Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0I024706.13ON47547525200.0
NCAS0D026206.13ON49347521980.0
KAFR0B065206.13ON49546420420.0
KNAG0E027506.13ON49846220420.0
CAGL0A01045g6.13ON48346020280.0
SAKL0E00946g6.13ON49346419920.0
Ecym_30166.13ON48946019900.0
TDEL0G045806.13ON48447019870.0
KLTH0C11462g6.13ON49246019830.0
KLLA0D00902g6.13ON49246219740.0
Kwal_56.223626.13ON49346219710.0
TPHA0J002706.13ON49647419660.0
Kpol_1032.46.13ON46746019480.0
YPL262W (FUM1)6.13ON48846319470.0
Smik_6.4706.13ON48846319450.0
Skud_16.166.13ON48846319420.0
Suva_16.436.13ON48846319280.0
Kpol_1045.766.13ON48546518920.0
ACR013C6.13ON48846118780.0
ZYRO0C07964g6.13ON50546118770.0
TBLA0A071306.13ON50045918180.0
TBLA0G010006.13ON46545917990.0
Skud_8.701.354ON4632461518e-10
KLLA0A08404g1.354ON4612521421e-08
SAKL0D09746g1.354ON4642471401e-08
AEL019W1.354ON4692461402e-08
Ecym_27491.354ON4702491392e-08
NDAI0G059401.354ON4622471392e-08
CAGL0I08987g1.354ON4612461383e-08
Suva_15.2011.354ON4632471374e-08
NCAS0A090101.354ON4622461374e-08
Smik_8.831.354ON4632461365e-08
KAFR0A009501.354ON4642501357e-08
YHR018C (ARG4)1.354ON4632471331e-07
ZYRO0G00748g1.354ON4622461294e-07
TBLA0F034801.354ON4662451294e-07
KNAG0I015601.354ON4622471285e-07
TDEL0D022201.354ON4652461277e-07
TPHA0A021901.354ON4632531268e-07
Kpol_1018.1251.354ON4602461171e-05
Skud_12.4434.197ON4822221115e-05
Suva_10.4594.197ON4822221116e-05
YLR359W (ADE13)4.197ON4822221116e-05
TBLA0A083204.197ON4822081106e-05
KLLA0B13189g4.197ON4822121107e-05
Smik_12.4464.197ON4822221107e-05
SAKL0B04972g4.197ON4822111091e-04
Ecym_24524.197ON4822111081e-04
TDEL0E017604.197ON4822111081e-04
ABL006C4.197ON4822221062e-04
CAGL0B02794g4.197ON4822081062e-04
NDAI0J019504.197ON4822111035e-04
KLTH0G19338g1.354ON4652721026e-04
NCAS0J012004.197ON4822111027e-04
TPHA0B010404.197ON4822081010.001
KLTH0A03344g4.197ON4822111000.001
Kwal_47.180664.197ON4822221000.001
Kpol_1042.164.197ON482211990.002
KNAG0B058404.197ON482211980.002
ZYRO0B07964g4.197ON482206960.003
KAFR0A062304.197ON482222960.004
Kwal_27.127821.354ON465272930.008
AAR086W3.438ON80757780.53
KNAG0D034804.117ON116282697.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0I02470
         (475 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   975   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   851   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   791   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   791   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   785   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   771   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   771   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   769   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   768   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   764   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   763   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   761   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   754   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   754   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   753   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   752   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   747   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   733   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   728   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   727   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   704   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   697   0.0  
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    63   8e-10
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    59   1e-08
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    59   1e-08
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    59   2e-08
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    58   2e-08
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    58   2e-08
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    58   3e-08
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    57   4e-08
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    57   4e-08
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    57   5e-08
KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.3...    57   7e-08
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    56   1e-07
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    54   4e-07
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    54   4e-07
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    54   5e-07
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    54   7e-07
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    53   8e-07
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    50   1e-05
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    47   5e-05
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    47   6e-05
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    47   6e-05
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    47   6e-05
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    47   7e-05
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    47   7e-05
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    47   1e-04
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    46   1e-04
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    46   1e-04
ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON} S...    45   2e-04
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    45   2e-04
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    44   5e-04
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    44   6e-04
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    44   7e-04
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    44   0.001
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    43   0.001
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    43   0.001
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    43   0.002
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    42   0.002
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    42   0.003
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    42   0.004
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    40   0.008
AAR086W Chr1 (496601..499024) [2424 bp, 807 aa] {ON} Syntenic ho...    35   0.53 
KNAG0D03480 Chr4 complement(625236..628724) [3489 bp, 1162 aa] {...    31   7.1  

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
           Anc_6.13 YPL262W
          Length = 475

 Score =  975 bits (2520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/475 (100%), Positives = 475/475 (100%)

Query: 1   MSTNSKTPSNESSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAF 60
           MSTNSKTPSNESSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAF
Sbjct: 1   MSTNSKTPSNESSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAF 60

Query: 61  GILKKSAAIVNQSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANE 120
           GILKKSAAIVNQSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANE
Sbjct: 61  GILKKSAAIVNQSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANE 120

Query: 121 VISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKN 180
           VISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKN
Sbjct: 121 VISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKN 180

Query: 181 SLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGG 240
           SLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGG
Sbjct: 181 SLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGG 240

Query: 241 TAVGTGLNTKVGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLF 300
           TAVGTGLNTKVGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLF
Sbjct: 241 TAVGTGLNTKVGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLF 300

Query: 301 KIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVM 360
           KIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVM
Sbjct: 301 KIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVM 360

Query: 361 AGSQGQFELNVYKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLV 420
           AGSQGQFELNVYKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLV
Sbjct: 361 AGSQGQFELNVYKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLV 420

Query: 421 TALNPKIGYDAASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPKP 475
           TALNPKIGYDAASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPKP
Sbjct: 421 TALNPKIGYDAASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPKP 475

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
           Anc_6.13 YPL262W
          Length = 493

 Score =  851 bits (2198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/475 (84%), Positives = 444/475 (93%)

Query: 1   MSTNSKTPSNESSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAF 60
           MS ++ T +++  +R+ETDSFGEIKVP++KYWGAQTQRSFQNFKIGG RE+IP PII AF
Sbjct: 19  MSLSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAF 78

Query: 61  GILKKSAAIVNQSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANE 120
           GILKKSAAIVN+SLGTLDP +A PI KA+DEV+QGKL DHFPLVVFQTGSGTQTNMN NE
Sbjct: 79  GILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNE 138

Query: 121 VISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKN 180
           VISNRA EL+G +LGSK+IHPNNH NQSQSSNDTFPSVMHIAAVLE+ N+LIP+LT+LK+
Sbjct: 139 VISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKD 198

Query: 181 SLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGG 240
           +LD KAKE+A+IVKIGRTHLQDATPLTLGQEFSGYVQQL NGI RI++SLYHLKFLAQGG
Sbjct: 199 ALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGG 258

Query: 241 TAVGTGLNTKVGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLF 300
           TAVGTGLNTK+GFDK+IA+EVSKETGI+F+TAPNKFEALAAHDAIVFAS A+ TVAGSLF
Sbjct: 259 TAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLF 318

Query: 301 KIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVM 360
           KIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQV +QIMGNNQTI +
Sbjct: 319 KIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISI 378

Query: 361 AGSQGQFELNVYKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLV 420
           AGSQGQFELNVYKPLMIANLLNSIRLM+DAC SF+IHC+D LKAN DKINENL+KSLMLV
Sbjct: 379 AGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLV 438

Query: 421 TALNPKIGYDAASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPKP 475
           TALNPKIGYDAASK+AKNAH KNITLKESALEL  LT EEFD+WV+PENMIGPKP
Sbjct: 439 TALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPKP 493

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
           YPL262W
          Length = 495

 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/464 (80%), Positives = 421/464 (90%)

Query: 11  ESSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIV 70
           +SSFR ETDSFGEI VP++KYWGAQTQRS QNFKIGGEREKIP+PII+AFGILKKSAAIV
Sbjct: 31  KSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKKSAAIV 90

Query: 71  NQSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELI 130
           N+ LGTLD  +A  II A+DEV QGKLNDHFPLVVFQTGSGTQ+NMNANEVISNRA EL+
Sbjct: 91  NERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELM 150

Query: 131 GAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYA 190
           G +LGSK +HPNNHVNQSQSSNDTFP+VMHIAA+LE+   L+P+L  LKNSLD K+ E+ 
Sbjct: 151 GGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNEFN 210

Query: 191 NIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTK 250
           +IVKIGRTHLQDATPLTLGQEFSGYVQQ+TNGI RI+ +LYHLKFLAQGGTAVGTGLNTK
Sbjct: 211 DIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLNTK 270

Query: 251 VGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLG 310
            GFDK+IA+++S+ETGI+FETAPNKFEALAAHDAIV  S A+ T+A SLFKIAQDIRYLG
Sbjct: 271 AGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYLG 330

Query: 311 SGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELN 370
           SGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQV +Q+MGN+ TI  AGSQGQFELN
Sbjct: 331 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQGQFELN 390

Query: 371 VYKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYD 430
           VYKPL+I+NLL+SIRL++DA +SF++HC+DGLKAN + I ENL+KSLMLVTALNP IGYD
Sbjct: 391 VYKPLLISNLLSSIRLLTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNPYIGYD 450

Query: 431 AASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPK 474
            ASK+AKNAH KNITLKESALELGLLTEE+F +WVIPE MIGPK
Sbjct: 451 NASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPK 494

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
           YPL262W
          Length = 498

 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/462 (80%), Positives = 424/462 (91%)

Query: 14  FRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQS 73
           FRVETDSFGEI VP+++YWGAQTQRSFQNFKIGG+REKIP P+++AFGILKKSAA VN++
Sbjct: 37  FRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFGILKKSAATVNEN 96

Query: 74  LGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAE 133
           LGTLD SIA  I  A+DEV +GKL+DHFPLVVFQTGSGTQ+NMNANEVISNRA EL+G E
Sbjct: 97  LGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGE 156

Query: 134 LGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIV 193
           LGSK++HPNNHVNQSQSSNDTFP+VMHIAA  E+ N LIP+L  LK++L +K +E+++IV
Sbjct: 157 LGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIV 216

Query: 194 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGF 253
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+Q+SLYHL FLAQGGTAVGTGLNTKVGF
Sbjct: 217 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGF 276

Query: 254 DKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGP 313
           DK++A+EVSKETG+ FETAPNKFEALAAHDAIV AS A+ T+A SLFKIAQDIRYLGSGP
Sbjct: 277 DKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGP 336

Query: 314 RCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYK 373
           RCGYGEL LP NEPGSSIMPGKVNPTQNEAMTQV +Q+MGNN TI  AGSQGQFELNVYK
Sbjct: 337 RCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNVYK 396

Query: 374 PLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAAS 433
           PLMI+NLL+SIRL++DA  SF+IHC++ LKAN DKI+ENL+KSLMLVTALNPKIGYDAA+
Sbjct: 397 PLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVTALNPKIGYDAAA 456

Query: 434 KLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPKP 475
           K+AKNAH KNITLKESALELG+LTE+EFD+WVIPENMI PKP
Sbjct: 457 KVAKNAHHKNITLKESALELGVLTEKEFDEWVIPENMISPKP 498

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/460 (79%), Positives = 420/460 (91%)

Query: 14  FRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQS 73
           +RVETD+FGEIKVP++KYWGAQTQRSFQNFKIGG RE++P PI++AFG+LKKSAAIVN+ 
Sbjct: 22  YRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSAAIVNEK 81

Query: 74  LGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAE 133
           LGTLD  IA PI +A+DEV +GKLNDHFPLVVFQTGSGTQ+NMNANEVISNRA ELIG E
Sbjct: 82  LGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 141

Query: 134 LGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIV 193
           LGSKKIHPNNH NQ+QSSNDTFPSVMHIAAV E+ N+L+P++T+LK++L  KA+E+ +IV
Sbjct: 142 LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQDIV 201

Query: 194 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGF 253
           KIGRTHLQDATPLTLGQEFSGYVQQL NGI RI+ +L HLK+LAQGGTAVGTGLNTK GF
Sbjct: 202 KIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKEGF 261

Query: 254 DKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGP 313
           DK+IA+++SKETGIDF+TAPNKFEALAAHDAIV AS A+ TVA SLFKIAQDIRYLGSGP
Sbjct: 262 DKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 321

Query: 314 RCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYK 373
           RCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQV +Q+MGNN  +  AG+ GQFELNV+K
Sbjct: 322 RCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFELNVFK 381

Query: 374 PLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAAS 433
           P+MI+NLL+SIRL++DACHSF++HCV+G++AN +KIN NLH SLMLVTALNPKIGYDAAS
Sbjct: 382 PVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIGYDAAS 441

Query: 434 KLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGP 473
           K+AKNA  KNITLKESALEL  LT EEFD+WVIPENM+GP
Sbjct: 442 KIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 493

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/464 (76%), Positives = 420/464 (90%)

Query: 11  ESSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIV 70
           +  +R+ETD+FGEIKVP++KYWGAQTQRSF+NFKIGG RE++P  +++AFG+LKKSAAIV
Sbjct: 29  QQKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIV 88

Query: 71  NQSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELI 130
           N+SLGTLDP I+ PI KA+DEVIQGKL DHFPLVVFQTGSGTQ+NMNANEVISNRA E+I
Sbjct: 89  NESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEII 148

Query: 131 GAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYA 190
           G E GSK++HPNNH NQ+QSSNDTFPSVMHIAAV E+ ++L+P+LT L++S   K+ E++
Sbjct: 149 GGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFS 208

Query: 191 NIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTK 250
           +IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI R++ SL+HLKFLAQGGTAVGTGLNTK
Sbjct: 209 SIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTK 268

Query: 251 VGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLG 310
           VGF + IA++VSKETGIDF+TAPNKFEALAAHDA+V  S A+ T+A SLFKIA DIRYLG
Sbjct: 269 VGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLG 328

Query: 311 SGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELN 370
           SGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQV +Q+MGNN  I  AG+ GQFELN
Sbjct: 329 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELN 388

Query: 371 VYKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYD 430
           V+KP+MI+NLL+S+RL++DA +SF++HCVDG+KAN D+I++ LH+SLMLVTALNPKIGYD
Sbjct: 389 VFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYD 448

Query: 431 AASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPK 474
           AASK+AKNAH K ITLKESAL+LG+L E+EFD+WVIPE MIGPK
Sbjct: 449 AASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPK 492

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii ACR013C
          Length = 489

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/460 (78%), Positives = 414/460 (90%)

Query: 14  FRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQS 73
           FR+ETD+FGEIKVP+NKYWGAQTQRS +NFKIGG RE++P PIIKAFGILKKSAAIVN+S
Sbjct: 28  FRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFGILKKSAAIVNES 87

Query: 74  LGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAE 133
           LGTLDP I+ PI +A+DEVI+GKL DHFPLVVFQTGSGTQ+NMNANEVISNRA ELIG E
Sbjct: 88  LGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 147

Query: 134 LGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIV 193
           LG+K+IHPNNH NQ+QSSNDTFPSVMHIAAV E+ N L+P+LT L++S   K +E+++IV
Sbjct: 148 LGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEFSHIV 207

Query: 194 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGF 253
           KIGRTHLQDATPLTLGQEF GY QQ+TNGI R++ SL+HLKFLAQGGTAVGTGLNTKVGF
Sbjct: 208 KIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVGTGLNTKVGF 267

Query: 254 DKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGP 313
            + IA++VSKET I+F+TAPNKFEALAAHDA+V  S A+ TVA SLFKIA DIRYLGSGP
Sbjct: 268 AEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGP 327

Query: 314 RCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYK 373
           RCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQ  +Q+MGNN TI  AG+ GQFELNV+K
Sbjct: 328 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFAGASGQFELNVFK 387

Query: 374 PLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAAS 433
           P+MI+NLLNSIRL++DA +SF++HCVDG+KAN DKI + LH+SLMLVTALNPKIGYD+A 
Sbjct: 388 PVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVTALNPKIGYDSAC 447

Query: 434 KLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGP 473
           K+AKNAH KNITLKESALELG+L+EEEF +WV+PE MIGP
Sbjct: 448 KVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
           Anc_6.13 YPL262W
          Length = 484

 Score =  769 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/470 (74%), Positives = 422/470 (89%)

Query: 6   KTPSNESSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKK 65
           K  +    FRVETD+FGEIKV +++YWGAQTQRS +NF+IGG RE++P PI++AFG+LKK
Sbjct: 15  KMSTKAGQFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKK 74

Query: 66  SAAIVNQSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNR 125
           SAA+VN+SLGTLDP +A PI +A+DEV QGKL  HFPLVVFQTGSGTQ+NMNANEVISNR
Sbjct: 75  SAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNR 134

Query: 126 ANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNK 185
           A ELIG ELGSK+IHPNNH NQ+QSSNDTFPSVMHIAAV E+  +L+P+L  L++SLD K
Sbjct: 135 AIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAK 194

Query: 186 AKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGT 245
           +KE+++IVKIGRTHLQDATPLTLGQEFSGYVQQ++NGI+R++ SL+ LK+LAQGGTAVGT
Sbjct: 195 SKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGT 254

Query: 246 GLNTKVGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQD 305
           GLNTK+GF + IA++VSKETG+DF+TAPNKFEALAAHDA+V AS A+ TVA SLFKIAQD
Sbjct: 255 GLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQD 314

Query: 306 IRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQG 365
           IRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEA+TQV +Q+MGNN  I  AG+ G
Sbjct: 315 IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASG 374

Query: 366 QFELNVYKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNP 425
           QFELNV+KP+MI+NLL+S+RL++DA +SF++HCVDG+ AN D+I + +H+SLMLVTALNP
Sbjct: 375 QFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNP 434

Query: 426 KIGYDAASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPKP 475
           KIGYDAASK+AKNAH K ITLK+SAL+LG+LTE EFD+WV+PENMIGPKP
Sbjct: 435 KIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPKP 484

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 492

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/460 (77%), Positives = 413/460 (89%)

Query: 15  RVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQSL 74
           RVETD+FGEI VP++KYWGAQTQRS +NFKIGG RE++P P+++AFGILKKSAAIVN+SL
Sbjct: 33  RVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAFGILKKSAAIVNESL 92

Query: 75  GTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAEL 134
           GTLDP I+ PI +A+DEVI GKL DHFPLVVFQTGSGTQ+NMNANEVISNRA E++G ++
Sbjct: 93  GTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVGGKM 152

Query: 135 GSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIVK 194
           G+K IHPNNH NQ+QSSNDTFPSVMHIAAV E+ ++L+P+LT L++S   K+KE+ +IVK
Sbjct: 153 GTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFESIVK 212

Query: 195 IGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGFD 254
           IGRTHLQDATPLTLGQEFSGYVQQLTNGI R++ SL HLKFLAQGGTAVGTGLNTKVGF 
Sbjct: 213 IGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFG 272

Query: 255 KMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPR 314
           + IA++VSKETGIDF+TAPNKFEALAAHDAIV  S A+ T+A SLFKIA DIRYLGSGPR
Sbjct: 273 EKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPR 332

Query: 315 CGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYKP 374
           CGYGEL LPENEPGSSIMPGKVNPTQNEAMTQV +Q+MGNN  I  AG+ GQFELNV+KP
Sbjct: 333 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 392

Query: 375 LMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAASK 434
           +MI+NLL+S+RL+ DAC+SF++HCVDG++AN DKI + LH+SLMLVTALNPKIGYDAASK
Sbjct: 393 VMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLVTALNPKIGYDAASK 452

Query: 435 LAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPK 474
           +AKNAH K ITLKESALEL +LT  EFDQWV+PENM+GPK
Sbjct: 453 VAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 492

 Score =  764 bits (1974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/462 (78%), Positives = 414/462 (89%)

Query: 13  SFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQ 72
           S+RVETD+FGEI+VPS+KYWGAQTQRS QNFKIGG RE++P PI+KAFG+LKKSAA+VN+
Sbjct: 30  SYRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNE 89

Query: 73  SLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGA 132
            LGTLDP IA PI +A+DEV QGKL +HFPLVVFQTGSGTQ+NMNANEVISNRA ELIG 
Sbjct: 90  RLGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGG 149

Query: 133 ELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANI 192
           ELGSKKIHPNNH NQ+QSSNDTFPSVMHIAAV E+ ++L+P+L  LK +L  K+ E+ +I
Sbjct: 150 ELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHI 209

Query: 193 VKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVG 252
           VKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R++ SLYHLKFLAQGGTAVGTGLNTKVG
Sbjct: 210 VKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVG 269

Query: 253 FDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSG 312
           F + IA++VSKETGIDF+TAPNKFEALAAHDA+V AS A+ T+A SLFKIA DIRYLGSG
Sbjct: 270 FAEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSG 329

Query: 313 PRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVY 372
           PRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQV +Q+MGN+  I  AG+ GQFELNV+
Sbjct: 330 PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVF 389

Query: 373 KPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAA 432
           KP+MI+NLL+SIRL+ DA +SF+IHCV+G+KAN D+I + LH+SLMLVTALNPKIGYDAA
Sbjct: 390 KPVMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAA 449

Query: 433 SKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPK 474
           SK+AKNAH K ITLKESALEL +L+ EEFDQWVIPE MIGPK
Sbjct: 450 SKVAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGPK 491

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
           (FUM1) - mitochondrial and cytoplasmic fumarase
           (fumarate hydralase) [contig 186] FULL
          Length = 493

 Score =  763 bits (1971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/462 (76%), Positives = 415/462 (89%)

Query: 14  FRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQS 73
           +RVETD+FGEIKVP++K WGAQTQRS +NFKIGG+RE++P PI+KAFGILKKSAAIVN+S
Sbjct: 32  YRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVNES 91

Query: 74  LGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAE 133
           LGTLDP ++ PI  A+DEVI GKL DHFPLVVFQTGSGTQ+NMNANEVISNRA +L+G E
Sbjct: 92  LGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVGGE 151

Query: 134 LGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIV 193
           +GSK IHPNNH NQ+QSSNDTFPSVMHIAAV E+ + L+P+L  L+++   KA+E+ +IV
Sbjct: 152 VGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIV 211

Query: 194 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGF 253
           KIGRTHLQDATPLTLGQEFSGYVQQLTNGI R++ SL++LKFLAQGGTAVGTGLNTKVGF
Sbjct: 212 KIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGF 271

Query: 254 DKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGP 313
            + IA++VSKETGIDF+TAPNKFEALAAHDA+V  S A+ T+A SLFKIA DIRYLGSGP
Sbjct: 272 AEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGP 331

Query: 314 RCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYK 373
           RCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQV +Q+MGNN  I  AG+ GQFELNV+K
Sbjct: 332 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 391

Query: 374 PLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAAS 433
           P+MI+NLL+SIRL+ DAC+SF++HCV+G++AN DKI + LH+SLMLVTALNPKIGYDAAS
Sbjct: 392 PVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDAAS 451

Query: 434 KLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPKP 475
           K+AKNAH K ITLKESALELG+L+  EFD+WV+PENM+GPKP
Sbjct: 452 KVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPKP 493

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
           YPL262W
          Length = 496

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/474 (74%), Positives = 426/474 (89%)

Query: 1   MSTNSKTPSNESSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAF 60
           M  + +  S+E+ FR+ETD FGEIKVP+NKYWGAQT+RSF+NF+IGG RE++P P++KAF
Sbjct: 23  MHQSMRCLSDEAGFRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAF 82

Query: 61  GILKKSAAIVNQSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANE 120
           G+LKKSAAIVN+  GTLDP I+  I +A+DEVIQGKLNDHFPLVVFQTGSGTQ+NMNANE
Sbjct: 83  GVLKKSAAIVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANE 142

Query: 121 VISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKN 180
           VISNRA EL+G  LGSK++HPNNHVNQ+QSSND+FP+VMHIAAV E+ ++LIP++  L++
Sbjct: 143 VISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRD 202

Query: 181 SLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGG 240
           +L++K+K++A+IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI RI+ SL +LKFLAQGG
Sbjct: 203 ALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGG 262

Query: 241 TAVGTGLNTKVGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLF 300
           TAVGTGLNT++GF + IA+++SKETG+ F+TAPNKFEALAAHDAIV AS AITTVA SLF
Sbjct: 263 TAVGTGLNTRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLF 322

Query: 301 KIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVM 360
           KIAQDIRYLGSGPRCGYGEL LPENEPGSSIMPGK+NPTQNEA+TQV  QI+GNNQTI+ 
Sbjct: 323 KIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIF 382

Query: 361 AGSQGQFELNVYKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLV 420
           AG+QGQFELNV+KP+MI+NLL+SIRL+ D   SF+IHCV+G+KAN ++I + ++KSLMLV
Sbjct: 383 AGTQGQFELNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLV 442

Query: 421 TALNPKIGYDAASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPK 474
           TALNPKIGYD A+K+AKNAH K ITLKESA++LG LTE EFD+WV+PE MIGPK
Sbjct: 443 TALNPKIGYDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
           [1404 nt, 468 aa]
          Length = 467

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/460 (76%), Positives = 415/460 (90%)

Query: 14  FRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQS 73
           FR+ETD FGEIKVP++KYWGAQTQRS++NFKIGG RE++P P++KAFG+LKKSAAIVN+ 
Sbjct: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66

Query: 74  LGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAE 133
            G LD  I+  I +A+DEVI+GKLN+HFPLVVFQTGSGTQ+NMNANEVISNRA EL G  
Sbjct: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126

Query: 134 LGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIV 193
           +GSK+IHPNNH N +QSSNDTFP+VMHIAAV E+ ++LIP++TELK++L NK+KE+ +IV
Sbjct: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186

Query: 194 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGF 253
           KIGRTHLQDATPLTLGQEFSGYVQQL NGI RI+ SL +LKFLAQGGTAVGTGLNTK+GF
Sbjct: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246

Query: 254 DKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGP 313
            + IA++VSKETGI+F+TAPNKFEALAAHDAIV +S A+ TVA SLFKIAQDIRYLGSGP
Sbjct: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306

Query: 314 RCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYK 373
           RCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQV +Q+MGNN  I  AG+ GQFELNV+K
Sbjct: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366

Query: 374 PLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAAS 433
           P+MI+NLL+SIRL+ DACHSF IHCV+G++AN DKIN+ LH+SLMLVTALNPKIGYD+A+
Sbjct: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426

Query: 434 KLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGP 473
           K+AKNAH K ITLKESALELG+LTE+EFD+WV+PE M+GP
Sbjct: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
           converts fumaric acid to L-malic acid in the TCA cycle;
           cytosolic and mitochondrial distribution determined by
           the N-terminal targeting sequence, protein conformation,
           and status of glyoxylate shunt; phosphorylated in
           mitochondria
          Length = 488

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/463 (76%), Positives = 414/463 (89%)

Query: 12  SSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVN 71
           SSFR ETD+FGEI VP++KYWGAQTQRSFQNFKIGG RE++PLP++ AFG+LKKSAAIVN
Sbjct: 26  SSFRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVN 85

Query: 72  QSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIG 131
           +SLG LDP I+  I +A+DEV  GKL+DHFPLVVFQTGSGTQ+NMNANEVISNRA E++G
Sbjct: 86  ESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILG 145

Query: 132 AELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYAN 191
            ++GSK++HPNNH NQSQSSNDTFP+VMHIAA L++ N LIP+LT LKN+L+ K+KE+ +
Sbjct: 146 GKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFDH 205

Query: 192 IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKV 251
           IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+  SL  L FLAQGGTAVGTGLNTK 
Sbjct: 206 IVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKP 265

Query: 252 GFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGS 311
           GFD  IA+++SKETG+ F+TAPNKFEALAAHDAIV  S A+ T+A SLFKIAQDIRYLGS
Sbjct: 266 GFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGS 325

Query: 312 GPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNV 371
           GPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQV +Q+MGNN  I  AGSQGQFELNV
Sbjct: 326 GPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNV 385

Query: 372 YKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDA 431
           +KP+MIANLLNSIRL++DA +SF++HCV+G+KAN  +I+E L KSLMLVTALNPKIGYDA
Sbjct: 386 FKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDA 445

Query: 432 ASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPK 474
           ASK+AKNAH K ITLKESALELG+LTE+EFD+WV+PE+M+GPK
Sbjct: 446 ASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEHMLGPK 488

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
           YPL262W (REAL)
          Length = 488

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/463 (76%), Positives = 413/463 (89%)

Query: 12  SSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVN 71
           S+FR ETD+FGEI VP++KYWGAQTQRSFQNFKIGG RE++PLP++ AFG+LKKSAAIVN
Sbjct: 26  STFRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVN 85

Query: 72  QSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIG 131
           +SLG LDP I+  I +A+DEV  GKL+DHFPLVVFQTGSGTQ+NMNANEVISNRA E++G
Sbjct: 86  ESLGGLDPKISKAIQEAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILG 145

Query: 132 AELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYAN 191
            ++GSK++HPNNH NQSQSSNDTFP+VMHIAA L++ N LIP+L  LKN+L+ K+KE+ +
Sbjct: 146 GKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELANLKNALEAKSKEFDH 205

Query: 192 IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKV 251
           IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+  SL  L FLAQGGTAVGTGLNTK 
Sbjct: 206 IVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKP 265

Query: 252 GFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGS 311
           GFD  IA+++SKETG+ F+TAPNKFEALAAHDAIV  S A+ T+A SLFKIAQDIRYLGS
Sbjct: 266 GFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGS 325

Query: 312 GPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNV 371
           GPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQV +Q+MGNN  I  AGSQGQFELNV
Sbjct: 326 GPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNV 385

Query: 372 YKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDA 431
           +KP+MIANLLNSIRL++DA +SF++HCV+G+KAN  +I+E L KSLMLVTALNPKIGYDA
Sbjct: 386 FKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDA 445

Query: 432 ASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPK 474
           ASK+AKNAH K ITLKESALELG+LTE+EFD+WV+PENM+GPK
Sbjct: 446 ASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  752 bits (1942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/463 (75%), Positives = 414/463 (89%)

Query: 12  SSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVN 71
           S+FR+ETD+FGEI VP++KYWGAQTQRSFQNFKIGG RE++PLP++ AFG+LKKSAA+VN
Sbjct: 26  STFRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVN 85

Query: 72  QSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIG 131
           +SLG LDP I+  I +A+DEV  GKL+DHFPLVVFQTGSGTQ+NMNANEVISNRA E++G
Sbjct: 86  ESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILG 145

Query: 132 AELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYAN 191
            ++GSK++HPNNH NQSQSSNDTFP+VMHIAA L++ N LIP+LT LKN+L+ K+KE+ +
Sbjct: 146 GKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEH 205

Query: 192 IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKV 251
           IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+  SL  L FLAQGGTAVGTGLNTK 
Sbjct: 206 IVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKP 265

Query: 252 GFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGS 311
           GFD  IA+++S ETG+ F+TAPNKFEALAAHDAIV  S A+ T+A SLFKIAQDIRYLGS
Sbjct: 266 GFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGS 325

Query: 312 GPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNV 371
           GPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQV +Q+MGNN  I  AGSQGQFELNV
Sbjct: 326 GPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNV 385

Query: 372 YKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDA 431
           +KP+MIANLLNSIRL++D+ +SF++HCV+G+KAN  +I+E L KSLMLVTALNPKIGYDA
Sbjct: 386 FKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDA 445

Query: 432 ASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPK 474
           ASK+AKNAH K ITLKESALELG+LTE+EFD+WV+PENM+GPK
Sbjct: 446 ASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/463 (75%), Positives = 410/463 (88%)

Query: 12  SSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVN 71
           S+FR ETD+FGEI VP++KYWGAQTQRSFQNFKIGG RE++PLP++ AFG+LKKSAAIVN
Sbjct: 26  STFRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVN 85

Query: 72  QSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIG 131
           +SLG LDP ++  I +A+DEV  GKL+DHFPLVVFQTGSGTQ+NMNANEVISNRA E++G
Sbjct: 86  ESLGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILG 145

Query: 132 AELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYAN 191
            ++GSK++HPNN  NQSQSSNDTFP+VMHIAA L++   LIP+LT LKN+L+ K+KE+ +
Sbjct: 146 GKIGSKQVHPNNDCNQSQSSNDTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEH 205

Query: 192 IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKV 251
           IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+  +L  L FLAQGGTAVGTGLNTK 
Sbjct: 206 IVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKP 265

Query: 252 GFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGS 311
           GFD  IA+++SKETG+ F+TAPNKFEALAAHDAIV  S A+ T+A SLFKIAQDIRYLGS
Sbjct: 266 GFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGS 325

Query: 312 GPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNV 371
           GPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQV +Q+MGNN  I   GSQGQFELNV
Sbjct: 326 GPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNV 385

Query: 372 YKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDA 431
           +KP+MIANLLNSIRL++DA  SF+IHCV+G+KAN  +I+E L KSLMLVTALNPKIGYDA
Sbjct: 386 FKPVMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDA 445

Query: 432 ASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPK 474
           ASK+AKNAH K ITLKESALELG+LTE+EFD+WV+PENM+GPK
Sbjct: 446 ASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa]
           {ON} complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/465 (73%), Positives = 407/465 (87%)

Query: 9   SNESSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAA 68
           SN   FRVETD FGEIKVP+NKYWGAQT+RSF+NFKIGG RE++P  +++AFG+LKK AA
Sbjct: 19  SNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAA 78

Query: 69  IVNQSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANE 128
           IVN  LG LDP+ +  I +A+DEV  GKLNDHFPLVVFQTGSGTQ+NMNANEVISNRA E
Sbjct: 79  IVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIE 138

Query: 129 LIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKE 188
           L G  LGSK+IHPNNH N +QSSNDTFP+VMHIAAV +++ +L+P+LT L+++L  K+ E
Sbjct: 139 LKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAE 198

Query: 189 YANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLN 248
           + +IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERI+ +  +L+FLAQGGTAVGTGLN
Sbjct: 199 FEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLN 258

Query: 249 TKVGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRY 308
           TK G+ + IA E+SKETG+ F+TAPNKFEALAAHDAIV AS A+ TVA SLFKIAQDIRY
Sbjct: 259 TKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRY 318

Query: 309 LGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFE 368
           LGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQV +Q+MGNN  +  AG+ GQFE
Sbjct: 319 LGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFE 378

Query: 369 LNVYKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIG 428
           LNV+KP++I+NLL+S++L+ DA  SF++HCV+G+KAN  KI+E LH+SLMLVTALNPKIG
Sbjct: 379 LNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIG 438

Query: 429 YDAASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGP 473
           YDAA+K+AKNAH K ITLKESALELG+LTE+EFD+WV+PE M+GP
Sbjct: 439 YDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL262W
           (FUM1)
          Length = 488

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/461 (71%), Positives = 400/461 (86%)

Query: 14  FRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQS 73
           FRVETD+FGEI+VP++KYWGAQTQRS +NF+IGG RE++P P+++AFG+LKKSAA+VN+ 
Sbjct: 27  FRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVNEQ 86

Query: 74  LGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAE 133
           LGTL+P IA  I +A+DEV QG+L +HFPLVVFQTGSGTQ+NMNANEVISNRA EL+G E
Sbjct: 87  LGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGE 146

Query: 134 LGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIV 193
           LGSK++HPNNH NQ+QSSNDTFPSVMHIAAV E+  +L+P+L  L+ S   K  E+A+IV
Sbjct: 147 LGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIV 206

Query: 194 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGF 253
           KIGRTHLQDATPLTLGQEFSGY QQ+ NGI R++ +   L+FLAQGGTAVGTGLNT+ GF
Sbjct: 207 KIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGF 266

Query: 254 DKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGP 313
            + IA +VS+ETG++F TAPNKFEALAAHDA+V AS A+ T+A SLFKIA DIRYLGSGP
Sbjct: 267 AEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGP 326

Query: 314 RCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYK 373
           RCGYGEL LPENEPGSSIMPGKVNPTQNEA+TQ  +Q+MGNN  I  AG+ GQFELNV+K
Sbjct: 327 RCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELNVFK 386

Query: 374 PLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAAS 433
           P+MIANLL+S+RL++DA  SF++HCVDG++ N D+I + LH+SLMLVTALNPKIGYDAAS
Sbjct: 387 PVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYDAAS 446

Query: 434 KLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPK 474
            +AKNAH K ITL+ SALELG+LT+ EFD+WV+PE MIGP+
Sbjct: 447 AVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 487

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 505

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/461 (73%), Positives = 405/461 (87%)

Query: 15  RVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQSL 74
           RVETD+FGEIKVP++KYWGAQTQRSF+NF+IGG+RE++P  ++ AFGILKK+ A VN++ 
Sbjct: 45  RVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEAN 104

Query: 75  GTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAEL 134
           G LDP +A  I +A+DEV  GKL DHFPLVVFQTGSGTQ+NMNANEVISNRA EL+G +L
Sbjct: 105 GQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKL 164

Query: 135 GSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIVK 194
           GSK +HPNNH+N SQSSNDTFP+VMHIAAVL +  +L+P LT LK+SL  K++E+A+IVK
Sbjct: 165 GSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVK 224

Query: 195 IGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGFD 254
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R++++L  LK LAQGGTAVGTGLNTK+G+ 
Sbjct: 225 IGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWA 284

Query: 255 KMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPR 314
           + +A EV+KETGIDF+TAPNKFEALAAHDA+V AS A+ T+A SLFKIAQDIRYLGSGPR
Sbjct: 285 ENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPR 344

Query: 315 CGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYKP 374
           CGYGEL LPENEPGSSIMPGKVNPTQNEA+TQV +Q+ GN+  I  AG+ GQFELNV+KP
Sbjct: 345 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKP 404

Query: 375 LMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAASK 434
           +MI+NLL+SI L+SDA +SF++HCVDG++AN + I + LH+SLMLVTALNPKIGYDAASK
Sbjct: 405 VMISNLLSSINLLSDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASK 464

Query: 435 LAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPKP 475
           +AKNAH   ITLKESAL+L +LT EEFD WV+PE+MIGPKP
Sbjct: 465 VAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPKP 505

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
           YPL262W
          Length = 500

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/459 (71%), Positives = 394/459 (85%)

Query: 15  RVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQSL 74
           R ETDSFGEI+VP+NKYWGAQTQRSF NFKIGGERE++P PII+AFG  KK+AAIVN SL
Sbjct: 41  RTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNSL 100

Query: 75  GTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAEL 134
           GTLD ++   I++A++EV QG LN+HFPLVVFQTGSGTQ+NMNANEVISNRA EL+G  L
Sbjct: 101 GTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTL 160

Query: 135 GSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIVK 194
           GSK++HPNNHVNQSQSSNDTFP+VMHIAA+ E+ N L+P L  L+ +LD+KAKE+  I+K
Sbjct: 161 GSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKIIK 220

Query: 195 IGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGFD 254
           IGRTHLQDATPLTLGQEFSGY QQLTN I+RI+ +L  L+++AQGGTAVGTGLNTK+GF 
Sbjct: 221 IGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGFA 280

Query: 255 KMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPR 314
           +  A+++S +T + F T+PNKFE+LAAHDAIV   +++ T+A SLFKI+QDIRYL SGPR
Sbjct: 281 EQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPR 340

Query: 315 CGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYKP 374
           CGYGEL +PENEPGSSIMPGKVNPTQNEAM Q  +Q+MGNN TI  AG+ GQFELN YKP
Sbjct: 341 CGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKP 400

Query: 375 LMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAASK 434
           LMIANLL+S RL+SDA  SF +HC  G++AN DKI+  LH+SLMLVT+LNPKIGYDAASK
Sbjct: 401 LMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASK 460

Query: 435 LAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGP 473
           +AKNAH K ITLK+SALEL +L+ ++FD+WV PENM+GP
Sbjct: 461 VAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
           YPL262W
          Length = 465

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/459 (69%), Positives = 397/459 (86%)

Query: 15  RVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQSL 74
           R+E D FGE++VP+NKYWGAQTQR+  NF IGGERE++P P+I A+GILKKS AIVN+SL
Sbjct: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64

Query: 75  GTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAEL 134
           GTLDP I+  I +A+DEV +G LN+HFPLVVFQTGSGTQTNMN NEVISNRA E++G +L
Sbjct: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124

Query: 135 GSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIVK 194
           GSK +HPNNHVNQSQS+ND+FP+ MHI+AV E+   L+P+L +L+++L +K+ E+  IVK
Sbjct: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184

Query: 195 IGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGFD 254
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+Q SL +LKF+AQGGTAVGTG+NTK  FD
Sbjct: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244

Query: 255 KMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPR 314
            ++A+++S ETGI+F+TAPNKFEALA+HDAIV  S A+ T+A SLFKI+QDIR+LGSGPR
Sbjct: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304

Query: 315 CGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYKP 374
           CGYGEL LPENEPGSSIMPGKVNPTQNEAM Q  +Q+MGNN  I  AG+ GQFELN YKP
Sbjct: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364

Query: 375 LMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAASK 434
           LMI+NLLNSIRL++D+C+SF+IHC+ G++AN DKIN+ L++SLMLVTALNPKIGYDAA+ 
Sbjct: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424

Query: 435 LAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGP 473
           +AK+AH   +TLKE+AL+  LLT E+FD+W++PE+M+ P
Sbjct: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 102/246 (41%), Gaps = 23/246 (9%)

Query: 118 ANEVISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTE 177
           ANE    R  E+IG ++  K       V+  +S ND   + + I     +N+NL P L  
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDNLFPALKG 140

Query: 178 LKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLA 237
           L + L  +AK   NI+  G THLQ A P+      S Y    T   +R+   L+ L    
Sbjct: 141 LVDVLIKRAKGEINILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLDQILHRLN--- 197

Query: 238 QGGTAVGTGLNTKVGFDKMIAQEVSKETGIDFETA-PNKFEALAAHDAIVFASSAITTVA 296
           Q     G       G D+    E     G+ F +   N   A++  D IV      T   
Sbjct: 198 QSPLGAGALAGHPYGIDREFLAE-----GLGFNSVIGNSMVAVSDRDFIVELMFWGTLFM 252

Query: 297 GSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVALQIMGNN 355
             + + A+D+    +     +G +QL +    GSS+MP K N    E +   + ++ G+ 
Sbjct: 253 NHISRFAEDLIIYCTAE---FGFIQLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFGDL 309

Query: 356 QTIVMA 361
              +M+
Sbjct: 310 TGFLMS 315

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 461

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 103/252 (40%), Gaps = 33/252 (13%)

Query: 117 NANEVISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLT 176
            ANE    R  E+IG  +  K       V+  +S ND   + M I     LN  ++P L+
Sbjct: 89  TANE---RRLGEIIGRGIAGK-------VHTGRSRNDQVATDMRIYCRDILNGTVLPALS 138

Query: 177 ELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFL 236
            L   +  +A+E  +++  G THLQ A P+      S Y    T   +R+Q  +  L   
Sbjct: 139 SLIKVILQRAEEEIDVLMPGYTHLQRAQPIRWAHWLSCYATYFTEDYKRLQQIVERLNVS 198

Query: 237 AQGGTAVGTGLNTKVGFDKMIAQEVSKETGIDFE-TAPNKFEALAAHDAIVFASSAITTV 295
             G  A+        G D+          G++F     N   A+A  D +V         
Sbjct: 199 PLGAGALA---GHPYGIDREFLA-----AGLNFNGVIGNSLTAVADRDFVV-----EIMF 245

Query: 296 AGSLF-----KIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVAL 349
            GSLF     + A+D+    +     +G +QL +    GSS+MP K NP   E +   + 
Sbjct: 246 WGSLFMNHISRFAEDLIIYSTAE---FGFIQLSDAYSTGSSLMPQKKNPDSLELLRGKSG 302

Query: 350 QIMGNNQTIVMA 361
           ++ G     +M+
Sbjct: 303 RVFGQLAGFLMS 314

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 464

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 99/247 (40%), Gaps = 23/247 (9%)

Query: 117 NANEVISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLT 176
            ANE    R  E+IG E+  K       V+  +S ND   + M I     LN  L+P L 
Sbjct: 91  TANE---RRLGEIIGREISGK-------VHTGRSRNDQVATDMRIYCRDILNEVLLPALQ 140

Query: 177 ELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFL 236
                L  +AKE  +++  G THLQ A P+      S Y    T    R++  +  L   
Sbjct: 141 AFIKVLTTRAKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKS 200

Query: 237 AQGGTAVGTGLNTKVGFDKMIAQEVSKETGIDFE-TAPNKFEALAAHDAIVFASSAITTV 295
             G  A+        G D+          G+ F+    N   A++  D +V      T  
Sbjct: 201 PLGAGALA---GHPYGIDREFLAR-----GLGFQGVIGNSLTAVSDRDFVVEIMFWGTLF 252

Query: 296 AGSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVALQIMGN 354
              + + ++D+    +     +G ++L +    GSS+MP K NP   E +   A ++ G 
Sbjct: 253 MNHISRFSEDLIIYSTAE---FGFIKLSDAYSTGSSLMPQKKNPDSLELLRGKAGRVFGE 309

Query: 355 NQTIVMA 361
               +M+
Sbjct: 310 LSGFLMS 316

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/246 (23%), Positives = 103/246 (41%), Gaps = 21/246 (8%)

Query: 117 NANEVISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLT 176
            ANE    R  E+IG  +  K       V+  +S ND   + M +     L + + P L 
Sbjct: 90  TANE---RRLGEIIGRHISGK-------VHTGRSRNDQVATDMRLYCREMLQDKVEPALF 139

Query: 177 ELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFL 236
           EL   L ++A+E  +++  G THLQ A P+      S Y        +R++  +  L   
Sbjct: 140 ELIKVLLHRAREEIDVLMPGYTHLQRAQPIRWSHWLSCYATYFVEDFKRLKEVIARLN-- 197

Query: 237 AQGGTAVGTGLNTKVGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVA 296
            Q     G       G D+   + ++ E G D     N   A++  D +V   S  +   
Sbjct: 198 -QSPLGAGALAGHPYGIDR---EYLACELGFD-GVIGNSMTAVSDRDFVVEIMSWGSLFM 252

Query: 297 GSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVALQIMGNN 355
             + ++A+D+    +     +G ++L +    GSS+MP K NP   E +   + ++ G  
Sbjct: 253 NHISRLAEDLIIYSTAE---FGFVKLADAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQL 309

Query: 356 QTIVMA 361
              +M+
Sbjct: 310 AGFLMS 315

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
           similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 98/249 (39%), Gaps = 31/249 (12%)

Query: 118 ANEVISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTE 177
           ANE    R  ELIG  +  K       V+  +S ND   + M I     LN  ++P ++ 
Sbjct: 91  ANE---RRLGELIGTAVAGK-------VHTGRSRNDQVATDMRIYCREILNEKILPAVSS 140

Query: 178 LKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLA 237
               L N+A+E  +++  G THLQ A P+      S Y    T    R++  +  L    
Sbjct: 141 FIRVLINRAREEVDVLMPGYTHLQRAQPIRWSHWLSCYATYFTEDYNRLRQVVERLN--- 197

Query: 238 QGGTAVGTGLNTKVGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAG 297
           Q     G       G D+    E     GI      N   A++  D ++          G
Sbjct: 198 QSPLGAGALAGHPYGIDRKYLAEQLGFNGI----IGNSLVAVSDRDFVI-----EIMFWG 248

Query: 298 SLF-----KIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVALQI 351
           SLF     + A+D+    +     +G + L +    GSS+MP K NP   E +   + ++
Sbjct: 249 SLFMNHISRFAEDLIIYSTAE---FGFINLADAYSTGSSLMPQKKNPDSLELLRGKSGRV 305

Query: 352 MGNNQTIVM 360
            G     +M
Sbjct: 306 FGQLSGFLM 314

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON}
           Anc_1.354 YHR018C
          Length = 462

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 102/247 (41%), Gaps = 23/247 (9%)

Query: 117 NANEVISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLT 176
            ANE    R  E+IG ++  K       V+  +S ND   + + I     LN  L P +T
Sbjct: 90  TANE---RRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPGMT 139

Query: 177 ELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFL 236
            L   L  +A+E  +I+  G THLQ A P+      S Y    T  ++R++  L      
Sbjct: 140 SLIEVLIKRAEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLKQILERFNKS 199

Query: 237 AQGGTAVGTGLNTKVGFDKMIAQEVSKETGIDFE-TAPNKFEALAAHDAIVFASSAITTV 295
             G  A+        G D+    E     G+ F+    N   A++  D +V      T  
Sbjct: 200 PLGAGALA---GHPYGIDREFLAE-----GLGFDGVIGNSLVAVSDRDFVVELMFWGTLF 251

Query: 296 AGSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVALQIMGN 354
              + + A+D+    +     +G ++L +    GSS+MP K N    E +   + ++ G+
Sbjct: 252 MNHISRFAEDLVIYSTAE---FGFIKLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

Query: 355 NQTIVMA 361
               +M+
Sbjct: 309 LAGFLMS 315

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018c ARLY
          Length = 461

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 101/246 (41%), Gaps = 23/246 (9%)

Query: 118 ANEVISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTE 177
           ANE    R  ELIG ++  K       V+  +S ND   + M I     LN  + P +  
Sbjct: 92  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDMRIYCREILNEKIFPAMKS 141

Query: 178 LKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLA 237
           L N L N+A++  +I+  G THLQ A P+      S Y    T  ++R++     L    
Sbjct: 142 LINVLVNRAEKEIDILMPGYTHLQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERLNKSP 201

Query: 238 QGGTAVGTGLNTKVGFDKMIAQEVSKETGIDFE-TAPNKFEALAAHDAIVFASSAITTVA 296
            G  A+        G D+    E     G+ F     N   A++  D +V      T   
Sbjct: 202 LGSGALA---GHPYGIDRQFLAE-----GLGFNGVIGNSLVAVSDRDFVVELMFWATLFM 253

Query: 297 GSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVALQIMGNN 355
             + + ++D+    +     +G ++L +    GSS+MP K N    E +   + ++ G  
Sbjct: 254 NHVSRFSEDLIIYSTAE---FGFIKLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFGEL 310

Query: 356 QTIVMA 361
              +M+
Sbjct: 311 SGFLMS 316

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 102/247 (41%), Gaps = 23/247 (9%)

Query: 117 NANEVISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLT 176
            ANE    R  ELIG ++  K       V+  +S ND   + + I     +N++L P + 
Sbjct: 90  TANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDSLFPAMK 139

Query: 177 ELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFL 236
            L + L  +A+   +I+  G THLQ A P+      S Y    T   +R+   L+ L   
Sbjct: 140 GLVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLVQILHRLN-- 197

Query: 237 AQGGTAVGTGLNTKVGFDKMIAQEVSKETGIDFETA-PNKFEALAAHDAIVFASSAITTV 295
            Q     G       G D+    E     G+ F +   N   A++  D IV      T  
Sbjct: 198 -QSPLGAGALAGHPYGIDREFLAE-----GLGFNSVIGNSLVAVSDRDFIVELMFWGTLF 251

Query: 296 AGSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVALQIMGN 354
              + + A+D+    +     +G +QL +    GSS+MP K N    E +   + ++ G+
Sbjct: 252 MNHISRFAEDLIIYCTAE---FGFIQLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

Query: 355 NQTIVMA 361
               +M+
Sbjct: 309 LTGFLMS 315

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa]
           {ON} Anc_1.354 YHR018C
          Length = 462

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 100/246 (40%), Gaps = 23/246 (9%)

Query: 118 ANEVISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTE 177
           ANE    R  E+IG ++  K       V+  +S ND   + + I     LN  L P LT 
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPALTS 140

Query: 178 LKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLA 237
           L   L  + +E  +I+  G THLQ A P+      S Y    T  + R++  L       
Sbjct: 141 LIQVLIKRGEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLNRLKQILVRFNKSP 200

Query: 238 QGGTAVGTGLNTKVGFDKMIAQEVSKETGIDFE-TAPNKFEALAAHDAIVFASSAITTVA 296
            G  A+        G D+    E     G++F     N   A++  D +V      T   
Sbjct: 201 LGAGALA---GHPYGIDREFLAE-----GLEFNGVIGNSLVAVSDRDFVVELMFWSTLFM 252

Query: 297 GSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVALQIMGNN 355
             + + A+D+    +     +G ++L +    GSS+MP K N    E +   + ++ G+ 
Sbjct: 253 NHISRFAEDLIIYSTAE---FGFIKLNDAYSTGSSLMPQKKNADSLELLRGKSGRVFGDL 309

Query: 356 QTIVMA 361
              +M+
Sbjct: 310 SGFLMS 315

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 100/246 (40%), Gaps = 23/246 (9%)

Query: 118 ANEVISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTE 177
           ANE    R  ELIG ++  K       V+  +S ND   + + I     +N  L P L  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNGTLFPALKG 140

Query: 178 LKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLA 237
           L + L  +A+   +I+  G THLQ A P+      S Y    T   +R+   L+ L    
Sbjct: 141 LVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLN--- 197

Query: 238 QGGTAVGTGLNTKVGFDKMIAQEVSKETGIDFETA-PNKFEALAAHDAIVFASSAITTVA 296
           Q     G       G D+    E     G+ F +   N   A++  D IV      T   
Sbjct: 198 QSPLGAGALAGHPYGIDREFLAE-----GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 297 GSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVALQIMGNN 355
             + + A+D+    +     +G +QL +    GSS+MP K N    E +   + ++ G+ 
Sbjct: 253 NHISRFAEDLIIYCTAE---FGFIQLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFGDL 309

Query: 356 QTIVMA 361
              +M+
Sbjct: 310 TGFLMS 315

>KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.354
           YHR018C
          Length = 464

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 66/250 (26%), Positives = 104/250 (41%), Gaps = 33/250 (13%)

Query: 118 ANEVISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTE 177
           ANE    R  E+IG  +  K       V+  +S ND   + M I     L NNL+  L E
Sbjct: 92  ANE---RRLGEIIGTGIAGK-------VHTGRSRNDQVATDMRIYCRDILTNNLLTYLKE 141

Query: 178 LKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLA 237
           L + +  +A E  +I+  G THLQ A P+      S Y    T   +R+Q  L  L    
Sbjct: 142 LISVICRRANEEMDILMPGYTHLQRAQPIRWSHWLSFYATYFTEDYKRLQEILARLNVSP 201

Query: 238 QGGTAVGTGLNTKVGFDK-MIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVA 296
            G  A+        G D+  +AQ++     I      N   A++  D +V          
Sbjct: 202 LGAGALA---GHPYGIDREFLAQDLGFSGVI-----GNSLVAVSDRDFVV-----EIMFW 248

Query: 297 GSLF-----KIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVALQ 350
           GSLF     + ++D+    +     +G ++L +    GSS+MP K N    E +   + +
Sbjct: 249 GSLFMNHISRFSEDLIIYSTAE---FGFIKLSDAYSTGSSLMPQKKNADSLELLRGKSGR 305

Query: 351 IMGNNQTIVM 360
           + G+    +M
Sbjct: 306 VFGDLAGFLM 315

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
           ARG4Argininosuccinate lyase, catalyzes the final step in
           the arginine biosynthesis pathway
          Length = 463

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 100/247 (40%), Gaps = 23/247 (9%)

Query: 117 NANEVISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLT 176
            ANE    R  ELIG ++  K       V+  +S ND   + + I     +N+ L P L 
Sbjct: 90  TANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDIVNDTLFPALK 139

Query: 177 ELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFL 236
            L   L  +A+   +++  G THLQ A P+      S Y    T   +R+   L+ L   
Sbjct: 140 GLVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLN-- 197

Query: 237 AQGGTAVGTGLNTKVGFDKMIAQEVSKETGIDFETA-PNKFEALAAHDAIVFASSAITTV 295
            Q     G       G D+    E     G+ F +   N   A++  D IV      T  
Sbjct: 198 -QSPLGAGALAGHPYGIDREFLAE-----GLGFNSVIGNSLVAVSDRDFIVELMFWGTLF 251

Query: 296 AGSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVALQIMGN 354
              + + A+D+    +     +G +QL +    GSS+MP K N    E +   + ++ G+
Sbjct: 252 MNHISRFAEDLIIYCTAE---FGFIQLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

Query: 355 NQTIVMA 361
               +M+
Sbjct: 309 LTGFLMS 315

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
           similar to uniprot|P04076 Saccharomyces cerevisiae
           YHR018C ARG4 Argininosuccinate lyase catalyzes the final
           step in the arginine biosynthesis pathway
          Length = 462

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 59/246 (23%), Positives = 103/246 (41%), Gaps = 23/246 (9%)

Query: 118 ANEVISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTE 177
           ANE    R  E+IG ++  K       V+  +S ND   + M I     +N  L+P L E
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQVVTDMRIFCRDTVNEKLLPGLKE 140

Query: 178 LKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLA 237
           L + +  +A++    +  G THLQ A P+      S Y    T  ++R++  L       
Sbjct: 141 LVSVMVKRAEKEIGYLMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLRQLLERFN--- 197

Query: 238 QGGTAVGTGLNTKVGFDK-MIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVA 296
           Q     G       G D+  +A+E+  +  I      N   A++  D +V      T   
Sbjct: 198 QSPLGAGALAGHPYGIDREFLAEELGFQGVI-----GNSLVAVSDRDFVVELMFWGTLFM 252

Query: 297 GSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVALQIMGNN 355
             + + A+D+    +     +G ++L +    GSS+MP K N    E +   + ++ G+ 
Sbjct: 253 NHISRFAEDLIIYSTAE---FGFIKLNDAYSTGSSLMPQKKNADSLELLRGKSGRVFGDL 309

Query: 356 QTIVMA 361
              +M+
Sbjct: 310 AGFLMS 315

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
           YHR018C
          Length = 466

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 59/245 (24%), Positives = 100/245 (40%), Gaps = 21/245 (8%)

Query: 118 ANEVISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTE 177
           ANE    R  E+IG  +  K       V+  +S ND   + + I     L   L+P + +
Sbjct: 91  ANE---RRLGEIIGTHIAGK-------VHTGRSRNDQCVTDLRIYCRDILVEKLLPFMID 140

Query: 178 LKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLA 237
           L   +  +A+   +I+  G THLQ A P+      S Y    T   +R++  L  L    
Sbjct: 141 LVQVITKRAENEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQVLERLNKCP 200

Query: 238 QGGTAVGTGLNTKVGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAG 297
            G  A+        G D+   Q +S E G +     N   A++  D IV      T    
Sbjct: 201 LGAGAIA---GHPYGIDR---QYLSDELGFN-SIIGNSLVAVSDRDFIVDIMFWSTLFMN 253

Query: 298 SLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQ 356
            + + ++D+    +     +G ++L +    GSS+MP K N    E +   + ++ G   
Sbjct: 254 HISRFSEDLIIYSTAE---FGFIKLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFGQLS 310

Query: 357 TIVMA 361
             +M+
Sbjct: 311 GFLMS 315

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
           YHR018C
          Length = 462

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 101/247 (40%), Gaps = 23/247 (9%)

Query: 117 NANEVISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLT 176
            ANE    R  E+IG  +  K       V+  +S ND   + M I     LN  L+P + 
Sbjct: 90  TANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVVTDMRIYCRDILNEKLLPFMA 139

Query: 177 ELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFL 236
           +L   L  +A+   + +  G THLQ A P+      S Y    T   +R++  L  L   
Sbjct: 140 DLIKVLVKRAENEIDTLMPGYTHLQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVS 199

Query: 237 AQGGTAVGTGLNTKVGFDKMIAQEVSKETGIDF-ETAPNKFEALAAHDAIVFASSAITTV 295
             G  A+        G D+    E     G++F     N   A++  D +V      T  
Sbjct: 200 PLGAGALA---GHPYGIDREFLAE-----GLNFGGVIGNSLVAVSDRDFVVELMFWGTLF 251

Query: 296 AGSLFKIAQDIRYLGSGPRCGYGELQLPEN-EPGSSIMPGKVNPTQNEAMTQVALQIMGN 354
              + + A+D+    +     +G ++L ++   GSS+MP K N    E +   + ++ G+
Sbjct: 252 MNHISRFAEDLIIYSTAE---FGFVKLSDSYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

Query: 355 NQTIVMA 361
               +M+
Sbjct: 309 LAGFLMS 315

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
           YHR018C
          Length = 465

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 58/246 (23%), Positives = 99/246 (40%), Gaps = 23/246 (9%)

Query: 118 ANEVISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTE 177
           ANE    R  E+IG  +  K       V+  +S ND   + + I     LN+ L P L  
Sbjct: 91  ANE---RRLGEIIGRNIAGK-------VHTGRSRNDQCVTDLRIYCRDLLNDKLFPDLQA 140

Query: 178 LKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLA 237
           L + +  + KE  +++  G THLQ A P+      S Y    T   +R++  +  +    
Sbjct: 141 LVDVMIKRGKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDFKRLRQIMDRIN--- 197

Query: 238 QGGTAVGTGLNTKVGFDKMIAQEVSKETGIDFE-TAPNKFEALAAHDAIVFASSAITTVA 296
           Q     G       G D+          G+ F+    N   A++  D IV      T   
Sbjct: 198 QSPLGAGALAGHPYGIDREFLA-----AGLGFDGVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 297 GSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVALQIMGNN 355
             + + A+D+    +     +G ++L +    GSS+MP K N    E +   + ++ G+ 
Sbjct: 253 NHISRFAEDLIIYSTAE---FGFIKLNDAYSTGSSLMPQKKNADSLELLRGKSGRVFGDL 309

Query: 356 QTIVMA 361
              +M+
Sbjct: 310 AGFLMS 315

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
           YHR018C
          Length = 463

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 61/253 (24%), Positives = 100/253 (39%), Gaps = 37/253 (14%)

Query: 118 ANEVISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTE 177
           ANE    R  E+IG ++  K       V+  +S ND   + + I     L++ L+  L  
Sbjct: 91  ANE---RRLGEIIGTKISGK-------VHTGRSRNDQCVTDLRIYCREYLSDKLLKNLET 140

Query: 178 LKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLA 237
           L N L N+A+E    +  G THLQ A P+      S Y        +R+      L    
Sbjct: 141 LINVLINRAEEEIEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERLNKSP 200

Query: 238 QGGTAVG--------TGLNTKVGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFAS 289
            G  A+           L  K+GFD +I                N   A++  D +V   
Sbjct: 201 LGAGALAGHPYGIDREYLAEKLGFDSVIG---------------NSLVAVSDRDFVVEIL 245

Query: 290 SAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVA 348
              T     + + A+D+    +     +G ++L +    GSS+MP K N    E +   +
Sbjct: 246 FWSTLFMNHISRFAEDLIIYSTAE---FGFIKLSDAYSTGSSLMPQKKNADSLELLRGKS 302

Query: 349 LQIMGNNQTIVMA 361
            ++ GN   ++M+
Sbjct: 303 GRVFGNLSGLLMS 315

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]
           {ON} complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/246 (23%), Positives = 97/246 (39%), Gaps = 23/246 (9%)

Query: 118 ANEVISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTE 177
           ANE    R  ELIG ++  K       V+  +S ND   + + I     + + L+P L  
Sbjct: 89  ANE---RRLGELIGTDISGK-------VHTGRSRNDQCVTDLRIYCRDIIQDKLLPSLKS 138

Query: 178 LKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLA 237
           L   L  + +    I+  G THLQ A P+      S Y    T   +R++  L  L    
Sbjct: 139 LIQVLVKRGEGEIGILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQLLDRLNVSP 198

Query: 238 QGGTAVGTGLNTKVGFDKMIAQEVSKETGIDFE-TAPNKFEALAAHDAIVFASSAITTVA 296
            G  A+        G D+          G+ F     N   A++  D +V      T   
Sbjct: 199 LGAGALA---GHPYGIDREFLA-----NGLGFNGVIGNSLVAVSDRDFVVELLFWGTLFM 250

Query: 297 GSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVALQIMGNN 355
             + + A+D+    +     +G + L +    GSS+MP K N    E +   + ++ GN 
Sbjct: 251 NHISRFAEDLIIYSTAE---FGFITLSDAYSTGSSLMPQKKNSDSLELLRGKSGRVFGNL 307

Query: 356 QTIVMA 361
             ++M+
Sbjct: 308 SGLLMS 313

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 89/222 (40%), Gaps = 48/222 (21%)

Query: 171 LIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASL 230
           +IP+L  + N L   A EY ++  +G TH Q A   TLG+  + ++Q+L   +   + + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 231 YHLKFLAQGGT-------------------AVGTGLNTKVGFDKMI---AQEVSKETGID 268
             +      GT                   A+   +   +GFDK+     Q  S++  ID
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDARVTELLGFDKVYPVTGQTYSRKIDID 247

Query: 269 FETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENE 326
              AP                  +++ A +  K+A DIR L +       E++ P  +++
Sbjct: 248 V-LAP------------------LSSFAATAHKMATDIRLLAN-----LKEVEEPFEKSQ 283

Query: 327 PGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFE 368
            GSS M  K NP + E +  +A  +       V   S   FE
Sbjct: 284 IGSSAMAYKRNPMRCERVCSLARHLGSLFSDAVQTASVQWFE 325

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 91/222 (40%), Gaps = 48/222 (21%)

Query: 171 LIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASL 230
           +IP+L  + N L   A EY ++  +G TH Q A   TLG+  + ++Q+L   +   + + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFERAR 187

Query: 231 YHLKFLAQGGT--------AVGTGLNTKV-----------GFDKMI---AQEVSKETGID 268
             +      GT        A+  G + KV           GFDK+     Q  S++  ID
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKIDID 247

Query: 269 FETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENE 326
              AP                  +++ A +  K+A DIR L +       E++ P  +++
Sbjct: 248 V-LAP------------------LSSFAATAHKMATDIRLLAN-----LKEVEEPFEKSQ 283

Query: 327 PGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFE 368
            GSS M  K NP + E +  +A  +       V   S   FE
Sbjct: 284 IGSSAMAYKRNPMRCERVCSLARHLGSLFNDTVQTASVQWFE 325

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
           ADE13Adenylosuccinate lyase, catalyzes two steps in the
           'de novo' purine nucleotide biosynthetic pathway;
           expression is repressed by adenine and activated by
           Bas1p and Pho2p; mutations in human ortholog ADSL cause
           adenylosuccinase deficiency
          Length = 482

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 91/222 (40%), Gaps = 48/222 (21%)

Query: 171 LIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASL 230
           +IP+L  + N L   A EY ++  +G TH Q A   TLG+  + ++Q+L   +   + + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 231 YHLKFLAQGGT--------AVGTGLNTKV-----------GFDKMI---AQEVSKETGID 268
             +      GT        A+  G + KV           GFDK+     Q  S++  ID
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKIDID 247

Query: 269 FETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENE 326
              AP                  +++ A +  K+A DIR L +       E++ P  +++
Sbjct: 248 V-LAP------------------LSSFAATAHKMATDIRLLAN-----LKEVEEPFEKSQ 283

Query: 327 PGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFE 368
            GSS M  K NP + E +  +A  +       V   S   FE
Sbjct: 284 IGSSAMAYKRNPMRCERVCSLARHLGSLFSDAVQTASVQWFE 325

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 90/208 (43%), Gaps = 20/208 (9%)

Query: 171 LIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASL 230
           +IP+L  + N L N A EY ++  +G TH Q A   TLG+  + ++Q+L   +   + + 
Sbjct: 128 VIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 231 YHLKFLAQGGTAVGTGLNTKVGF----DKM--IAQEVSKETGID--FETAPNKFEALAAH 282
             +      GT  GT  +    F    DK+  + + V +  G D  +      +      
Sbjct: 188 NDIGLRGVKGTT-GTQASFLALFHGNHDKVEELDERVVELLGFDTVYPVTGQTYSRKIDI 246

Query: 283 DAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVNPTQ 340
           D +    S + + A +  K+A DIR L +       E++ P  +++ GSS M  K NP +
Sbjct: 247 DVV----SPLVSFAATAHKMATDIRLLAN-----LKEVEEPFEKSQIGSSAMAYKRNPMR 297

Query: 341 NEAMTQVALQIMGNNQTIVMAGSQGQFE 368
            E +  +A  +       V   S   FE
Sbjct: 298 CERVCSLARHLGSLLSDTVQTASVQWFE 325

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 91/212 (42%), Gaps = 28/212 (13%)

Query: 171 LIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASL 230
           LIP+L  + N L   A EY ++  +G TH Q A   TLG+  + ++Q+L   +     + 
Sbjct: 128 LIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 231 YHLKFLAQGGTAVGT---------GLNTKV-GFDKMIAQEVSKET--GIDFETAPNKFEA 278
             +      GT  GT         G + KV   DK +A+ +   T   +  +T   K   
Sbjct: 188 NDIGLRGVKGTT-GTQASFLTLFHGDHDKVEALDKRVAELLGFSTVYPVTGQTYSRKI-- 244

Query: 279 LAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKV 336
               D  V A   +++ A +  K+A DIR L +       EL+ P  +++ GSS M  K 
Sbjct: 245 ----DIDVLAP--LSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKR 293

Query: 337 NPTQNEAMTQVALQIMGNNQTIVMAGSQGQFE 368
           NP + E +  +A  +       V   S   FE
Sbjct: 294 NPMRCERVCSLARHLGSLFNDAVQTASVQWFE 325

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 90/222 (40%), Gaps = 48/222 (21%)

Query: 171 LIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASL 230
           +IP+L  + N L   A EY ++  +G TH Q A   TLG+  + ++Q+L   +   + + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 231 YHLKFLAQGGT--------AVGTGLNTKV-----------GFDKMI---AQEVSKETGID 268
             +      GT        A+  G + KV           GFDK+     Q  S++  ID
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKIDID 247

Query: 269 FETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENE 326
              AP                  +++ A +  K+A DIR L +       E++ P  + +
Sbjct: 248 V-LAP------------------LSSFAATAHKMATDIRLLAN-----LKEVEEPFEKTQ 283

Query: 327 PGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFE 368
            GSS M  K NP + E +  +A  +       V   S   FE
Sbjct: 284 IGSSAMAYKRNPMRCERVCSLARHLGSLFSDAVQTASVQWFE 325

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 91/211 (43%), Gaps = 26/211 (12%)

Query: 171 LIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASL 230
           LIP+L  + N L   A EY ++  +G TH Q A   TLG+  + ++Q+L   +     + 
Sbjct: 128 LIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 231 YHLKFLAQGGT--------AVGTGLNTKV-GFDKMIAQEVSKET--GIDFETAPNKFEAL 279
             +      GT        A+  G + KV   DK + + +  +T   +  +T   K    
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKI--- 244

Query: 280 AAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVN 337
              D  V A   +++ A +  K+A DIR L +       E++ P  +++ GSS M  K N
Sbjct: 245 ---DIDVLAP--LSSFAATAHKMATDIRLLAN-----LKEMEEPFEKSQIGSSAMAYKRN 294

Query: 338 PTQNEAMTQVALQIMGNNQTIVMAGSQGQFE 368
           P + E +  +A  +       V   S   FE
Sbjct: 295 PMRCERVCSLARHLGSLFSDAVQTASVQWFE 325

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ABL006C
          Length = 482

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 89/211 (42%), Gaps = 26/211 (12%)

Query: 171 LIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASL 230
           LIP+L  + N L   A +Y ++  +G TH Q A   TLG+  + ++Q+L   +     + 
Sbjct: 128 LIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 231 YHLKFLAQGGT--------AVGTGLNTKV-GFDKMIAQEVSKETGID--FETAPNKFEAL 279
             + F    GT        A+  G + KV   DK +A+     +G D  +      +   
Sbjct: 188 NDIGFRGVKGTTGTQASFLALFHGDHDKVEALDKRVAE----LSGFDIIYPVTGQTYSRK 243

Query: 280 AAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVN 337
              D +      +++ A +  K+A DIR L +       EL+ P   ++ GSS M  K N
Sbjct: 244 VDIDVL----GPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMAYKRN 294

Query: 338 PTQNEAMTQVALQIMGNNQTIVMAGSQGQFE 368
           P + E +  +A  +       V   S   FE
Sbjct: 295 PMRCERVCSLARHLGSLYSGAVQTASVQWFE 325

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 92/211 (43%), Gaps = 26/211 (12%)

Query: 171 LIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASL 230
           +IP+L  + N L + A +Y ++  +G TH Q A   TLG+  + ++Q+L   +     + 
Sbjct: 128 IIPKLVNVINRLSDFALKYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 231 YHLKFLAQGGT--------AVGTGLNTKV-GFDKMIAQEVSKET--GIDFETAPNKFEAL 279
             +      GT        A+  G + KV   DK + + +  +T   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 280 AAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVN 337
                 +   S +++ A +  K+A DIR L +       E++ P  +++ GSS M  K N
Sbjct: 246 ------IDVLSPLSSFAATAHKMATDIRLLAN-----LKEMEEPFEKSQIGSSAMAYKRN 294

Query: 338 PTQNEAMTQVALQIMGNNQTIVMAGSQGQFE 368
           P + E +  +A  +       V   S   FE
Sbjct: 295 PMRCERVCSLARHLGSLFSDAVQTASVQWFE 325

>ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR359W
           (ADE13)
          Length = 482

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 90/222 (40%), Gaps = 48/222 (21%)

Query: 171 LIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIE-----R 225
           +IP+L  + N L   A EY ++  +G TH Q A   TLG+  + ++Q+L   +      R
Sbjct: 128 IIPKLVNVINRLSKFACEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 226 IQASLYHLK--------FLA--QGGTAVGTGLNTKV----GFD---KMIAQEVSKETGID 268
               L  +K        FLA   G       L+ +V    GFD    +  Q  S++  ID
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDRVEALDKRVTELLGFDIVYPVTGQTYSRKIDID 247

Query: 269 FETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENE 326
              + + FEA  AH                  K+A DIR L +       E++ P  + +
Sbjct: 248 ILGSGSSFEA-TAH------------------KMATDIRLLAN-----LKEVEEPFEKTQ 283

Query: 327 PGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFE 368
            GSS M  K NP + E +  +A  +       V   S   FE
Sbjct: 284 IGSSAMAYKRNPMRCERVCSLARHLGSLFNDAVQTASVQWFE 325

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359w ADE13
          Length = 482

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 91/208 (43%), Gaps = 20/208 (9%)

Query: 171 LIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASL 230
           +IP+L  + N L   A EY ++  +G TH Q A   TLG+  + ++Q+L   +   + + 
Sbjct: 128 VIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 231 YHLKFLAQGGTAVGTGLNTKVGF----DKM--IAQEVSKETGID--FETAPNKFEALAAH 282
             +      GT  GT  +    F    DK+  + + V++  G D  +      +      
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGNHDKVEELDERVTELLGFDTVYPVTGQTYSRKIDI 246

Query: 283 DAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVNPTQ 340
           D +    + +++ A S  K+A DIR L +       E++ P  +++ GSS M  K NP +
Sbjct: 247 DVL----APLSSFAASAHKMATDIRLLAN-----LKEVEEPFEKSQIGSSAMAYKRNPMR 297

Query: 341 NEAMTQVALQIMGNNQTIVMAGSQGQFE 368
            E +  +A  +       V   S   FE
Sbjct: 298 CERVCSLARHLGSLFSDAVQTASVQWFE 325

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 91/211 (43%), Gaps = 26/211 (12%)

Query: 171 LIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASL 230
           +IP+L  + + L   A EY ++  +G TH Q A   TLG+  + ++Q+L   +     + 
Sbjct: 128 VIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 231 YHLKFLAQGGT--------AVGTGLNTKV-GFDKMIAQEVSKET--GIDFETAPNKFEAL 279
             +      GT        A+  G + KV   DK + + +  +T   +  +T   K    
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKI--- 244

Query: 280 AAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVN 337
              D  V A   +++ A +  K+A DIR L +       EL+ P  +++ GSS M  K N
Sbjct: 245 ---DIDVLAP--LSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRN 294

Query: 338 PTQNEAMTQVALQIMGNNQTIVMAGSQGQFE 368
           P + E +  +A  +       V   S   FE
Sbjct: 295 PMRCERVCSLARHLGSLFSDAVQTASVQWFE 325

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]
           {ON} highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 465

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 58/272 (21%), Positives = 112/272 (41%), Gaps = 26/272 (9%)

Query: 91  EVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAELGSKKIHPNNHVNQSQS 150
           E+I+G+   +     F    G +    ANE    R  E+IG  +  K       V+  +S
Sbjct: 70  EIIRGEWASN----SFVEKDGDEDIHTANE---RRLGEIIGRHIAGK-------VHTGRS 115

Query: 151 SNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQ 210
            ND   + M I    E  +N+   L +L  ++  +A++  + +  G THLQ A P+    
Sbjct: 116 RNDQVATDMRIYC-REALDNMAKILKDLVGAILQRAEQEIDALMPGYTHLQRAQPIRWSH 174

Query: 211 EFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGFDKMIAQEVSKETGIDFE 270
             + Y    T   +R++     L     G  A+        G D+   + +++  G D  
Sbjct: 175 WLNLYATYFTEDFKRLKQIRERLNVSPLGCGALA---GHPYGIDR---EHIAERLGFD-G 227

Query: 271 TAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGS 329
              N  +A++  D +V      +     + + ++D+    +     +  ++L +    GS
Sbjct: 228 VIGNSLQAVSDRDFVVEILFWCSLFMNHISRFSEDLIIYSTAE---FNFVKLSDAYSTGS 284

Query: 330 SIMPGKVNPTQNEAMTQVALQIMGNNQTIVMA 361
           S+MP K NP   E +   + ++ G+    +M+
Sbjct: 285 SLMPQKKNPDSLELLRGKSGRVFGSLSGFMMS 316

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 90/211 (42%), Gaps = 26/211 (12%)

Query: 171 LIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASL 230
           +IP+L  + + L   A EY ++  +G TH Q A   TLG+  + ++Q+L   +     + 
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 231 YHLKFLAQGGT--------AVGTGLNTKV-GFDKMIAQEVSKET--GIDFETAPNKFEAL 279
             +      GT        A+  G + KV   DK + + +  +T   +  +T   K    
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKI--- 244

Query: 280 AAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVN 337
              D  V A  A  + A +  K+A DIR L +       E++ P  +++ GSS M  K N
Sbjct: 245 ---DIDVLAPLA--SFAATAHKMATDIRLLAN-----LKEIEEPFEKSQIGSSAMAYKRN 294

Query: 338 PTQNEAMTQVALQIMGNNQTIVMAGSQGQFE 368
           P + E +  +A  +       V   S   FE
Sbjct: 295 PMRCERVCSLARHLGSLFSDAVQTASVQWFE 325

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 89/208 (42%), Gaps = 20/208 (9%)

Query: 171 LIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASL 230
           +IP+L  + + L   A EY ++  +G TH Q A   TLG+  + ++Q+L   +     + 
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDLRNFVRAR 187

Query: 231 YHLKFLAQGGTAVGTGLNTKVGF----DKM--IAQEVSKETGID--FETAPNKFEALAAH 282
             L      GT  GT  +    F    DK+  + + V++  G D  +      +      
Sbjct: 188 NDLGLRGVKGTT-GTQASFLALFHGNHDKVEELDERVTELLGFDTVYPVTGQTYSRKIDI 246

Query: 283 DAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVNPTQ 340
           D +    + + + A +  K+A DIR L +       E++ P  +++ GSS M  K NP +
Sbjct: 247 DVL----APLASFAATAHKMATDIRLLAN-----LKEVEEPFEKSQIGSSAMAYKRNPMR 297

Query: 341 NEAMTQVALQIMGNNQTIVMAGSQGQFE 368
            E +  +A  +       V   S   FE
Sbjct: 298 CERVCSLARHLGSLYSDAVQTASVQWFE 325

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 90/211 (42%), Gaps = 26/211 (12%)

Query: 171 LIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASL 230
           LIP+L  + N L   A ++ ++  +G TH Q A   TLG+  + ++Q+L   +     + 
Sbjct: 128 LIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 231 YHLKFLAQGGT--------AVGTGLNTKV-GFDKMIAQEVSKET--GIDFETAPNKFEAL 279
             +      GT        A+  G + KV   DK + + +  +T   +  +T   K    
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKI--- 244

Query: 280 AAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVN 337
              D  V A   + + A +  K+A DIR L +       E++ P  +++ GSS M  K N
Sbjct: 245 ---DIDVLAP--LCSFAATAHKMATDIRLLAN-----LKEIEEPFEKSQIGSSAMAYKRN 294

Query: 338 PTQNEAMTQVALQIMGNNQTIVMAGSQGQFE 368
           P + E +  +A  +       V   S   FE
Sbjct: 295 PMRCERVCSLARHLGSLFNDAVQTASVQWFE 325

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
           (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 88/222 (39%), Gaps = 48/222 (21%)

Query: 171 LIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASL 230
           LIP+L  + + L   A E+ ++  +G TH Q A   TLG+  + ++Q+L   +     + 
Sbjct: 128 LIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 231 YHLKFLAQGGTAVGTG---------------LNTKV----GFDKMI---AQEVSKETGID 268
             +      GT    G               L+ +V    GFD +     Q  S++  ID
Sbjct: 188 NDIGLRGVKGTTGTQGSFLALFHSDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 269 FETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENE 326
              AP                  +++ A +  K+A DIR L +       E++ P  +++
Sbjct: 248 V-LAP------------------LSSFAATAHKMATDIRLLAN-----LKEIEEPFEKSQ 283

Query: 327 PGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFE 368
            GSS M  K NP + E +  +A  +       V   S   FE
Sbjct: 284 IGSSAMAYKRNPMRCERVCSLARHLGSLFSDAVQTASVQWFE 325

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
           (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 91/211 (43%), Gaps = 26/211 (12%)

Query: 171 LIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASL 230
           +IP+L  + + L   A EY ++  +G TH Q A   T+G+  + ++Q+L   +     + 
Sbjct: 128 IIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVRAR 187

Query: 231 YHLKFLAQGGT--------AVGTGLNTKV-GFDKMIAQEVSKET--GIDFETAPNKFEAL 279
             +      GT        A+  G + KV   DK + + +  +T   +  +T   K    
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDDDKVEALDKRVVELLGFDTVYPVTGQTYSRKI--- 244

Query: 280 AAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVN 337
              D  V A   +++ A +  K+A DIR L +       E++ P  +++ GSS M  K N
Sbjct: 245 ---DIDVLAP--LSSFAATAHKMATDIRLLAN-----LKEVEEPFEKSQIGSSAMAYKRN 294

Query: 338 PTQNEAMTQVALQIMGNNQTIVMAGSQGQFE 368
           P + E +  +A  +       V   S   FE
Sbjct: 295 PMRCERVCSLARHLGSLFSDAVQTASVQWFE 325

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 91/211 (43%), Gaps = 26/211 (12%)

Query: 171 LIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASL 230
           +IP+L  + + L   A +Y ++  +G TH Q A   TLG+  + ++Q+L   +     + 
Sbjct: 128 VIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVRAR 187

Query: 231 YHLKFLAQGGT--------AVGTGLNTKV-GFDKMIAQEVSKET--GIDFETAPNKFEAL 279
             +      GT        A+  G + KV   DK + + +  +T   +  +T   K    
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKI--- 244

Query: 280 AAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVN 337
              D  V A   +++ A S  K+A DIR L +       E++ P  +++ GSS M  K N
Sbjct: 245 ---DIDVLAP--LSSFAASAHKMATDIRLLAN-----LKEVEEPFEKSQIGSSAMAYKRN 294

Query: 338 PTQNEAMTQVALQIMGNNQTIVMAGSQGQFE 368
           P + E +  +A  +       V   S   FE
Sbjct: 295 PMRCERVCSLARHLGSLFSDAVQTASVQWFE 325

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 86/206 (41%), Gaps = 16/206 (7%)

Query: 171 LIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASL 230
           +IP+L  + + L   A  Y ++  +G TH Q A   TLG+  + ++Q L   +     + 
Sbjct: 128 IIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDRAR 187

Query: 231 YHLKFLAQGGTAVGTGLNTKVGF----DKM--IAQEVSKETGIDFETAPNKFEALAAHDA 284
             +      GT  GT  +    F    DK+  + Q V++  G  FET         +   
Sbjct: 188 NDIGLRGVKGTT-GTQASFLALFHGNHDKVEELDQRVTELLG--FETVYPVTGQTYSRKI 244

Query: 285 IVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVNPTQNE 342
            +   + + + A +  K+A DIR L +       E++ P  + + GSS M  K NP + E
Sbjct: 245 DIDVLAPLASFAATAHKMATDIRLLAN-----LKEVEEPFEKTQIGSSAMAYKRNPMRCE 299

Query: 343 AMTQVALQIMGNNQTIVMAGSQGQFE 368
            +  +A  +       V   S   FE
Sbjct: 300 RVCSLARHMGSLFNDAVQTASVQWFE 325

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 89/222 (40%), Gaps = 48/222 (21%)

Query: 171 LIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASL 230
           LIP+L  + N L   A    ++  +G TH Q A   TLG+  + ++Q+L   +   + + 
Sbjct: 128 LIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 231 YHLKFLAQGGT--------AVGTGLNTKV-----------GFDKMI---AQEVSKETGID 268
             +      GT        A+  G + KV           GFD +     Q  S++  ID
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHNKVEKLDERVVELLGFDTVYPVTGQTYSRKIDID 247

Query: 269 FETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENE 326
                              A + +++ A +  K+A DIR L +       E++ P  +++
Sbjct: 248 -------------------AFAPLSSFAATAHKMATDIRLLAN-----LKEVEEPFEKSQ 283

Query: 327 PGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFE 368
            GSS M  K NP + E +  +A  +      +V   S   FE
Sbjct: 284 IGSSAMAYKRNPMRCERVCSLARHLGSLFNDMVQTASVQWFE 325

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]
           {ON} YHR018C (ARG4) - argininosuccinate lyase [contig
           260] FULL
          Length = 465

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 57/272 (20%), Positives = 112/272 (41%), Gaps = 26/272 (9%)

Query: 91  EVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAELGSKKIHPNNHVNQSQS 150
           E+I+G+   +     F    G +    ANE    R  E+IG  +  K       V+  +S
Sbjct: 70  EIIRGEWASN----SFVEKDGDEDIHTANE---RRLGEIIGRHIAGK-------VHTGRS 115

Query: 151 SNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQ 210
            ND   + M I    E  +NL   L +L  ++  ++++  + +  G THLQ A P+    
Sbjct: 116 RNDQVATDMRIYCR-EALDNLAKILEDLIGAILQRSEQEIDALMPGYTHLQRAQPIRWSH 174

Query: 211 EFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGFDKMIAQEVSKETGIDFE 270
             + Y    T   +R++     L     G  A+        G D+   + +++  G   +
Sbjct: 175 WLNLYATYFTEDFKRLKQIRERLNVSPLGCGALA---GHPYGIDR---EFLAERLGFS-D 227

Query: 271 TAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGS 329
              N  +A++  D +V      +     + + ++D+    +     +  ++L +    GS
Sbjct: 228 VIGNSLQAVSDRDFVVEIMFWCSLFMNHISRFSEDLIIYSTAE---FNFVKLSDAYSTGS 284

Query: 330 SIMPGKVNPTQNEAMTQVALQIMGNNQTIVMA 361
           S+MP K NP   E +   + ++ G+    +M+
Sbjct: 285 SLMPQKKNPDSLELLRGKSGRVFGSLAGFMMS 316

>AAR086W Chr1 (496601..499024) [2424 bp, 807 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR097W (ASK10) and
           YPR115W
          Length = 807

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 160 HIAAVLELNNNLIPQLTELKNSLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYV 216
            + A  ELNN +IP+L EL+ +L +K KE   +    +T++ +   LT GQ    Y+
Sbjct: 187 QLKASRELNNVVIPKLEELRRNLSSKIKEIKELSNDFKTNIHEQVALT-GQLLQKYI 242

>KNAG0D03480 Chr4 complement(625236..628724) [3489 bp, 1162 aa] {ON}
           Anc_4.117 YGL006W
          Length = 1162

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 41/82 (50%), Gaps = 14/82 (17%)

Query: 16  VETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFG------------IL 63
           ++TD    IKVP N+  G Q  RS   ++  G+  +IP  + K+FG            +L
Sbjct: 52  LKTDLETGIKVPLNETEGTQNHRSTDRYRKYGD-NRIPERLPKSFGKLIWEAFNDKTMLL 110

Query: 64  KKSAAIVNQSLGTLDPSIATPI 85
             +AAIV+ +LG  +    TP+
Sbjct: 111 LTAAAIVSFALGMYE-YFYTPV 131

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,669,652
Number of extensions: 2169142
Number of successful extensions: 6199
Number of sequences better than 10.0: 96
Number of HSP's gapped: 6456
Number of HSP's successfully gapped: 97
Length of query: 475
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 362
Effective length of database: 40,524,141
Effective search space: 14669739042
Effective search space used: 14669739042
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)