
           ES HSN  + E  QK+T SV S      SE  I    ++ ++     Y    +  +L+ F
Sbjct: 23  ESVHSNDSQREDNQKQTISVDSF-----SEDDISPNVIEILKRPLSTYITVCFNCILIGF 77

Query: 63  SLFLVAYAYGLDGNI--------RXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFA 114
             F++ +  G  G          R                   +  I  +  A G +   
Sbjct: 78  GGFMMGWDIGTIGGFIAQPDFKRRFGSTTKEGEHYLSKVRTGLLVSIFNIGCAIGSVTLG 137

Query: 115 RASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAGGCFYQVGYTGAMLIVE 168
           R  DI+GR   LI+A   +VVG +IE  + +      + R  AG     +     MLI E
Sbjct: 138 RLGDIYGRRLGLIMATTIFVVGVVIEIASIDKWYQYFIGRIIAGVGMGVIAILSPMLISE 197

Query: 169 V 169
           V
Sbjct: 198 V 198

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 46/78 (58%), Gaps = 3/78 (3%)

Query: 270 KLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSK 329
            +D IG +L +  FG +++ F         W++A+IIV  V+ +   L +++++E+K++K
Sbjct: 294 SMDWIGAILGI--FGLLILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAK 350

Query: 330 HPLTPWALLKDRGVFSAL 347
            PL P A+  +RG+   L
Sbjct: 351 TPLIPKAISSNRGMLMIL 368

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 102/254 (40%), Gaps = 42/254 (16%)

Query: 108 AGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIV 167
           A Q  + + SD+ GR   ++ A  F+ +G ++   A +V +F        VG  G   + 
Sbjct: 87  AFQPLYGKLSDLTGRKFAVLTAHFFFGLGCLLTCFANSVTQFAIARAICGVGGGGINAMS 146

Query: 168 EVIATDFSNLNWRLL----ALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLA 223
            +  +D      R +    A  V  L  I+   I G     +G         W  +F L 
Sbjct: 147 SITVSDICTQRERGIYQGYANIVFGLGQILGAPIGGLFIDTLG---------WRILFGLQ 197

Query: 224 CIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFF 283
              +  C      L +KN   KL+  + V +  +W     ID+L                
Sbjct: 198 VPTILLC----SSLVHKNVNIKLSHLLPVEERFKWSNLSRIDIL---------------- 237

Query: 284 GCVLVPFTLAGGM---NSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKD 340
           G   + FT++G +   ++E   A + +  VI ++     +IL E+ +SK  + P+ LLK 
Sbjct: 238 GSSTLVFTISGVLFLCSTELNKALLSIFTVISFIA----FILIELYYSKERIMPFELLK- 292

Query: 341 RGVFSALIIATMIN 354
            G F     AT+I+
Sbjct: 293 -GSFGLASAATVIS 305

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 80/367 (21%), Positives = 141/367 (38%), Gaps = 52/367 (14%)

Query: 114 ARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATD 173
           AR S + G    ++  I+ +  G++I + A ++    AG     +G +G   +  VI   
Sbjct: 100 ARLSAVLGPRISVVSCIILFEAGSLISALANSMNMLIAGRVVAGIGGSGLQTLSLVIGCQ 159

Query: 174 FSNLNWRLLALFVPALPF----IINTWISGDVTSAVGGDWKWGI-------GMWAFIFPL 222
             +   R L L +    F    I+  ++ G  T+ V   W+W         G+   IF  
Sbjct: 160 LVDEKSRPLVLSLLNCTFAVASIVGPFLGGAFTTHV--TWRWCFYINLPIGGLAIAIFVF 217

Query: 223 ACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCF 282
              P G  +L        N+  K++     P  K  K+   +  L +  D++  +     
Sbjct: 218 FYNPEGVNLLE----KFGNTFKKVSS--FHPVKKSPKKV--LQQLLFGFDILSFISFTAG 269

Query: 283 FGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKF--------SKHPLTP 334
           +   L+  T  GG    W +  +I   +IG V+ + + ++++ K         S  PL  
Sbjct: 270 WLLFLLALTF-GGQTHAWNSGIVISFIIIG-VLLIAISLVYDFKVFEQIKTQDSFRPLLS 327

Query: 335 WALLKDR--------GVFSALII-ATMINFCWYMQGDYMYTVLVVAVHE-SVKSATRITS 384
           W ++ +R        G FS +     MI    + Q  Y ++     +H   +  +T + S
Sbjct: 328 WEIMSNRSILLSNFTGFFSTVAYNVQMIYSVQFFQLVYGFSAWKAGLHLIPILVSTVVFS 387

Query: 385 LYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCL 444
           + S +             K    KP ++FG +M  +  GL+      S  H   IG L L
Sbjct: 388 IASGI----------LTKKTGHIKPLLVFGSAMGVLGGGLMTLLDNKSTKHTQ-IGVLIL 436

Query: 445 LGFGAGF 451
            G   GF
Sbjct: 437 PGVALGF 443

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 102/256 (39%), Gaps = 34/256 (13%)

Query: 106 AAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN-----VARFTAGGCFYQVGY 160
           +A  Q  + + SDIFGR  +L    + + +G +I   A +     + RF +G     VG 
Sbjct: 143 SATFQPLYGKISDIFGRKIVLTFCNVNFFIGCLICGTAKSFWVLVIGRFISG-----VGG 197

Query: 161 TGAMLIVEVIATDFSNLNWRLLALFVPALPF----------IINTWISGDVTSAVGGDWK 210
            G   +  +  +D   L  R  AL+     F          II  W +  +     G W+
Sbjct: 198 GGITSMSTITVSDIIPLRNR--ALYQGVCNFYYGLGIALGGIIGGWFTEKL-----GSWR 250

Query: 211 WGIGMWAFIFPLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWK 270
              G + F  PL+ I     M+ ++    K+SK    +  M            I      
Sbjct: 251 ---GAFLFQVPLSVISTVTVMVWLQL--PKDSKSYGLEITMSNNSSNNGTESIIMKKLKT 305

Query: 271 LDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKH 330
           +D  G + +V F    ++  + AGG +   K+   +   +I  V     +I  E+KF+K 
Sbjct: 306 IDWYGAMSLVIFLLSFMI-LSSAGGSDISVKSNTFLYLTLIS-VTSFISFIYIELKFAKD 363

Query: 331 PLTPWALLKDRGVFSA 346
           P+ P   LKDR V  +
Sbjct: 364 PILPLVFLKDRSVLGS 379

>TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 96/275 (34%), Gaps = 43/275 (15%)

Query: 2   SLESSHSNQGEEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLF 61
            +ES HSN+ ++E   K+ +      +         D   Q IE+  +Q K  Y  V L 
Sbjct: 21  DIESVHSNRFQKEDDMKQDFDDMENSL---------DDTPQAIEI-PKQPKSAYITVCLT 70

Query: 62  -----FSLFLVAYAYGLDGNI------------RXXXXXXXXXXXXXXXLLSTVNCIKTV 104
                F  F+  +  G  G              R               L+S  N    V
Sbjct: 71  CIMVAFGGFINGWDIGTIGGFVAQTDFLERFGSRHSDGTAYLSKVRTGLLVSIFN----V 126

Query: 105 IAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAGGCFYQV 158
             A G +   R  DI+GR   LI+A   +VVG +IE  + +      + R  AG     +
Sbjct: 127 GCAIGSVTLGRLGDIYGRRLGLIMATAIFVVGVVIEIASIDKWYQYFIGRIIAGIGMGVI 186

Query: 159 GYTGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAF 218
                MLI EV   D          L +    F+ +    G  T +    W+ G+G+   
Sbjct: 187 AVLSPMLISEVSPKDMRGAMVSCYQLMITMGIFLGDCCNYGTKTYSDSTQWRVGLGLQ-- 244

Query: 219 IFPLACIPLGCCML---HMRYLANKNSKDKLAKHV 250
            F      +G  M      RYL  K   ++  + V
Sbjct: 245 -FAWCLCMVGGMMFVPESPRYLVEKGKLEEAKRSV 278

>TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {ON} 
          Length = 578

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 63/149 (42%), Gaps = 14/149 (9%)

Query: 107 AAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAGGCFYQVGY 160
           A G +   +  DI+GR   LI+A + +V+G +IE  + +      + R  AG     +  
Sbjct: 127 AVGSVTLGKLGDIYGRRWGLILATIIFVIGVLIEITSVDKWYQYFIGRIIAGIGMGLIAV 186

Query: 161 TGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIF 220
              MLI EV   +          L +    F+ N    G  + +    W+ G+G+  F++
Sbjct: 187 LSPMLISEVAPKELRGAMVSCYQLMITFGIFLGNCCNYGTKSYSNSAQWRIGVGL-QFLW 245

Query: 221 PLACIPLGCCMLHM----RYLANKNSKDK 245
            +  +   C M+ +    RYL  K   ++
Sbjct: 246 SIIMV---CAMMFVPESPRYLIQKGKTEQ 271

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 102/246 (41%), Gaps = 21/246 (8%)

Query: 106 AAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAML 165
           +A  Q  + + SDIFGR  +LI   + + VG++I   + +     AG     +G  G   
Sbjct: 169 SATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAGIGGGGITS 228

Query: 166 IVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGG---DWKWGIGMWAFI-FP 221
           +  +  +D   L  R L   +    F + T + G     VGG   D   G  M   I  P
Sbjct: 229 MSSITTSDIVPLRNRALYQGICNFYFGLGTALGG----VVGGWFSDRSVGWRMSFLIQLP 284

Query: 222 LACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYF-FIDVLFWKLDMIGLLLMV 280
           +A       +L +R       K+   + + V  +     YF  I V    +D IG   +V
Sbjct: 285 IAFFSTILIILFLRL-----PKESKGRGLQVDGN-----YFSTIKVRLSAVDWIGATTLV 334

Query: 281 CFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKD 340
            F    ++  +L GG    + T+H  +   +  V+   ++   E+K +K P+ P   LKD
Sbjct: 335 LFLFSFMITASL-GGKEIPY-TSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKD 392

Query: 341 RGVFSA 346
           R V  +
Sbjct: 393 RSVLGS 398

>Skud_4.5 Chr4 complement(9302..11023) [1722 bp, 573 aa] {ON}
           YJR158W (REAL)
          Length = 573

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 70/165 (42%), Gaps = 20/165 (12%)

Query: 109 GQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNV-ARFTAGGCFYQVGYTG----- 162
           G + FAR +D  GR   ++I +L Y+VG II+  + +   ++  G   Y +G  G     
Sbjct: 122 GGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLC 181

Query: 163 AMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIG---MWAFI 219
            ML+ E+   D       L  L V    F+    + G         W+  +G   +WA I
Sbjct: 182 PMLLSEIAPKDLRGGLVSLFQLNVTFGIFLGYCSVYGTRKYDNTAQWRIPVGLCFLWALI 241

Query: 220 FPLACIPLGCCML--HMRYL----ANKNSKDKLAKHVMVPKDKEW 258
                I +G  ++    RYL     N+ ++  +AK  MV  +  W
Sbjct: 242 -----IIIGMLLVPESPRYLIERGKNEEARISIAKINMVSPEDPW 281

>TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}
          Length = 574

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 50/121 (41%), Gaps = 6/121 (4%)

Query: 101 IKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAGGC 154
           I  V  A G +   R  DI+GR   LI+A + +VVG +IE  + +      + R  AG  
Sbjct: 124 IFNVGCAIGSVTLGRLGDIYGRRLGLIMATVIFVVGVVIEIASIDKWYQYFIGRIIAGIG 183

Query: 155 FYQVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIG 214
              +     MLI EV   D          L +    F+ +    G  T +    W+ G+G
Sbjct: 184 MGVIAVLSPMLISEVSPKDMRGAMVSCYQLMITMGIFLGDCTEYGSKTYSDSTQWRVGLG 243

Query: 215 M 215
           +
Sbjct: 244 L 244

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score = 38.5 bits (88), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 1/44 (2%)

Query: 298 SEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDR 341
           S W  A+IIV  +I  V+ L L+ ++E+ F+K PL P A++KDR
Sbjct: 301 SGWNQAYIIVLLIIS-VLFLVLFGVYEIHFAKSPLLPQAVMKDR 343

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 38.1 bits (87), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 96/243 (39%), Gaps = 26/243 (10%)

Query: 107 AAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLI 166
           AA Q  + R SDI GR   L+IA  F+++GT++   A NV  F        +G  G   +
Sbjct: 93  AAFQPLYGRCSDIVGRKCALLIAQSFFLLGTLLTCFARNVTEFAIARAICGMGGGGIGAM 152

Query: 167 VEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIP 226
             +  +D      R   ++      I     +G V  A  G        W  IF    + 
Sbjct: 153 SSITVSDICTTKER--GMYQGYANVIFG---AGQVLGAPVGGLIMETFNWRIIFAAQVVA 207

Query: 227 LGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCV 286
           +  CM+    LA +N   KL    + P  + + R         ++D+ G  ++ C     
Sbjct: 208 IMICMI----LAYRNINLKLLH--IPPFHQRFTRKN-----LSRIDLFGSSMLSCSLVSF 256

Query: 287 LVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSA 346
           L+ F+ +G   S W          +  +V L L+ + E   +   L P  +L+     SA
Sbjct: 257 LMLFS-SGVSRSLW---------FLLTLVSLTLFCINERYIATERLLPNGILRGHFGLSA 306

Query: 347 LII 349
           L+I
Sbjct: 307 LLI 309

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 3/75 (4%)

Query: 269 WKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFS 328
           + +D IG +L V   G +L+ F    G    W+TA+II   V+  V  L L+  +E+K++
Sbjct: 263 FAMDWIGSVLAVI--GLILLNFVWNQGPIVGWQTAYIIALLVVS-VFFLALFFTYEVKYA 319

Query: 329 KHPLTPWALLKDRGV 343
           + PL P  + K+R +
Sbjct: 320 ESPLLPVEVTKNRHI 334

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 99/254 (38%), Gaps = 43/254 (16%)

Query: 106 AAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNV-----ARFTAGGCFYQVGY 160
           +A  Q  + + SDIFGR  +L++  + ++VG ++     +      ARF +G     +G 
Sbjct: 127 SATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISG-----IGG 181

Query: 161 TGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVT---SAVGGDWKWGIGMWA 217
            G   +  +  +D   L  R L   +    F + T   G V    S  GG W+      A
Sbjct: 182 GGVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACGGVVGGWFSDHGGGWR-----MA 236

Query: 218 FIF--PLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIG 275
           F+   PL+ +      + M+               + P+ K       I      +D IG
Sbjct: 237 FLIQVPLSALSSLLIAVFMK---------------LPPRSKRVNSPASIKNKLLSVDWIG 281

Query: 276 LLLMVCFFGCVLVPFTLAG---GMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPL 332
              +V F    LV  +L G     NS+       V   IG  +    +I  E+  +K P+
Sbjct: 282 ASALVVFLSLFLVTASLGGKEIAFNSK-----TFVALCIGSSLACAFFIGVELYGAKDPI 336

Query: 333 TPWALLKDRGVFSA 346
            P + L++R V  +
Sbjct: 337 LPLSFLRNRSVLGS 350

>YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexose
           transporter, up-regulated in media containing raffinose
           and galactose at pH 7.7 versus pH 4.7, repressed by high
           levels of glucose
          Length = 564

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 103 TVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIE-SQATNVARFTAGGCFYQVGYT 161
           ++  A G + FAR +D  GR   ++I +L Y+VG II+ S      ++  G   Y +G  
Sbjct: 116 SIGCAIGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAG 175

Query: 162 G-----AMLIVEVIATD 173
           G      ML+ E+  TD
Sbjct: 176 GCSVLCPMLLSEIAPTD 192

>YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}
           HXT13Hexose transporter, induced in the presence of
           non-fermentable carbon sources, induced by low levels of
           glucose, repressed by high levels of glucose
          Length = 564

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 103 TVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIE-SQATNVARFTAGGCFYQVGYT 161
           ++  A G + FAR +D  GR   ++I +L Y+VG II+ S      ++  G   Y +G  
Sbjct: 116 SIGCAIGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAG 175

Query: 162 GA-----MLIVEVIATD 173
           G      ML+ E+  TD
Sbjct: 176 GCSVLCPMLLSEIAPTD 192

>YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}
           HXT15Protein of unknown function with similarity to
           hexose transporter family members, expression is induced
           by low levels of glucose and repressed by high levels of
           glucose
          Length = 567

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 103 TVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIE-SQATNVARFTAGGCFYQVGYT 161
           +V  + G + FAR +D  GR   ++I +L Y+VG II+ S      ++  G   Y +G  
Sbjct: 119 SVGCSIGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAG 178

Query: 162 G-----AMLIVEVIATD 173
           G      ML+ E+  TD
Sbjct: 179 GCSVLCPMLLSEIAPTD 195

>YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Protein
           of unknown function with similarity to hexose
           transporter family members, expression is repressed by
           high levels of glucose
          Length = 567

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 103 TVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIE-SQATNVARFTAGGCFYQVGYT 161
           +V  + G + FAR +D  GR   ++I +L Y+VG II+ S      ++  G   Y +G  
Sbjct: 119 SVGCSIGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAG 178

Query: 162 G-----AMLIVEVIATD 173
           G      ML+ E+  TD
Sbjct: 179 GCSVLCPMLLSEIAPTD 195

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 60/273 (21%), Positives = 113/273 (41%), Gaps = 52/273 (19%)

Query: 106 AAAGQIWFARASDIFGRLTMLIIAILFYVVGTII--ESQATNV---ARFTAGGCFYQVGY 160
           +A  Q  + + SDIFGR  +LI + L +  G II   S + N+    RF AG     +G 
Sbjct: 445 SAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSNSLNMLVWGRFVAG-----IGG 499

Query: 161 TGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGG---DWKWGIGMWA 217
            G   +  +  +D   L  R +   +    F + T   G     +GG   D ++G   W 
Sbjct: 500 GGITSMTTITVSDIVPLRSRAVYQGICNFFFGLGTAFGG----VIGGIFVDHQYG---WR 552

Query: 218 FIF----PLACIP--LGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKL 271
            +F    P++ +   L C  L +  +  KN +  L + +M                  ++
Sbjct: 553 MVFWSQVPVSGLSTLLICSFLVVPRI--KNYEVSLGRKLM------------------RV 592

Query: 272 DMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHP 331
           D +G + M+ +    L+  T+ GG++ +  +       +   V  + +++L E+  +  P
Sbjct: 593 DWLGSISMILWLTSFLLITTMMGGISLDIDSDQFHYLIMFSSVSAI-IFVLTELFVASDP 651

Query: 332 LTPWALLKDRGVFSALI-----IATMINFCWYM 359
           + P   L +R V  A +     +   +  C+Y+
Sbjct: 652 VLPLRFLSNRSVLGASLGNFFCVMGFMTICFYL 684

>Smik_25.4 Chr25 (8471..9415) [945 bp, 315 aa] {ON} YJL214W (REAL)
          Length = 315

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 46/103 (44%), Gaps = 9/103 (8%)

Query: 101 IKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAGGC 154
           I  V +A G ++ ++  DI+GR T LII I+ Y+VG +I+  + +      + R  AG  
Sbjct: 119 IFNVGSAIGCLFLSKLGDIYGRCTGLIIVIVVYMVGIVIQIASVDKWYQYFIGRIIAGIG 178

Query: 155 FYQVGYTGAMLIVEVIATDFSNL---NWRLLALFVPALPFIIN 194
              +     MLI E             W+L+  F   L +  N
Sbjct: 179 AGSISVLAPMLISETAPKQIRGTLLACWQLMVTFAIFLGYCTN 221

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 96/397 (24%), Positives = 152/397 (38%), Gaps = 38/397 (9%)

Query: 111 IWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVI 170
           +W  R + I G    LI+A+L +  G+++ + A ++     G     VG +G   +  VI
Sbjct: 89  VW-GRFASIIGFQHSLILAVLIFEAGSLVAALANSMNMLIVGRVVAGVGGSGLQTLCFVI 147

Query: 171 ATDFSNLNWRLLALFVPALPF----IINTWISGDVTSAVGGDWKW------GIGMWAFIF 220
                N   R L + + +  F    I+   I G  T+ V   W+W       IG +A I 
Sbjct: 148 GCTMVNERSRPLVISILSCAFAVAAIVGPIIGGAFTTHV--TWRWCFYINLPIGGFAVIM 205

Query: 221 PLACIPLGC--CMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLL 278
            L          +   R +  + SK +L + +  P +    R   I +LF K D +G  L
Sbjct: 206 FLLTYKTKSENILQQTRNILGRISKFEL-RRLTEPGNL---RKALIGILF-KFDFLGFAL 260

Query: 279 MVCFFGCVLVPFTLA-GGMNSEWKTAHIIVPEVIG---WVVCLPLYILWEMKFSKHP--- 331
                G VL    L  GG    W +  II   V+G   +V  L        KF+  P   
Sbjct: 261 SSA--GLVLFLLGLTFGGNKYSWNSGQIITYLVLGILLFVFSLIYDFFIFQKFNPEPDNT 318

Query: 332 -LTPWALLKDRGVFSALIIATMINF--CWYMQGDYMYTVL---VVAVHESVKSATRITSL 385
              P   LK      A+II  M+ F  C    G  +Y+V    ++    + K+   +  +
Sbjct: 319 SYRPL-FLKRLVAKPAVIIVNMVTFLLCIGYNGQMIYSVQFFQLIFASSAWKAGLHLIPI 377

Query: 386 YSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLL 445
               +            K+   KP +IFG  +  +  GL+     +S S    IG L L 
Sbjct: 378 V-ITNVIAAIASGVITKKLGLVKPLLIFGGILGVIGAGLMTLMSNNSTSSTQ-IGVLILP 435

Query: 446 GFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYN 482
           G   GF    +  S Q   +  +  A    + + A+N
Sbjct: 436 GLSLGFALQASLMSAQLQIKKDRPEATTDFIEITAFN 472

>Ecym_1388 Chr1 complement(806312..808030) [1719 bp, 572 aa] {ON}
           similar to Ashbya gossypii AFR442C
          Length = 572

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 67/166 (40%), Gaps = 28/166 (16%)

Query: 94  LLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQ--ATNVARFTA 151
           LL     + TVI   GQ+ F   +D+ GR  +  + ++  +  T+++    ++    F A
Sbjct: 101 LLKVSTSVGTVI---GQVGFGTLADVVGRKKIYGVELIIMIAATVLQCTIGSSPSINFVA 157

Query: 152 GGCFYQV----GYTGAMLIVEVIATDFSNLNWR---LLALFVPA---------LPFIINT 195
              FY++    G  G   +  +I ++FS   WR   + A+F            L  I+  
Sbjct: 158 VLTFYRIVMGIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQLSCGILALILVA 217

Query: 196 WISGDVTSAVGGD------WKWGIGMWAFIFPLACIPLGCCMLHMR 235
              GD+  A  GD       K    MW  +    C+P G   L+ R
Sbjct: 218 AYKGDLVGATTGDECGFECQKACDQMWRILVGFGCVP-GLIALYFR 262

>ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar to
           uniprot|P30605 Saccharomyces cerevisiae YDR497C ITR1
          Length = 564

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 32/60 (53%)

Query: 96  STVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCF 155
           S V+ +  + A AG I     S++ GR T L+I+  FY +G II + A NV    AG  F
Sbjct: 134 SLVSSLMPLGAVAGSILLTPFSEMLGRKTSLVISCGFYTMGAIICAAALNVQTMYAGRFF 193

>NDAI0E00210 Chr5 complement(19177..21018) [1842 bp, 613 aa] {ON}
           Anc_8.858
          Length = 613

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 45/93 (48%), Gaps = 9/93 (9%)

Query: 94  LLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIE--SQATNVARFTA 151
           LL     + TVI   GQI F   +DI GR  +  + ++  +V TI++  + ++    F A
Sbjct: 117 LLKVSTSVGTVI---GQIGFGTMADIMGRKKIYGLELILMIVTTILQCMTGSSPSINFVA 173

Query: 152 GGCFYQ----VGYTGAMLIVEVIATDFSNLNWR 180
              FY+    +G  G   +  +I ++FS   WR
Sbjct: 174 ILTFYRIVMGIGIGGDYPLSSIITSEFSTTKWR 206

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 67/172 (38%), Gaps = 5/172 (2%)

Query: 11  GEEE--IAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVA 68
           GEEE      E   +HS+   S +  S  D G +  E   + ++ P     +  SL+L  
Sbjct: 2   GEEEGRPGSIELDEIHSSKGES-TVPSFPDTGEE--EDLEKDFRDPNTFPYILLSLWLNT 58

Query: 69  YAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLII 128
               +DG I                 ++ V     +   A Q  + + SD+ GR   L+ 
Sbjct: 59  SICAVDGTIISTTMNEIASIFQEASKVTWVATAYMLTTCAVQPLYGKTSDLLGRKKCLLF 118

Query: 129 AILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWR 180
           A + ++VG ++   A  +           VG +G   +  +I +D + L+ R
Sbjct: 119 AEVVFIVGLVMCGAARTIEELIVARAICGVGGSGLGAMCNIILSDLAPLSQR 170

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 3/79 (3%)

Query: 270 KLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSK 329
           K+D IG LL V   G +L+ F       S W  A+IIV  ++  V  L  + ++E+K ++
Sbjct: 269 KMDWIGSLLGV--IGLILMNFVWNQAPISGWSKAYIIVILIVA-VFFLVAFFIYELKKAE 325

Query: 330 HPLTPWALLKDRGVFSALI 348
            PL P  + K+R + + +I
Sbjct: 326 SPLLPPEVTKNRHIVTIII 344

>SAKL0D00814g Chr4 complement(63086..64798) [1713 bp, 570 aa] {ON}
           highly similar to gnl|GLV|KLLA0C16852g Kluyveromyces
           lactis KLLA0C16852g and similar to uniprot|P25297
           YML123C Saccharomyces cerevisiae PHO84 High- affinity
           inorganic phosphate (Pi) transporter and low- affinity
           manganese transporter
          Length = 570

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 75/192 (39%), Gaps = 38/192 (19%)

Query: 94  LLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQ--ATNVARFTA 151
           LL     + TVI   GQI F   +DI GR  +  + ++  +  T+++     +    F A
Sbjct: 100 LLKVSTSVGTVI---GQIGFGTMADIVGRKKIYGLELIVMMAATVLQCTLGKSPAVSFVA 156

Query: 152 GGCFYQV----GYTGAMLIVEVIATDFSNLNWR---LLALF-----------VPALPFI- 192
              FY+V    G  G   +  +I ++FS   WR   + A+F           + AL  + 
Sbjct: 157 VLAFYRVIMGIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQISAGIVALVLVA 216

Query: 193 --------INTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSKD 244
                   +NT     +  A   D      MW  +  L C+P G   L+ R    ++ + 
Sbjct: 217 AYKNQLIDVNTGAECGIECAKACDQ-----MWRILVGLGCVP-GVVALYFRLTIPESPRY 270

Query: 245 KLAKHVMVPKDK 256
           +L  HV     K
Sbjct: 271 QLDVHVEAENAK 282

>Skud_14.406 Chr14 (740510..742204) [1695 bp, 564 aa] {ON} YNR072W
           (REAL)
          Length = 564

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 77/171 (45%), Gaps = 20/171 (11%)

Query: 103 TVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIE-SQATNVARFTAGGCFYQVGYT 161
           +V  A G + FAR +D  GR   ++I +L Y+VG II+ S +    ++  G   Y +G  
Sbjct: 116 SVGCAIGGLIFARFADKLGRRLAIVIVVLVYMVGAIIQISSSHKWYQYFVGKIIYGLGAG 175

Query: 162 GAMLIVEVIATDFSNLNWR--LLALFVPALPFII---NTWISGDVTSAVGGDWKWGIG-- 214
           G  ++  ++ ++ +  + R  L++L+   + F I      + G         W+  +G  
Sbjct: 176 GCSVLCPMLLSEIAPKDLRGGLISLYQLNMTFGIFLGYCSVYGTRKYDDTAQWRVPLGLC 235

Query: 215 -MWAFIFPLACIPLGCCML--HMRYLANKNSKDK----LAKHVMVPKDKEW 258
            +WA I     I +G  ++    RYL  +   ++    LAK   V  D  W
Sbjct: 236 FLWALI-----IIVGMLLVPESPRYLIEREKHEEARISLAKINKVSPDDPW 281

>Smik_14.401 Chr14 (716260..718170) [1911 bp, 636 aa] {ON} YNR072W
           (REAL)
          Length = 636

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 103 TVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIE-SQATNVARFTAGGCFYQVGYT 161
           +V  A G + FAR +D  GR   ++I +L Y+VG II+ S      ++  G   Y +G  
Sbjct: 188 SVGCAIGGVSFARFADKLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAG 247

Query: 162 GAMLIVEVIATDFSNLNWR--LLALFVPALPFII 193
           G  ++  ++ ++ +  + R  L++L+   + F I
Sbjct: 248 GCSVLCPMLLSEIAPKDLRGGLISLYQLNMTFGI 281

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 106/266 (39%), Gaps = 37/266 (13%)

Query: 111 IWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVI 170
           IW   A+ I  + TML  AI+ + +G++I + A +++    G     VG  G   +  VI
Sbjct: 121 IWGRIATPIGFKETMLF-AIVIFEIGSLISALANSMSMLIGGRVIAGVGGCGIQSLSFVI 179

Query: 171 ATDFSNLNWRLLALFVPALPF----IINTWISGDVTSAVGGDWKW------GIGMWAFIF 220
            +     + R + + V +  F    ++  ++ G  TS+V   W+W       IG  AF  
Sbjct: 180 GSTLVEESQRGILIAVLSCSFAIASVVGPFLGGVFTSSV--TWRWCFYVNLPIGGLAFFL 237

Query: 221 PLACIPLGCC-----MLHMRYLAN------KNSKDKLAKHVMVPKDKEWKRYFFIDVLFW 269
            L     G       M ++R   +      +N    L K     K   W++ F    L +
Sbjct: 238 FLFFYNPGLSTFQETMDNIRKFPSQFIEIVRNVAYHLLKIKGFSKLNGWRKPFM--ELIF 295

Query: 270 KLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAH----------IIVPEVIGWVVCLPL 319
             D+I  +     F C+L+ FT  GG    W +A           ++V   I   +  P 
Sbjct: 296 MYDIIEFVFCSAGFTCILLAFTF-GGNRYAWNSASIIILFIIGIVLVVLAGIYDFLVFPK 354

Query: 320 YILWEMKFSKHPLTPWALLKDRGVFS 345
           + + +      PL  W  +K  G+F+
Sbjct: 355 FNIVKATPHYQPLMSWTNIKKPGIFT 380

>Smik_5.19 Chr5 complement(25102..26805) [1704 bp, 567 aa] {ON}
           YEL069C (REAL)
          Length = 567

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 103 TVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIE-SQATNVARFTAGGCFYQVGYT 161
           +V  A G + FAR +D  GR   ++I +L Y+VG II+ S      ++  G   Y +G  
Sbjct: 119 SVGCAIGGVSFARFADKLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAG 178

Query: 162 GAMLIVEVIATDFSNLNWR--LLALFVPALPFII 193
           G  ++  ++ ++ +  + R  L++L+   + F I
Sbjct: 179 GCSVLCPMLLSEIAPKDLRGGLISLYQLNMTFGI 212

>Smik_6.20 Chr6 (28923..30632) [1710 bp, 569 aa] {ON} YJL219W (REAL)
          Length = 569

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 56/131 (42%), Gaps = 15/131 (11%)

Query: 101 IKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAGGC 154
           I  V +A G ++ ++  DI+GR   LII I+ Y+VG +I+  + +      + R  AG  
Sbjct: 123 IFNVGSAIGCLFLSKLGDIYGRCMGLIIVIVVYMVGIVIQIASVDKWYQYFIGRIIAGIG 182

Query: 155 FYQVGYTGAMLIVEVIATDFSNL---NWRLLALFVPALPFIINTWISGDVTSAVGGDWKW 211
              +     MLI E             W+L+  F   L +  N    G  T +    W+ 
Sbjct: 183 AGSISVLAPMLISETAPKHIRGTLLACWQLMVTFAIFLGYCTNY---GTKTYSNSVQWRV 239

Query: 212 GIGM---WAFI 219
            +G+   WA I
Sbjct: 240 PLGLCFAWAII 250

>TBLA0D05800 Chr4 complement(1435290..1437014) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 62/152 (40%), Gaps = 10/152 (6%)

Query: 107 AAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAGGCFYQVGY 160
           A G +   R  DI+GR   LI+A   +VVG +IE  + +      + R  AG     +  
Sbjct: 130 AIGSVTLGRLGDIYGRRLGLIMATTIFVVGVVIEIASIDKWYQYFIGRIIAGVGMGVIAI 189

Query: 161 TGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIF 220
              MLI EV   +          L +    F+ +    G  T +    W+ G+G+  F +
Sbjct: 190 LSPMLISEVSPREMRGAMVSCFQLMITLGIFLGDCTEYGTKTYSNSVQWRVGLGL-QFAW 248

Query: 221 PLACIPLGCCML--HMRYLANKNSKDKLAKHV 250
            L C+  G   +    RYL  K   ++  + V
Sbjct: 249 CL-CMVGGMMFVPESPRYLVEKGKLEEAKRSV 279

>Smik_10.8 Chr10 (9814..11523) [1710 bp, 569 aa] {ON} YJL214W (REAL)
          Length = 569

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 9/103 (8%)

Query: 101 IKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAGGC 154
           I  V +A G ++ ++  DI+GR   LII I+ Y+VG II+  + +      + R  AG  
Sbjct: 123 IFNVGSAIGCLFLSKLGDIYGRCMGLIIVIVVYMVGIIIQIASVDKWYQYFIGRIIAGIG 182

Query: 155 FYQVGYTGAMLIVEVIATDFSNL---NWRLLALFVPALPFIIN 194
              +     MLI E             W+L+  F   L +  N
Sbjct: 183 AGSISVLAPMLISETAPKQIRGTLLACWQLMVTFAIFLGYCTN 225

>Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)
          Length = 570

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%)

Query: 96  STVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAG 152
           S V+ +  + A AG I     S+ FGR   L I+ +FY VG I+ + A+N     AG
Sbjct: 140 SLVSSLMPLGAVAGSILLTPFSEYFGRKKSLAISCVFYTVGAIVCAAASNHHEMYAG 196

>YJL214W Chr10 (26887..28596) [1710 bp, 569 aa] {ON}  HXT8Protein of
           unknown function with similarity to hexose transporter
           family members, expression is induced by low levels of
           glucose and repressed by high levels of glucose
          Length = 569

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 56/131 (42%), Gaps = 15/131 (11%)

Query: 101 IKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAGGC 154
           I  V +A G ++ ++  DI+GR   LII I+ Y+VG +I+  + +      + R  AG  
Sbjct: 123 IFNVGSAIGCLFLSKLGDIYGRCMGLIIVIVVYMVGIVIQIASIDKWYQYFIGRIIAGIG 182

Query: 155 FYQVGYTGAMLIVEVIATDFSNL---NWRLLALFVPALPFIINTWISGDVTSAVGGDWKW 211
              +     MLI E             W+L+  F   L +  N    G  T +    W+ 
Sbjct: 183 AGSISVLAPMLISETAPKHIRGTLLACWQLMVTFAIFLGYCTNY---GTKTYSNSVQWRV 239

Query: 212 GIGM---WAFI 219
            +G+   WA I
Sbjct: 240 PLGLCFAWAII 250

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 101/251 (40%), Gaps = 37/251 (14%)

Query: 106 AAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN-----VARFTAGGCFYQVGY 160
           +A  Q  + + SDIFGR  +L+ + L + +G +I   + N     + RF AG     +G 
Sbjct: 188 SATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAG-----IGG 242

Query: 161 TGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIF 220
            G   +  +  TD   L  R L   +  + F + T   G     VGG +      W   F
Sbjct: 243 GGLTSMCSITTTDIVPLRSRALYQGICNVFFGLGTACGG----LVGGLFADRAVGWRMAF 298

Query: 221 PLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFW--KLDMI---G 275
            L  +PL              S   +   + +PK  +  +      + W  KL M+   G
Sbjct: 299 -LVQVPLTLL-----------STTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTG 346

Query: 276 LLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPW 335
            + +V F  C    FTL   +  E    H+ +  V+  ++    +I  E+  +  P+ P 
Sbjct: 347 TVTLVVFLFC----FTLVCSLYGE-DLPHLYLIFVV-ILLSGSYFIYHELYVATDPILPI 400

Query: 336 ALLKDRGVFSA 346
             L++R V +A
Sbjct: 401 RFLENRSVLAA 411

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 26/132 (19%), Positives = 52/132 (39%)

Query: 49  EQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAA 108
             ++ P    L+  SL+L      +DG I                L++ V     +   +
Sbjct: 42  RDFRDPKTFPLVLLSLWLNTSICAIDGTIISTTMNEVASIFQEASLVTWVATAYMLTTCS 101

Query: 109 GQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVE 168
            Q  + + SD+ GR   L+ A + +++G ++   A  V           +G +G   +  
Sbjct: 102 VQPLYGKTSDLLGRKKCLLFAEVVFIIGLVLCGMARTVKELAIARAICGIGGSGLGAMCN 161

Query: 169 VIATDFSNLNWR 180
           +I +D + L+ R
Sbjct: 162 IILSDLAPLSQR 173

>NCAS0C00270 Chr3 complement(34958..36670) [1713 bp, 570 aa] {ON}
           Anc_8.858
          Length = 570

 Score = 34.7 bits (78), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 46/96 (47%), Gaps = 15/96 (15%)

Query: 94  LLSTVNCIKTVIAAAGQIWFARASDIFGR-----LTMLIIAILFYVVGTIIESQATNVAR 148
           LL     + TVI   GQ+ F   +DI GR     L ++I+ ++  +  T  ES+A N   
Sbjct: 92  LLKVSTSVGTVI---GQVGFGTIADIVGRKKIYGLELIIMIVMSVLQTTTGESRAIN--- 145

Query: 149 FTAGGCFYQ----VGYTGAMLIVEVIATDFSNLNWR 180
           F A   FY+    +G  G   +  +I ++F+   WR
Sbjct: 146 FVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR 181

>Skud_7.620 Chr7 complement(1041205..1041522,1041626..1042714) [1407
           bp, 468 aa] {ON} YJL214W (REAL)
          Length = 468

 Score = 34.3 bits (77), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 45/103 (43%), Gaps = 9/103 (8%)

Query: 101 IKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAGGC 154
           I  V +A G ++ ++  DI+GR   L+I I+ Y+VG +I+  + +      + R  AG  
Sbjct: 120 IFNVGSAIGCLFLSKLGDIYGRCMGLVIVIVVYMVGIVIQIASVDKWYQYFIGRIVAGVG 179

Query: 155 FYQVGYTGAMLIVEVIATDFSNL---NWRLLALFVPALPFIIN 194
              +     MLI E             W+L+  F   L +  N
Sbjct: 180 AGSISVLAPMLISETAPKQIRGTLLACWQLMVTFAIFLGYCTN 222

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 3/73 (4%)

Query: 269 WKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFS 328
           + +D  G +L V   G +L  F       + W TA+II   +I  V  L  + ++E+K++
Sbjct: 264 FSMDWTGSVLAVI--GLILFNFVWNQAPTAGWGTAYIIALLIIS-VFFLVAFFVYEVKYA 320

Query: 329 KHPLTPWALLKDR 341
           K PL P A+ K+R
Sbjct: 321 KVPLLPHAVTKNR 333

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 34.3 bits (77), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 80/367 (21%), Positives = 142/367 (38%), Gaps = 42/367 (11%)

Query: 111 IWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVI 170
           IW  R + + G    + ++I  + VG+I+ + AT++     G     VG +G   +  VI
Sbjct: 112 IW-GRTASLLGFQASMTLSIFIFEVGSIVSASATSMDNLIVGRVIAGVGGSGLQTLSLVI 170

Query: 171 ATDFSNLNWRLLALFVPALPF----IINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIP 226
            +       R + + +    F    +I  ++ G  T+ V   W+W      F   L    
Sbjct: 171 GSSIVEEKNRAMIVSIVMSAFAAASLIGPFVGGAFTTHV--IWRW-----CFWINLPIGA 223

Query: 227 LGCCMLHMRYLANKNSKD-------KLAKHVMVPKDKEWKRYFFIDV-LFWKLDMIGLLL 278
           +   + +  Y   + S         K  K +   K   W+ Y  +   L ++ D++G   
Sbjct: 224 VTALLFYFTYNPKRLSAASRFTSCFKSVKALSFEKLASWETYRCMGKNLLFRFDIVGFAT 283

Query: 279 MVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWV-----VCLPLYILWEM-----KFS 328
             C   C+L+     GG +  WK+A +I   ++G++     V    YI  ++       S
Sbjct: 284 G-CAGVCLLLLGLTLGGEDDSWKSAIVICFLIVGFLLSVLSVVYDFYIFDKINPEPSNLS 342

Query: 329 KHPLTPWALLKDRGVF--SALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLY 386
             P+    LL +R +   + +  A+ I F  YM     +  LV+    +  +   +  L 
Sbjct: 343 FRPMLVKGLLNNRFILLPNLVTCASAIAFSGYMLYSVQFFQLVMG-SSAWNAGLHLIPLV 401

Query: 387 SFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFG---LLIRYRGDSASHAGIIGSLC 443
              S            K  + KP +I  +S+  +  G   LL  + G+S      IG   
Sbjct: 402 -IASIVSAIICGGIMKKTGQVKPLMISTVSILLIGGGVSTLLDNHSGNSMQ----IGVWI 456

Query: 444 LLGFGAG 450
           L GFG G
Sbjct: 457 LPGFGLG 463

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 47/77 (61%), Gaps = 3/77 (3%)

Query: 265 DVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWE 324
           ++  + +D IG +L V   G +L+ F       S W  A+IIV  +I  V+ L ++I++E
Sbjct: 259 NIHHFSMDWIGSVLGVI--GLILLNFVWNQAPISGWNQAYIIVILIIS-VIFLVVFIIYE 315

Query: 325 MKFSKHPLTPWALLKDR 341
           ++F+K PL P A++KDR
Sbjct: 316 IRFAKTPLLPRAVIKDR 332

>Skud_6.12 Chr6 (17593..18687,18791..19108) [1413 bp, 470 aa] {ON}
           YJL214W (REAL)
          Length = 470

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 45/103 (43%), Gaps = 9/103 (8%)

Query: 101 IKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAGGC 154
           I  V +A G ++ ++  DI+GR   LII I+ Y+VG +I+  + +      + R  AG  
Sbjct: 122 IFNVGSAIGCLFLSKLGDIYGRCVGLIIVIVVYMVGIVIQIASVDKWYQYFIGRIVAGIG 181

Query: 155 FYQVGYTGAMLIVEVIATDFSNL---NWRLLALFVPALPFIIN 194
              +     MLI E             W+L+  F   L +  N
Sbjct: 182 AGSISVLAPMLISETAPKQIRGTLLACWQLMVTFAIFLGYCTN 224

>Skud_13.18 Chr13 complement(23890..25647) [1758 bp, 585 aa] {ON}
           YML123C (REAL)
          Length = 585

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 9/93 (9%)

Query: 94  LLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN--VARFTA 151
           LL     + TVI   GQ+ F   +DI GR  +  + ++  +V TI+++   +     F A
Sbjct: 106 LLKVSTSVGTVI---GQVGFGTLADIVGRKKIYGLELIIMIVCTILQTTVAHSPAINFVA 162

Query: 152 GGCFYQ----VGYTGAMLIVEVIATDFSNLNWR 180
              FY+    +G  G   +  +I ++F+   WR
Sbjct: 163 VLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR 195

>Suva_13.20 Chr13 complement(24012..25766) [1755 bp, 584 aa] {ON}
           YML123C (REAL)
          Length = 584

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 9/93 (9%)

Query: 94  LLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN--VARFTA 151
           LL     + TVI   GQ+ F   +DI GR  +  + ++  +V TI+++   +     F A
Sbjct: 106 LLKVSTSVGTVI---GQVGFGTLADIVGRKKIYGLELIIMIVCTILQTTVAHSPAINFVA 162

Query: 152 GGCFYQ----VGYTGAMLIVEVIATDFSNLNWR 180
              FY+    +G  G   +  +I ++F+   WR
Sbjct: 163 VLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR 195

>Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W
           (REAL)
          Length = 562

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 67/329 (20%), Positives = 129/329 (39%), Gaps = 32/329 (9%)

Query: 63  SLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGR 122
           +LF   +  G DG I                + S +     + + + Q  +   SD  GR
Sbjct: 63  TLFSNVFLAGFDGTITASTYQTIGNEFNQMSISSWITTAYLITSTSFQPLYGSFSDALGR 122

Query: 123 LTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWR-- 180
              L  A   + +G +  S +TN+   +       +G  G + +  ++ +D    + R  
Sbjct: 123 RNCLFFANAVFTIGCLACSFSTNIYMLSFMRALAGIGGGGLITLSTIVNSDVIPSSKRGI 182

Query: 181 LLALFVPALPF--IINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLA 238
             A     L F  I      G +TS +G  W+W    +    P++ I     +L   Y+ 
Sbjct: 183 FQAFQNLLLGFGAICGASFGGTITSTIG--WRW---CFLIQVPISMI---ASLLMNYYVP 234

Query: 239 NKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNS 298
           N+   D    ++++   K  K           +D+ G +L++   G  L    L+ G + 
Sbjct: 235 NQKEYDDQKINILLSSKKILK----------DIDITGSILIIA--GLTLQLLYLSLGASF 282

Query: 299 EWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWY 358
            W    +++  ++  +V + L+IL E K +   + P  L+     F  L I+ ++ F  Y
Sbjct: 283 SWTNPPVLM-LLLASIVIIILFILNERKTTARAIIPMELVNSSFSFVVLSISILVGFASY 341

Query: 359 MQGDYMYTV----LVVAVHESVKSATRIT 383
               Y++T+     +V    + K+  R+T
Sbjct: 342 A---YLFTLPLFFQIVLGDSTAKAGLRLT 367

>TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {ON}
           Anc_5.395 YHR094C
          Length = 574

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 36/70 (51%), Gaps = 8/70 (11%)

Query: 107 AAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAG-GCFYQVG 159
           A G  +  R  D++GR   +IIA + +VVGTII+  +        + R  AG GC   + 
Sbjct: 131 AIGCFFLGRLGDMYGRRMAIIIASIIFVVGTIIQIASVKAWYQYMIGRIVAGLGCGI-IA 189

Query: 160 YTGAMLIVEV 169
            +  MLI EV
Sbjct: 190 ISSPMLISEV 199

>YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease of
           basic amino acids in the vacuolar membrane
          Length = 458

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 99/239 (41%), Gaps = 20/239 (8%)

Query: 257 EWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLA-GGMNSEWKTAHIIVPEVIGWVV 315
            +KR   ++ + +K D  G  L  C  G VL    L  GG    W +  +I   V+G V+
Sbjct: 119 NFKR--LMNGIIFKFDFFGFAL--CSAGLVLFLLGLTFGGNKYSWNSGQVIAYLVLG-VL 173

Query: 316 CLPLYILWEM----KFSKHP--LTPWALLKDRGVFS-ALIIATMINF--CWYMQGDYMYT 366
                ++++     KF+  P  ++   LL  R V   A+II  M+ F  C    G  +Y+
Sbjct: 174 LFIFSLVYDFFLFDKFNPEPDNISYRPLLLRRLVAKPAIIIINMVTFLLCTGYNGQMIYS 233

Query: 367 VL---VVAVHESVKSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFG 423
           V    ++    + K+   +  +    +            K+   KP +IFG  +  +  G
Sbjct: 234 VQFFQLIFASSAWKAGLHLIPIV-ITNVIAAIASGVITKKLGLVKPLLIFGGVLGVIGAG 292

Query: 424 LLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYN 482
           L+     ++++ +  IG L L GF  GF    +  S Q      +  A +  + + A+N
Sbjct: 293 LMTLMT-NTSTKSTQIGVLLLPGFSLGFALQASLMSAQLQITKDRPEAAMDFIEVTAFN 350

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 82/206 (39%), Gaps = 18/206 (8%)

Query: 17  QKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGN 76
             ET ++    IS  +E ++ D G ++   ++E    P    +   +L + ++   LD  
Sbjct: 2   SDETAALLVPVISPTTETALVDTGEESTTSHSE--LPPTKVRITVLALLMGSFLSALDTT 59

Query: 77  IRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVG 136
           I                 +S +     +  +A Q  + + SDIFGR  +LI++ L + +G
Sbjct: 60  IVATLLPTIASDLDASSQMSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALG 119

Query: 137 -TIIESQATN------VARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVPAL 189
             I  S  TN        RF AG     +G  G   +  +  +D   L  R +   +  +
Sbjct: 120 CAICGSPWTNNVWVLSTGRFVAG-----IGGGGQATLSTITTSDIIPLRKRGVYQGLVNI 174

Query: 190 PFIINTWISGDVTSAV---GGDWKWG 212
            F +    SG V  AV   G  W+W 
Sbjct: 175 CFSLGC-ASGSVLGAVLQQGIGWRWA 199

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 80/381 (20%), Positives = 144/381 (37%), Gaps = 50/381 (13%)

Query: 111 IWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVI 170
           IW  R + + G  T  + AI+ + VG+++ + A ++     G     +G +G   +V VI
Sbjct: 97  IW-GRIATLVGFKTSTLAAIVIFEVGSLVSALANSMDMLIGGRVIAGIGGSGVQSLVFVI 155

Query: 171 ATDFSNLNWRLLALFVPALPF----IINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIP 226
           ++       R L + V +  F    ++  ++ G  T+ V   W+W   +   +  LA   
Sbjct: 156 SSTLVEERNRGLIIAVMSSSFGIASVVGPFLGGAFTTHV--TWRWCFYINLPVGGLAFFL 213

Query: 227 LGCCMLHMRYLANKNSKD--------------------KLAKHVMVPKDK-----EWKRY 261
                   +++ NK++ +                    +  K V V   K      W+  
Sbjct: 214 FLTFYNPEKWVVNKDTAEDEVVGNGRLGLLSILGGQAVRFVKSVGVQLAKLRYPGTWR-- 271

Query: 262 FFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYI 321
                LF++ D++  + M      +L+ FT  GG   +W +   I   V+G +  L  ++
Sbjct: 272 IIARELFYRFDIVEFVFMTLGSVLILLAFTF-GGNKYKWNSGSTISMFVLGILFTLGAFV 330

Query: 322 LWEMKFSK----------HPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVA 371
                + K           PL  W + K  GV+   I    +   + +Q +Y+     + 
Sbjct: 331 YDFFIYPKFEAVKTVPHYQPLMSWNICKKPGVWLFNIAVFFVACAFSIQTNYIIQYFQLV 390

Query: 372 VHESV-KSATRITSLYSFVSXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRG 430
            +++  K+A  + +    V             K    KP  IF      +  GLL     
Sbjct: 391 FNDTAWKAAIHLIATVVPVVITVVSSGIVNS-KTGYVKPIAIFSGVTGIIGAGLLTLLD- 448

Query: 431 DSASHAGIIGSLCLLG--FGA 449
           + AS A  IG L L G  FGA
Sbjct: 449 NHASSAKKIGLLILPGVTFGA 469

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 86/393 (21%), Positives = 146/393 (37%), Gaps = 35/393 (8%)

Query: 114 ARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATD 173
            R + I G    LI+A+L +  G+++ + A ++     G     VG +G   +  VI   
Sbjct: 101 GRFASIIGFQHSLILAVLIFEAGSLVAALANSMNMLIVGRVVAGVGGSGLQTLCFVIGCT 160

Query: 174 FSNLNWRLLALFVPALPF----IINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGC 229
             +   R L + + +  F    I+   I G  T+ V   W+W      F   L    L  
Sbjct: 161 MVDERSRPLVISILSCAFAVAAIVGPIIGGAFTTHV--TWRW-----CFYINLPIGGLAV 213

Query: 230 CMLHMRYLAN--------KNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVC 281
            M  + Y A         K +  K++        K       I+ L +K D  G  L   
Sbjct: 214 IMFLLTYDAKNDGIIQQMKGALRKISGFEFSRLKKPGNLRKAINCLIFKFDFFGFALSST 273

Query: 282 FFGCVLVPFTLA-GGMNSEWKTAHIIVPEVIGWVVCL-----PLYILWEMKFSKHPLTPW 335
             G VL    L  GG    W +  +I   V+G V+ +       ++  +    +  ++  
Sbjct: 274 --GLVLFLLGLTFGGNKYTWSSGQVITYLVLGIVLFIFSLVYDFFLFDKFNPERDNISYR 331

Query: 336 ALLKDRGVFS-ALIIATMINF--CWYMQGDYMYTVL---VVAVHESVKSATRITSLYSFV 389
            L   R V   A+II  M+ F  C    G  +Y+V    ++    + K+   +  +    
Sbjct: 332 PLFLRRLVAKPAIIIVNMVTFLLCTGYNGQMIYSVQFFQLIFASSAWKAGLHLIPIV-IT 390

Query: 390 SXXXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGA 449
           +            K+   KP +IFG  +  +  GL+   + +S S    IG L L GF  
Sbjct: 391 NVIAAIASGIITKKLGLVKPLLIFGGFLGVIGAGLMTLMKNNSTSSTQ-IGVLILPGFSL 449

Query: 450 GFFTYTTQASIQATTRSHQKLAVITALYLAAYN 482
           GF    +  S Q      +    +  + + A+N
Sbjct: 450 GFALQASLMSAQLQINKDRPETPMDFIEITAFN 482

>TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 8/68 (11%)

Query: 109 GQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAG-GCFYQVGYT 161
           G  +  R  D++GR   LIIA   ++VGTII+  +        + R  AG GC   +   
Sbjct: 123 GSFFLGRLGDMYGRRIGLIIATTIFIVGTIIQVASVKAWYQYMIGRIVAGVGCGV-IAML 181

Query: 162 GAMLIVEV 169
             MLI EV
Sbjct: 182 SPMLISEV 189

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 8/74 (10%)

Query: 103 TVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAG-GCF 155
            V  A G  +  R  DI+GR   LI+A + +++GT+I+  +        + R  AG GC 
Sbjct: 128 NVGQAIGSFFLGRLGDIYGRRIGLIVASVIFIIGTVIQIASVKAWYQYMIGRIIAGLGCG 187

Query: 156 YQVGYTGAMLIVEV 169
             +     MLI EV
Sbjct: 188 L-IAILSPMLISEV 200

>NCAS0B00220 Chr2 complement(20530..22407) [1878 bp, 625 aa] {ON}
           Anc_8.858
          Length = 625

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 45/93 (48%), Gaps = 9/93 (9%)

Query: 94  LLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIE--SQATNVARFTA 151
           LL     + TVI   GQ+ F   +D+ GR  +  + ++  ++ TI++  + ++    F A
Sbjct: 140 LLKVSTSVGTVI---GQVGFGTMADVIGRKKIYGMELILMIITTILQCTTGSSPGINFVA 196

Query: 152 GGCFYQ----VGYTGAMLIVEVIATDFSNLNWR 180
              FY+    +G  G   +  +I ++FS   WR
Sbjct: 197 VLTFYRILMGIGIGGDYPLSSIITSEFSTTKWR 229

>TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}
          Length = 568

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 8/74 (10%)

Query: 103 TVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAG-GCF 155
            V  A G  +  R  DI+GR   LI+A   ++VGT+I+  +        + R  AG GC 
Sbjct: 121 NVGQAIGSFFLGRLGDIYGRRIGLIVASFIFIVGTVIQIASVKAWYQYMIGRIVAGLGCG 180

Query: 156 YQVGYTGAMLIVEV 169
             +     MLI EV
Sbjct: 181 L-IAILSPMLISEV 193

>KNAG0C05190 Chr3 (1014564..1016258) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 6/69 (8%)

Query: 107 AAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAGGCFYQVGY 160
           A G I  ++A D++GR   LII +  Y+VG +I+    N      + R  +G     +  
Sbjct: 121 AIGGIILSKAGDMYGRKKGLIIVVSIYIVGIVIQIATINKWYQYFIGRIISGLGVGGISV 180

Query: 161 TGAMLIVEV 169
              MLI EV
Sbjct: 181 LSPMLISEV 189

>NDAI0B03060 Chr2 complement(775021..776817) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 4/52 (7%)

Query: 94  LLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN 145
           L+S VN    +  A G I  ++A D++GR   L I  + Y+VG II+  A N
Sbjct: 149 LVSIVN----IGCAIGGIVLSKAGDVYGRRKGLTIVTMVYMVGIIIQISAVN 196

>KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON}
           uniprot|Q8NJ22 Kluyveromyces lactis KLLA0E08987g frt1
           Hexose transporter
          Length = 566

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%)

Query: 96  STVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAG 152
           S ++ +  + A  G I     S+ FGR   L+I+ +FY +G I+ + A +V    AG
Sbjct: 132 SLISSLMPLGAVGGSILLTPLSEYFGRKVALVISCIFYTIGGILCAAAQDVHTMYAG 188

>Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}
           YIL171W (HXT12) - hexose permease [contig 381] FULL
          Length = 569

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 24/39 (61%)

Query: 107 AAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN 145
           A G +   +  DI+GR   L+I I+ YVVGTII+  A +
Sbjct: 129 AFGGLTLPKLGDIYGRRLGLMIVIVLYVVGTIIQISAQD 167

>TBLA0B02940 Chr2 (677253..679238) [1986 bp, 661 aa] {ON} Anc_8.858
           YML123C
          Length = 661

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 11/94 (11%)

Query: 94  LLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIES---QATNVARFT 150
           LL     + TV+   GQ+ F   +D+ GR  +    ++  +V TI+++   QA  ++ FT
Sbjct: 103 LLKVSTSVGTVV---GQVGFGVLADLLGRKKIYGCELIIIIVCTILQTMCGQAPGLS-FT 158

Query: 151 AGGCFYQV----GYTGAMLIVEVIATDFSNLNWR 180
           A   FY++    G  G   +  +I ++F+   WR
Sbjct: 159 AMLTFYRIVMGLGIGGDYPLSSIITSEFATTKWR 192

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 44/79 (55%), Gaps = 3/79 (3%)

Query: 271 LDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKH 330
           +D IG +L V   G +L  F    G    W+ A+IIV  ++  V+ L  + ++E+K++K 
Sbjct: 272 MDWIGSVLGV--IGLILFNFVWNQGPIVGWEKAYIIVLLIVS-VIFLIAFFVYEIKYAKV 328

Query: 331 PLTPWALLKDRGVFSALII 349
           PL P A+ ++  + + L +
Sbjct: 329 PLLPKAVTQNGHILTILTV 347

>TBLA0A03400 Chr1 complement(810961..812685) [1725 bp, 574 aa] {ON}
           Anc_5.394 YHR092C
          Length = 574

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 6/75 (8%)

Query: 101 IKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAGGC 154
           I  V  A G +   R  D++GR   LIIA + ++VG +IE  +        + R  AG  
Sbjct: 124 IFNVGCAIGCVALGRLGDMYGRRMGLIIASIIFIVGNVIEIASVEAWYQYFIGRIVAGVG 183

Query: 155 FYQVGYTGAMLIVEV 169
              +     MLI EV
Sbjct: 184 MGVIAVLSPMLISEV 198

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 61/155 (39%), Gaps = 12/155 (7%)

Query: 107 AAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLI 166
            A Q  + + SD+ GR T L++A  F++VG +  + + N+  F+       +G  G   +
Sbjct: 89  TAFQPLYGKLSDLAGRKTALMVAHSFFLVGCLFTALSRNLVEFSIARAVCGMGAGGISAL 148

Query: 167 VEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIP 226
             +  +D      R +      + F   + + G +     G W      W  IF      
Sbjct: 149 SSISVSDICTPKERGVYQGYANVVFGTGSMLGGPI-----GGWLMDSFGWKVIFAGQVPL 203

Query: 227 LGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRY 261
           +  CM    +L  +N   KL   + VP   E  R+
Sbjct: 204 IMTCM----FLGYRNVNIKL---LHVPPRHERYRW 231

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 51/121 (42%), Gaps = 15/121 (12%)

Query: 110 QIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNV-----ARFTAGGCFYQVGYTGAM 164
           Q  + + SDIFGR  +L+ + L + +G ++   A  V      RF AG     +G  G  
Sbjct: 204 QPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAG-----IGGGGLT 258

Query: 165 LIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLAC 224
            +  +I +D   L  R     +  + +++   + G +     G W    G W  +F L  
Sbjct: 259 SMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSM-----GGWLAEYGGWRLVFLLQV 313

Query: 225 I 225
           +
Sbjct: 314 V 314

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 77/356 (21%), Positives = 135/356 (37%), Gaps = 25/356 (7%)

Query: 114 ARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATD 173
            R + IFG    L+++IL +  G++I + + ++     G     +G +G   +  VIA+ 
Sbjct: 97  GRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVIAST 156

Query: 174 FSNLNWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLH 233
            +    R +A+ V +  + +    S  + SA      W    W F   L    L   +L 
Sbjct: 157 LTTERSRGVAISVLSCAYAVAAVASPFMGSAFTTHVTW---RWCFYINLPIGGLAFAVLV 213

Query: 234 MRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKL------DMIGLLLMVCFFGCVL 287
           + Y  ++ +  +    V+    +      F   L+ K+          +  + C  G +L
Sbjct: 214 LTYKPHEGNSARSIVSVLKSCCEFGTARLFSKDLYLKMFNELVFGFDFIGFIFCSVGFIL 273

Query: 288 VPFTLA-GGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSK----------HPLTPWA 336
               L  GG    W +  IIV  V+G  + +   +   M F K           PL PW+
Sbjct: 274 FRLGLTFGGDKYTWSSGAIIVYFVVGVTISVAFLLYDFMVFPKFGRVRKNASFRPLVPWS 333

Query: 337 LLKDRGVFSALIIATMINFCWYMQGDYMYTVL-VVAVHESVKSATRITSLYSFVSXXXXX 395
           ++   G+ +A+    ++   +  Q  Y+     +V   ++ +++  + +L          
Sbjct: 334 VVSRPGIATAVAANFLMCVAYSAQVVYIIQFFQLVRGSDAWRASIHVVAL-EIPDIITVA 392

Query: 396 XXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLG--FGA 449
                       KP I  GI    V  GLL     DS S    IG L L G  FGA
Sbjct: 393 ISGAISRMTGHVKPIIFVGIIAGLVGAGLLTLLDNDSGSSKH-IGLLILPGVAFGA 447

>NCAS0F03100 Chr6 complement(618654..620366) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 6/69 (8%)

Query: 107 AAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAGGCFYQVGY 160
           A G I  A++ DI+GR   LII +  Y+VG +I+  +        + R  +G     +  
Sbjct: 127 AFGGIILAKSGDIYGRKMGLIIVVCIYIVGIVIQIASVKAWYQYFIGRIISGLGVGGIAV 186

Query: 161 TGAMLIVEV 169
              MLI EV
Sbjct: 187 LSPMLISEV 195

>YML123C Chr13 complement(24037..25800) [1764 bp, 587 aa] {ON}
           PHO84High-affinity inorganic phosphate (Pi) transporter
           and low-affinity manganese transporter; regulated by
           Pho4p and Spt7p; mutation confers resistance to
           arsenate; exit from the ER during maturation requires
           Pho86p; cells overexpressing Pho84p accumulate heavy
           metals but do not develop symptoms of metal toxicity
          Length = 587

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 9/93 (9%)

Query: 94  LLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN--VARFTA 151
           LL     + TVI   GQ  F   +DI GR  +  + ++  +V TI+++   +     F A
Sbjct: 106 LLKVSTSVGTVI---GQFGFGTLADIVGRKRIYGMELIIMIVCTILQTTVAHSPAINFVA 162

Query: 152 GGCFYQ----VGYTGAMLIVEVIATDFSNLNWR 180
              FY+    +G  G   +  +I ++F+   WR
Sbjct: 163 VLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR 195

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 54/130 (41%), Gaps = 8/130 (6%)

Query: 106 AAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAML 165
           +A  Q  + + SDIFGR  +LI + + + +G +I   +  +    AG     +G  G   
Sbjct: 177 SATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFIAGIGGGGLTS 236

Query: 166 IVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVT---SAVGGDWKWGIGMWAFIFPL 222
           +  +  +D   L  R L   +    F + T   G V    S  GG W+      AF+  +
Sbjct: 237 MSSITTSDIVPLRNRALYQGICNFFFGLGTACGGLVGGWFSEHGGGWR-----VAFLIQI 291

Query: 223 ACIPLGCCML 232
               + C ++
Sbjct: 292 PLCAISCSLI 301

>AFL205C Chr6 complement(49039..50679) [1641 bp, 546 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR094C
           (HXT1)
          Length = 546

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 69/163 (42%), Gaps = 17/163 (10%)

Query: 107 AAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAGGCFYQVGY 160
           A G I+ ++ +D++GR   L+I  L YV+G +++  +T+      + R  +G     +  
Sbjct: 111 AVGGIFLSKFADMYGRRIGLMIVTLVYVIGIVVQISSTDKWYQYCIGRVISGLGVGGIAV 170

Query: 161 TGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGGDWK-WGIGMWAFI 219
              MLI E        +      L + A  F+   + +   T A   D K W I +    
Sbjct: 171 LSPMLISETSPKHLRGMLVSCYQLMITAGIFV--GYCANYGTKAKYEDSKQWRIPL-GLS 227

Query: 220 FPLACIPLGCCML---HMRYLANKN----SKDKLAKHVMVPKD 255
           F  A + +G  +L     RYL   N    +K  LA+   VP D
Sbjct: 228 FAWAILMIGGMVLVPESPRYLVEVNKYEDAKRSLARSNKVPVD 270

>TBLA0A01250 Chr1 (294923..296434) [1512 bp, 503 aa] {ON} 
          Length = 503

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 8/70 (11%)

Query: 107 AAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAG-GCFYQVG 159
           A G  +  R  D++GR   +I+A + +VVGT+I+  +        + R  AG GC   + 
Sbjct: 60  AIGCFFLGRLGDMYGRRIAIIVASIIFVVGTVIQIASVKAWYQYMIGRIVAGLGCGI-IA 118

Query: 160 YTGAMLIVEV 169
            +  MLI EV
Sbjct: 119 ISSPMLISEV 128

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 56/268 (20%), Positives = 113/268 (42%), Gaps = 23/268 (8%)

Query: 104 VIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGA 163
           + + + Q  +   SD+ GR   L  A + + +G +    + N+   +    F  +G  G 
Sbjct: 113 ITSTSFQPLYGSFSDVLGRRKCLFFASMIFSIGCLGCGISINILWLSFMRAFTGIGGGGL 172

Query: 164 MLIVEVIATDFSNLNWR----LLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFI 219
           + +  ++ +D    + R         +  L  I      G +TS++G  W+     W F+
Sbjct: 173 ITLSTIVNSDMIPTSKRGIFQAFQNLLLGLGAICGASFGGVITSSIG--WR-----WCFL 225

Query: 220 FPLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLM 279
             +     G  + H+ Y+ N++  ++  K     + KE  ++  ID     L +IGL L 
Sbjct: 226 LQVPISLAGALIGHL-YVRNQDEYER-RKSKESSQTKEMLKH--IDFSGAFLIIIGLTLQ 281

Query: 280 VCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLK 339
           + +    L   + A    + W +  +    V  ++V L L++L E + S   + P  L++
Sbjct: 282 LVY----LSLGSAADESGNTWSSPGLSAVLVASFIV-LVLFVLTEERTSARAIIPSKLVR 336

Query: 340 DRGVFSALIIATMINFCWYMQGDYMYTV 367
               F  L I+ ++ F  Y    Y++T+
Sbjct: 337 SLFSFLVLTISVLVGFASYA---YLFTL 361

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 78/360 (21%), Positives = 139/360 (38%), Gaps = 33/360 (9%)

Query: 114 ARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATD 173
            R + IFG    L+++IL +  G++I + + ++     G     +G +G   +  VIA+ 
Sbjct: 97  GRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVIAST 156

Query: 174 FSNLNWRLLALFVPALPFII----NTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGC 229
            +    R +A+ V +  + +      ++ G  T+ V   W+W      F   L    L  
Sbjct: 157 LTTERSRGVAISVLSCAYAVAAVAGPFMGGAFTTHV--TWRW-----CFYINLPIGSLAF 209

Query: 230 CMLHMRYLANK-NSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMI-----GLLLMVCFF 283
            +L + Y  ++ NS   +   +    +    R F  D+     D +      +  + C  
Sbjct: 210 AVLVLTYKPHEGNSARSIVSVLKSCCEFGTARLFSKDLYLKMFDELVFGFDFIGFIFCSV 269

Query: 284 GCVLVPFTLA-GGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSK----------HPL 332
           G +L    L  GG    W +  IIV  ++G  + +   +   M F K           PL
Sbjct: 270 GFILFLLGLTFGGDKYAWSSGAIIVYFIVGVTISVAFLLYDFMIFPKFGRVRKNASFRPL 329

Query: 333 TPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVL-VVAVHESVKSATRITSLYSFVSX 391
            PW+++   G+ +A+    ++   +  Q  Y+     +V   ++ +++  + +L      
Sbjct: 330 VPWSVVSRPGIATAVAANFLMCVAYSAQVVYIIQFFQLVRGSDAWRASIHVVAL-EIPDI 388

Query: 392 XXXXXXXXXXIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLG--FGA 449
                           KP I  GI    V  GLL     DS S    IG L L G  FGA
Sbjct: 389 ITVAISGAISRMTGHVKPIIFVGIIAGLVGAGLLTLLDNDSGSSKH-IGLLILPGVAFGA 447

>TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}
          Length = 578

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 8/74 (10%)

Query: 103 TVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAG-GCF 155
            V  A G  +  R  DI+GR   LI+A + ++ GTII+  +        + R  AG GC 
Sbjct: 131 NVGQAIGSFFLGRLGDIYGRRIGLIVASVIFIAGTIIQIASIKAWYQYMIGRIVAGLGCG 190

Query: 156 YQVGYTGAMLIVEV 169
             +     MLI EV
Sbjct: 191 L-IAILSPMLISEV 203

>TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 8/70 (11%)

Query: 107 AAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAG-GCFYQVG 159
           A G  +  R  D++GR   +I+A + ++VGT+I+  +        + R  AG GC   + 
Sbjct: 126 AIGCFFLGRLGDMYGRRIAIIVASIIFIVGTVIQIASVKAWYQYMIGRIVAGLGCGI-IA 184

Query: 160 YTGAMLIVEV 169
            +  MLI EV
Sbjct: 185 ISSPMLISEV 194

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 66/295 (22%), Positives = 113/295 (38%), Gaps = 26/295 (8%)

Query: 44  IEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKT 103
           +E    +Y     +  + FSL+L ++   LDG I                    +     
Sbjct: 22  LEQKFHEYNLALPKFPILFSLWLGSFLSSLDGTIVANIMNRVAEEFSESSRKQWIATSFL 81

Query: 104 VIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGA 163
           +   A Q  + + SDI GR + L+ A  F+ +G ++   A NV  F+       +G  G 
Sbjct: 82  LTNTAFQPLYGKLSDITGRKSALLTAHFFFGIGCLLTCFARNVTEFSIARAICGIGAGGL 141

Query: 164 MLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLA 223
             I  +  +D      R +      + F +   +     + +GG +   IG W  +F + 
Sbjct: 142 NAIGSIAVSDICTARERGVYQGYANIVFGLGQLLG----APLGGVFIETIG-WRALFGVQ 196

Query: 224 CIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFF 283
              +  C +    LA KN   KL     VP  KE  RY   ++   ++D+ G L +V   
Sbjct: 197 VPVIMLCSV----LAIKNINIKLFH---VPPMKE--RYTLKNL--SRIDIFGSLSLVATI 245

Query: 284 GCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALL 338
             VL  F  +  +N  + T   I   ++        +IL E  ++   + P  LL
Sbjct: 246 SGVL--FLCSSHLNKLYLTLFTIGSFIV--------FILVERYYATEKILPLELL 290

>Kwal_56.22285 s56 (26966..28669) [1704 bp, 567 aa] {ON} YNR072W
           (HXT17) - Putative hexose transporter [contig 187] FULL
          Length = 567

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%)

Query: 107 AAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN 145
           A G +  ++  DIFGR   L+  +  YVVGTII+  A++
Sbjct: 126 ALGGLTLSKLGDIFGRRLALMFVVGVYVVGTIIQISASD 164

>Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W
           (HXT17) - Putative hexose transporter [contig 159] FULL
          Length = 567

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%)

Query: 107 AAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN 145
           A G +  ++  DIFGR   L+  +  YVVGTII+  A++
Sbjct: 126 ALGGLTLSKLGDIFGRRLALMFVVGVYVVGTIIQISASD 164

>Kwal_14.854 s14 complement(82977..84689) [1713 bp, 570 aa] {ON}
           YMR011W (HXT2) - high affinity hexose transporter-2
           [contig 245] FULL
          Length = 570

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 107 AAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN 145
           A G +   R  D++GR   L+  IL YVVG II+  ++N
Sbjct: 130 AIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSN 168

>ZYRO0G00286g Chr7 (18542..20311) [1770 bp, 589 aa] {ON} highly
           similar to uniprot|P39003 Saccharomyces cerevisiae
           YDR343C HXT6 High-affinity glucose transporter of the
           major facilitator superfamily nearly identical to Hxt7p
           expressed at high basal levels relative to other HXTs
           repression of expression by high glucose requires SNF3
          Length = 589

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 6/69 (8%)

Query: 107 AAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAGGCFYQVGY 160
           A G +   + +D++GR   + IA +FYVVGT+I   + +      + R  +G     +  
Sbjct: 147 AFGGLILTKPADVYGRKLAVTIAAVFYVVGTVISIASIDKWYQYMIGRIISGLGVGSLAV 206

Query: 161 TGAMLIVEV 169
              MLI EV
Sbjct: 207 LSPMLISEV 215

>AFL207C Chr6 complement(44349..45968) [1620 bp, 539 aa] {ON}
           Unclear if syntenic homolog of Saccharomyces cerevisiae
           YDR343C (HXT6), YDR342C (HXT7) and YHR092C (HXT4)
          Length = 539

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 107 AAGQIWFARASDIFGRLTMLIIAILFYVVGTIIE-SQATNVARFTAGGCFYQVGYTGAML 165
           A G I  +R  D++GR   L+I  L YVVG II+ S  T   ++  G     +G  G  +
Sbjct: 106 AVGGIILSRLGDMYGRRIGLMIVSLIYVVGIIIQISSNTKWYQYCIGRVISGLGVGGIAV 165

Query: 166 IVEVIATDFSNLNWR 180
           +  ++ ++ S  + R
Sbjct: 166 LSPMLISETSPKHLR 180

>NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa]
           {ON} 
          Length = 573

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 60/155 (38%), Gaps = 17/155 (10%)

Query: 2   SLESSHSNQGEEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKP---YYRV 58
           ++ S + N  +   +   ++S+     + G +  +KD G   I  + E  KKP   Y  V
Sbjct: 11  AVGSQNVNDNDLAPSDSGSHSILENQSNKGEDDEMKDFGDNEIAPH-EMPKKPASEYVTV 69

Query: 59  -LLFFSLFLVAYAYGLD-GNIRXXXXXX------XXXXXXXXXLLSTVN-----CIKTVI 105
            +L   +    Y YG D G I                       LS V       I  + 
Sbjct: 70  SILCLMIAFGGYVYGWDTGTISGFVSQTDWIRRFGQKHHDGTHYLSKVRTGLLLAIFNIG 129

Query: 106 AAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIE 140
            A G + F+R  DI+GR   L+   + Y+VG II 
Sbjct: 130 CAIGGLLFSRLGDIYGRRKALVFVTVVYMVGLIIS 164

>Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011W
           (REAL)
          Length = 541

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%)

Query: 107 AAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN 145
           A G +   R  DI+GR   L+  IL Y+VG +I+  +T+
Sbjct: 118 AVGGLTLGRLGDIYGRKIGLMCVILVYIVGIVIQIASTD 156

>NDAI0G01520 Chr7 complement(336365..337957) [1593 bp, 530 aa] {ON}
           Anc_3.23
          Length = 530

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 94  LLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIE 140
           LL  +  I  +  A G +  A+ +D FGR T L + ++ YV+G +I+
Sbjct: 107 LLGLIISIFNIGCAVGSVTLAKLADWFGRKTGLYVTVIIYVIGLLIQ 153

>CAGL0B02475g Chr2 (236029..237771) [1743 bp, 580 aa] {ON} highly
           similar to uniprot|P25297 Saccharomyces cerevisiae
           YML123c PHO84
          Length = 580

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 44/96 (45%), Gaps = 15/96 (15%)

Query: 94  LLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVAR----- 148
           LL     + TVI   GQ+ F   +DI GR  +  + ++  +  TI++   T + R     
Sbjct: 107 LLKVSTSVGTVI---GQLGFGTMADIVGRKKIYGLELIVMIATTILQ---TTIGRSPGIN 160

Query: 149 FTAGGCFYQ----VGYTGAMLIVEVIATDFSNLNWR 180
           F A   FY+    +G  G   +  +I ++F+   WR
Sbjct: 161 FPAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR 196

>TPHA0I00380 Chr9 (72432..74168) [1737 bp, 578 aa] {ON} Anc_8.858
           YML123C
          Length = 578

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 42/93 (45%), Gaps = 9/93 (9%)

Query: 94  LLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTII-----ESQATN-VA 147
           LL     + TV    GQ+ F   +D+ GR  +  + ++  +V TI+     +S A N VA
Sbjct: 94  LLKVSTSVGTVF---GQVGFGTLADVVGRKKIYGLELIVVIVTTILQCTAGQSPAVNFVA 150

Query: 148 RFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWR 180
             T       +G  G   +  +I ++FS   WR
Sbjct: 151 ILTTYRIVMGIGIGGDYPLSSIITSEFSTTKWR 183

>TDEL0E02290 Chr5 (441643..443358) [1716 bp, 571 aa] {ON} Anc_5.395
           YHR094C
          Length = 571

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%)

Query: 101 IKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIE 140
           I  V  A G I  +R  D++GR   LI  ++ YVVG +I+
Sbjct: 122 IFNVGCAIGGIILSRIGDVYGRRVGLITVVIIYVVGILIQ 161

>Skud_6.61 Chr6 (114670..116310) [1641 bp, 546 aa] {ON} YFL011W
           (REAL)
          Length = 546

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 107 AAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN 145
           A G +   R  DI+GR   L+  IL YVVG +I+  +T+
Sbjct: 111 AVGGLTLGRLGDIYGRRIGLMWVILVYVVGIVIQIASTD 149

>Smik_13.11 Chr13 complement(20464..22224) [1761 bp, 586 aa] {ON}
           YML123C (REAL)
          Length = 586

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 43/93 (46%), Gaps = 9/93 (9%)

Query: 94  LLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN--VARFTA 151
           LL     + TVI   GQ+ F   +DI GR  +  + ++  +  TI+++   +     F A
Sbjct: 106 LLKVSTSVGTVI---GQVGFGTLADIVGRKKIYGMELIVMIFCTILQTTVAHSPAINFVA 162

Query: 152 GGCFYQ----VGYTGAMLIVEVIATDFSNLNWR 180
              FY+    +G  G   +  +I ++F+   WR
Sbjct: 163 VLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR 195

>TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%)

Query: 96  STVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAG 152
           S V+ +   +   G I     S+ FGR   L+++ +FY VG I+ + A N     AG
Sbjct: 140 SLVSSLMPWVLVGGSILLTPLSETFGRKKALVMSCIFYTVGAIVCAAAGNHHEMYAG 196

>Skud_13.163 Chr13 (274262..275905) [1644 bp, 547 aa] {ON} YHR094C
           (REAL)
          Length = 547

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%)

Query: 107 AAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN 145
           A G +   R  DI+GR   L+  +L Y+VG +I+  ++N
Sbjct: 118 AIGGLTLGRLGDIYGRRIGLMCVVLVYIVGIVIQIASSN 156

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 284 GCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGV 343
           G +L  F    G    W   +II   ++  V  L  + ++E+KF+K PL P  ++K+R +
Sbjct: 282 GMILFNFVWNQGPIDGWNKGYIIALLIVS-VFLLIAFFIYEIKFAKSPLLPPEVIKNRHI 340

>ZYRO0A00902g Chr1 complement(64264..66078) [1815 bp, 604 aa] {ON}
           similar to uniprot|P25297 Saccharomyces cerevisiae
           YML123C PHO84 High-affinity inorganic phosphate (Pi)
           transporter and low-affinity manganese transporter
           regulated by Pho4p and Spt7p mutation confers resistance
           to arsenate exit from the ER during maturation requires
           Pho86p
          Length = 604

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 74/194 (38%), Gaps = 38/194 (19%)

Query: 66  LVAYAYGLDGNIRXXXXXXXXXXXXXXXLLSTVNCIKTVIAAAGQIWFARASDIFGRLTM 125
           ++ Y Y  DGNI                LL     + TVI   GQ  F   +D+ GR  +
Sbjct: 84  MMTYVYWKDGNI----------PSSSETLLKVSTSVGTVI---GQFGFGILADVLGRKKI 130

Query: 126 LIIAILFYVVGTIIES--QATNVARFTAGGCFYQVGYTGAML----IVEVIATDFSNLNW 179
             + ++  +   I++    A+    FTA   F+++     +     +  +I ++FS   W
Sbjct: 131 YGVELIIMIAACIMQCVIGASPAVNFTAIMTFFRIIMGIGIGGDYPLSSIITSEFSTTKW 190

Query: 180 R---LLALFVPA---------LPFIINTWISGDVTSAVGGDW------KWGIGMWAFIFP 221
           R   + A+F            +  I+      D+ +A  G        +    MW  +  
Sbjct: 191 RGAIMSAVFANQAFGQVAAGIVALILVEGYKDDLKAAKSGSTCGPSCKRACDQMWRILIG 250

Query: 222 LACIPLGCCMLHMR 235
           + C+P GC  L+ R
Sbjct: 251 MGCVP-GCIALYFR 263

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 52/137 (37%)

Query: 37  KDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRXXXXXXXXXXXXXXXLLS 96
           ++A V  +E    +Y     +  + FSL+L ++   LD  I                   
Sbjct: 15  EEAEVLPLEQKYHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQ 74

Query: 97  TVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFY 156
            +     +   A Q  + + SDI GR   L+ A  F+ +G ++   A NV  F+      
Sbjct: 75  WIATSFLLTNTAFQPLYGKLSDIIGRRPALLTAQFFFGLGCLMTCFARNVTEFSIARAVC 134

Query: 157 QVGYTGAMLIVEVIATD 173
            +G  G   I  +  +D
Sbjct: 135 GIGAGGLNAISSIAVSD 151

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 64/165 (38%), Gaps = 18/165 (10%)

Query: 107 AAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAGGCFYQVGY 160
           A G ++  +  D++GR   LI     +VVG II+  + +      + R  AG     +  
Sbjct: 135 AIGSVFLGKLGDLYGRRWGLIFGTSIFVVGVIIQIASVSKWFQYFIGRIIAGIGMGVIAV 194

Query: 161 TGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIF 220
              MLI EV   +          L +    F+ N    G  +      W+  +G+     
Sbjct: 195 LSPMLISEVAPKELRGAMVSCYQLMITFGIFLGNCCNYGTKSYQNSKQWRIAVGLQF--- 251

Query: 221 PLACIPLGCCMLHM----RYLANKN----SKDKLAKHVMVPKDKE 257
            L CI +   M  +    RYL  +N    +K+ +A    + K+ E
Sbjct: 252 -LWCIIMVSGMTFVPESPRYLVQQNMFEEAKESIAISNKLSKESE 295

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 45/76 (59%), Gaps = 3/76 (3%)

Query: 265 DVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWE 324
           ++  + +D IG +L V   G +L+ F       S W  A+IIV  +I  V+ L ++I++E
Sbjct: 262 NIHHFSMDWIGSVLGVI--GLILLNFVWNQAPISGWSQAYIIVILIIS-VIFLAVFIIYE 318

Query: 325 MKFSKHPLTPWALLKD 340
           M F+K PL P A++KD
Sbjct: 319 MWFAKSPLLPHAVIKD 334

>TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.84
           YDR497C
          Length = 634

 Score = 31.6 bits (70), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%)

Query: 111 IWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAG 152
           I+   A+D+FGR   L+ + L +VVG I++  A    + TAG
Sbjct: 191 IFAGTAADVFGRKPCLMFSNLMFVVGAIVQITAHKFWQMTAG 232

>Smik_12.140 Chr12 (270030..271751) [1722 bp, 573 aa] {ON} YLR081W
           (REAL)
          Length = 573

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 6/69 (8%)

Query: 107 AAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAGGCFYQVGY 160
           A G I  ++A D++GR   L I +  Y+VG II+  + N      + R  +G     +  
Sbjct: 133 AFGGIILSKAGDMYGRKKGLSIVVSVYIVGIIIQIASINKWYQYFIGRIISGLGVGGIAV 192

Query: 161 TGAMLIVEV 169
              MLI E+
Sbjct: 193 LSPMLISEI 201

>NDAI0C01740 Chr3 (378218..380041) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 6/75 (8%)

Query: 101 IKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATN------VARFTAGGC 154
           I  V AA G +  AR  D++GR   LI  +  Y VG +I+  + +      + R  +G  
Sbjct: 139 IFNVGAAIGGVMLARTGDMWGRRLGLITVVSIYTVGIVIQIASIDKWFQYFIGRIISGLG 198

Query: 155 FYQVGYTGAMLIVEV 169
              +     MLI EV
Sbjct: 199 VGGIAVLAPMLISEV 213

>TPHA0B03900 Chr2 (920520..922184) [1665 bp, 554 aa] {ON} Anc_1.432
          Length = 554

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%)

Query: 108 AGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVG 159
            G +   + SD FGR   L +   F+++G II+  + NV    AG     +G
Sbjct: 84  GGALVSPKFSDAFGRRVSLHLCAAFWIIGAIIQCASQNVGMLVAGRVISGIG 135

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.140    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,229,144
Number of extensions: 2220660
Number of successful extensions: 7254
Number of sequences better than 10.0: 292
Number of HSP's gapped: 7035
Number of HSP's successfully gapped: 292
Length of query: 638
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 522
Effective length of database: 40,180,143
Effective search space: 20974034646
Effective search space used: 20974034646
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 69 (31.2 bits)