Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0I022806.14ON48248222870.0
NCAS0D026306.14ON45141610771e-143
KNAG0E009206.14ON5314208921e-114
KAFR0L003606.14ON5024508651e-110
KAFR0B065506.14ON4564738521e-109
SAKL0E01012g6.14ON5445138511e-108
Skud_15.1646.14ON4824238311e-105
CAGL0B03619g6.14ON4683438281e-105
Suva_15.1786.14ON4764218261e-105
Kwal_56.223876.14ON5434288271e-104
KLLA0D00979g6.14ON5615258211e-103
Kpol_1045.756.14ON4774408141e-103
YOR003W (YSP3)6.14ON4784268141e-103
Smik_5.276.14ON6084368231e-103
Smik_15.1726.14ON4784268101e-102
NDAI0K028806.14ON7044588271e-102
TDEL0G045506.14ON5644628141e-102
YEL060C (PRB1)6.14ON6354318191e-102
TBLA0A073006.14ON5734518141e-102
KNAG0F02970singletonON4203247981e-101
Skud_5.296.14ON6084388121e-101
Ecym_30186.14ON5754348061e-100
KLTH0C11396g6.14ON5504907981e-100
Suva_5.76.14ON6644318007e-99
NCAS0F002206.14ON6954667975e-98
ACR012C6.14ON5414287856e-98
ZYRO0C07942g6.14ON5484397795e-97
TPHA0M002306.14ON5854227747e-96
CAGL0E02651g6.14ON4854267651e-95
Kpol_1032.56.14ON6804247643e-93
CAGL0L13266gsingletonON5794365078e-57
Suva_3.846.313ON5274284592e-50
Smik_3.1496.313ON4914314545e-50
Kpol_1018.56.313ON4654134527e-50
TDEL0A072806.313ON4363254481e-49
Skud_3.1246.313ON5404474471e-48
YCR045C (RRT12)6.313ON4913234396e-48
KNAG0I024706.313ON4754284222e-45
ZYRO0D08822g6.313ON4903234186e-45
SAKL0A02002g6.313ON4793494133e-44
CAGL0L10802g6.313ON5173404135e-44
KLTH0A06094g6.313ON4963124117e-44
Kpol_1028.616.313ON5183134074e-43
NCAS0D043906.313ON4923304054e-43
TBLA0F039706.313ON7342403844e-39
Kwal_23.61836.313ON4933273765e-39
KLLA0F06028g6.313ON5083253732e-38
AAR069W6.313ON7683323783e-38
TPHA0D037606.313ON6073193736e-38
Ecym_21056.313ON6102883719e-38
KAFR0J024506.313ON4782383661e-37
NDAI0I005606.313ON4832103492e-35
TBLA0A067006.313ON4972343467e-35
Kwal_33.133721.78ON3773393312e-33
KLTH0F02288g1.78ON3803573242e-32
Kpol_2000.691.78ON3863042502e-22
ZYRO0F16764g1.78ON3863402342e-20
TPHA0B045201.78ON3883262235e-19
TDEL0C062301.78ON3643622182e-18
TBLA0A054101.78ON3822661828e-14
Ecym_64862.6ON781102714.4
YNL238W (KEX2)2.6ON814106705.1
CAGL0J07546g2.6ON78987705.7
Skud_14.1012.6ON819106705.8
TDEL0E021805.406ON98793705.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0I02280
         (482 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   885   0.0  
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     419   e-143
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   348   e-114
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   337   e-110
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   332   e-109
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   332   e-108
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   324   e-105
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   323   e-105
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   322   e-105
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   323   e-104
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   320   e-103
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   318   e-103
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   318   e-103
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   321   e-103
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   316   e-102
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   323   e-102
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   318   e-102
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   320   e-102
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   318   e-102
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              311   e-101
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   317   e-101
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   315   e-100
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   311   e-100
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   312   7e-99
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   311   5e-98
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   306   6e-98
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   304   5e-97
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   302   7e-96
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   299   1e-95
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   298   3e-93
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   199   8e-57
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   181   2e-50
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   179   5e-50
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   178   7e-50
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   177   1e-49
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   176   1e-48
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   173   6e-48
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   167   2e-45
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   165   6e-45
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   163   3e-44
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   163   5e-44
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   162   7e-44
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   161   4e-43
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   160   4e-43
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   152   4e-39
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   149   5e-39
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   148   2e-38
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   150   3e-38
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   148   6e-38
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   147   9e-38
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   145   1e-37
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    139   2e-35
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   137   7e-35
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   132   2e-33
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   129   2e-32
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   100   2e-22
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...    95   2e-20
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...    91   5e-19
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    89   2e-18
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    75   8e-14
Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}...    32   4.4  
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    32   5.1  
CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa] ...    32   5.7  
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    32   5.8  
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    32   5.9  

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  885 bits (2287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/482 (91%), Positives = 439/482 (91%)

Query: 1   MTLGGTLLILSWFARSITSLIIPEIIHSGNNDASHAKLNERDTLDKNQIPFIIPTHGPQK 60
           MTLGGTLLILSWFARSITSLIIPEIIHSGNNDASHAKLNERDTLDKNQIPFIIPTHGPQK
Sbjct: 1   MTLGGTLLILSWFARSITSLIIPEIIHSGNNDASHAKLNERDTLDKNQIPFIIPTHGPQK 60

Query: 61  NFIPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQISNDTKGM 120
           NFIPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQISNDTKGM
Sbjct: 61  NFIPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQISNDTKGM 120

Query: 121 IIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLL 180
           IIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLL
Sbjct: 121 IIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLL 180

Query: 181 QDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCA 240
           QDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCA
Sbjct: 181 QDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCA 240

Query: 241 GIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXXXXXXXXXXXXE 300
           GIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVA                  E
Sbjct: 241 GIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVANSHTNKTNNISSSSSVHSE 300

Query: 301 FKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGXX 360
           FKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVG  
Sbjct: 301 FKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGAS 360

Query: 361 XXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXXXXXGLTAYYLSL 420
                     NWGPCVDVFAPGINIKSTYIGPNNNETL             GLTAYYLSL
Sbjct: 361 SFSDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLSLSGSSMSSPFVSGLTAYYLSL 420

Query: 421 QPDVSSQFHDSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKDLSGFWNATRK 480
           QPDVSSQFHDSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKDLSGFWNATRK
Sbjct: 421 QPDVSSQFHDSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKDLSGFWNATRK 480

Query: 481 EN 482
           EN
Sbjct: 481 EN 482

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  419 bits (1077), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 220/416 (52%), Positives = 264/416 (63%), Gaps = 20/416 (4%)

Query: 63  IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQISNDTKGMII 122
           IP+QYIVLF++DTTD+Q       L+S +   + +Y +       L  FQ+++D +G   
Sbjct: 53  IPNQYIVLFKSDTTDIQRETHLATLNSWLLNTDPQYTI-------LHSFQLAHDLQGYTS 105

Query: 123 RAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQD 182
           R P +  +  +  +      II+ IE+DSYVH      QIDS WGL+RISQR  LKLLQD
Sbjct: 106 RLP-EQLIRSLATD-----PIIQSIEQDSYVHALGRQKQIDSPWGLARISQRERLKLLQD 159

Query: 183 QFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGI 242
           QFY YDD+G+     CYILDTGIN NH EF+GRA WG      EP+ ED NGHGTHCAG+
Sbjct: 160 QFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHGTHCAGV 219

Query: 243 IGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFK 302
           IGS  YGVAK T LIAVKVLD +GDG MS VI G+E+V                    FK
Sbjct: 220 IGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTG-----FK 274

Query: 303 GSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGXXXX 362
           GSV+NLSLGA KSP+L   +E+A K+G+H  VAAGNED+DAC TSPADSP  +TVG    
Sbjct: 275 GSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSF 334

Query: 363 XXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXXXXXGLTAYYLSLQP 422
                   NWGPCVDVFAPGINI STYIGP+NNET              GL AY+LSLQP
Sbjct: 335 SDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQP 394

Query: 423 DVSSQFHDSLM--TPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKDLSGFWN 476
           D  SQF+  +   TP QLK KII FST G+L E+P  T N++VYNGGG  L  FWN
Sbjct: 395 DTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFWN 450

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  348 bits (892), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 195/420 (46%), Positives = 257/420 (61%), Gaps = 19/420 (4%)

Query: 65  DQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQISNDTKGMIIR- 123
           ++YI+LF+   T  QIS  +Q L  ++ E     +     + VL  F +     G +   
Sbjct: 96  NKYIILFKEGVTAEQISAHKQLLQQVLLE-TSDVSAQGIVADVLDSFDLEGVLSGYVAEL 154

Query: 124 APIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQ 183
           +P+   LE V+ + F     ++++E+DS VH N+F TQ ++ WGL+RIS R+ L L    
Sbjct: 155 SPM--VLELVRRSPF-----VQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFN 207

Query: 184 FYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGII 243
            Y YDD  +G+GVD YI+DTGIN  H EFEGRA WG ++P  +   ED NGHGTHCAG I
Sbjct: 208 KYLYDD-AAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFD-EDGNGHGTHCAGTI 265

Query: 244 GSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKG 303
            SK YGVAK  N+IAVKVL   G GSMSDVI+G+EF A                  +FKG
Sbjct: 266 ASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDK------KFKG 319

Query: 304 SVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGXXXXX 363
           S  N+SLG  KSPSLD  +++A K+G+H +VAAGNE++DAC TSPA S   ITVG     
Sbjct: 320 STANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLS 379

Query: 364 XXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXXXXXGLTAYYLSLQPD 423
                  NWG CVD+FAPG+NI STY G +++ T              GL  Y+LSLQP+
Sbjct: 380 DDRAYFSNWGSCVDIFAPGLNILSTYTG-SDDATATLSGTSMASPHVAGLLTYFLSLQPE 438

Query: 424 VSSQFHDSL-MTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKDLSGFWNATRKEN 482
            SSQF  S  +TP+QLK+K++D+ST G+L +LP DT N L+YNGGG DLS FW    K++
Sbjct: 439 KSSQFGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDKGKKS 498

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  337 bits (865), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 184/450 (40%), Positives = 259/450 (57%), Gaps = 32/450 (7%)

Query: 44  LDKNQIPFIIPTHGP-QKNFIPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKY---- 98
           LD  +   + P H    +N IP +YI++F++  +  QI   ++ +++L  + +  +    
Sbjct: 38  LDSAKFSSLAPVHNADAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDF 97

Query: 99  --------NVNDNYSK----VLSRFQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKI 146
                   NV ++  +    ++S F IS+   G I       +L D   +      +I  
Sbjct: 98  TEYLQTDINVPESMRQSLGGIVSDFDISSLLSGYIA------YLSDELLHFIRLNPLIAF 151

Query: 147 IERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGIN 206
           IE D+ VH   F TQ ++ WGL+RIS R  L L     Y YDD+ +GK VD Y++DTG++
Sbjct: 152 IEHDTMVHTTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDD-AGKNVDAYVIDTGVD 210

Query: 207 SNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKG 266
            NH+EF  RA WG ++P+ +  + D NGHGTH AG IGS+ YGVAK  N+IAVKVL   G
Sbjct: 211 VNHVEFHSRAHWGKTIPLNDQDI-DGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNG 269

Query: 267 DGSMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAK 326
            GSMSDV+ G+EF                      KGSV N+SLG  KSP+LD+A+ +A 
Sbjct: 270 SGSMSDVVKGVEFAVSSHLERMKNEK-------NLKGSVANMSLGGGKSPALDLAVNAAV 322

Query: 327 KIGIHITVAAGNEDEDACMTSPADSPAVITVGXXXXXXXXXXXXNWGPCVDVFAPGINIK 386
           K GIH  VAAGNE+++AC +SPA +   +TVG            NWG CVD+FAPG+NI 
Sbjct: 323 KAGIHFAVAAGNENQNACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNIL 382

Query: 387 STYIGPNNNETLXXXXXXXXXXXXXGLTAYYLSLQPDVSSQFHDSLMTPDQLKRKIIDFS 446
           STYIG N++ T              GL AYYLSLQP+ SS+F    ++  QLK+K+I+++
Sbjct: 383 STYIGANDDVTATLSGTSMASPHVAGLLAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYA 442

Query: 447 TNGMLKELPLDTANKLVYNGGGKDLSGFWN 476
           T  +L++LP  T N L+YNGGG+DLS FWN
Sbjct: 443 TKDVLEDLPEGTPNVLIYNGGGQDLSDFWN 472

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  332 bits (852), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 196/473 (41%), Positives = 267/473 (56%), Gaps = 29/473 (6%)

Query: 9   ILSWFARSIT-----SLIIPEIIHSGNNDASHAKLNERD-TLDKNQIPFIIPTHGPQKNF 62
           +L W+   +      SL++PEI      +    K  +RD T  + ++  +      Q + 
Sbjct: 4   LLFWYTSFVLTGGCLSLLLPEIFQCRGIETISQK--DRDSTFSRTEV--LEHLSAKQNDI 59

Query: 63  IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQISNDTKGMII 122
           I DQYIV+F+N     +     + L + I+  + +++  D++   L+ F+I     G I+
Sbjct: 60  IKDQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNLNIFKIGTTLSGYIL 119

Query: 123 RAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQD 182
           R PI+         +     I+++IE DS VH  K   Q D+ WGLSRISQR  +++ QD
Sbjct: 120 RGPIETL------QLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVRIGQD 173

Query: 183 QFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGI 242
           Q Y+YDD  SG  V  Y+LDTGI  +H +F GRA WG ++ V     ED++GHGTH AGI
Sbjct: 174 QLYYYDDATSGN-VTAYVLDTGIMISHEQFNGRARWGKTI-VPNDVDEDNSGHGTHVAGI 231

Query: 243 IGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFK 302
           I S  +GVAK   ++AVKVL   G+G MSDV+ G+EFV                     K
Sbjct: 232 IASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKNKNYS----------K 281

Query: 303 GSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGXXXX 362
           GSVVNLSLGA KSP+L +A+++A    IH  VAAGNE+ DAC TSPAD+   ITVG    
Sbjct: 282 GSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIF 341

Query: 363 XXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXXXXXGLTAYYLSLQP 422
                   NWG CVDVFAPG+N+ STYIG ++N TL             GL AYYLSLQP
Sbjct: 342 SDERAFFSNWGECVDVFAPGMNVMSTYIG-SDNATLSLSGTSAAAPYTAGLIAYYLSLQP 400

Query: 423 DVSSQFHDSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKDLSGFW 475
           D  S +    MTP +LK KI+ F +  +L ELP +T N ++YNG G++LS FW
Sbjct: 401 DKDSGYFTGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  332 bits (851), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 204/513 (39%), Positives = 279/513 (54%), Gaps = 44/513 (8%)

Query: 1   MTLGGTLLILSWFARSITSLIIPEIIHSG--------NND-----ASHAKLNERDTLDKN 47
           M +  T+L ++       +L+IPE+  S         N+D     AS AK   R   +K 
Sbjct: 1   MKVQSTILPIAALTTLAAALVIPEVDKSSKDVSVKEINSDSQEVLASFAKEITRAAAEKG 60

Query: 48  QIPFIIP-THGPQ-KNFIPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYS 105
           +   + P    PQ  N IP +YI++F+ D T  +IS  ++ +S    E   K +  D++ 
Sbjct: 61  EEVKLAPLVSSPQPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSF- 119

Query: 106 KVLSRFQISNDTKGMIIRAPIDDFLE--DVKNNIFNY--------------QKIIKIIER 149
              +  + S D  G+  ++      E  D+ N +  Y               + ++ IE+
Sbjct: 120 --FAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEK 177

Query: 150 DSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNH 209
           DS V  ++F TQ  + WGLSRIS R  L L     Y YDD+ +GKGV  Y++DTGIN NH
Sbjct: 178 DSLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDD-AGKGVTSYVIDTGINVNH 236

Query: 210 IEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGS 269
            +F GRA WG ++P  +    D NGHGTHCAG I S+ YGVAK   ++A+KVL   G G+
Sbjct: 237 KDFNGRAVWGKTVPQNDEDA-DGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGT 295

Query: 270 MSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIG 329
           MSDV+ G+EF A                   FKGS  N+SLG  KSP+LD+A+ +A K G
Sbjct: 296 MSDVVKGVEFAAQSHQEASKKNKKG------FKGSTANMSLGGGKSPALDLAVNAAVKAG 349

Query: 330 IHITVAAGNEDEDACMTSPADSPAVITVGXXXXXXXXXXXXNWGPCVDVFAPGINIKSTY 389
           IH  VAAGNE++DAC TSPA +   ITVG            NWG CVD+FAPG+N+ STY
Sbjct: 350 IHFAVAAGNENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTY 409

Query: 390 IGPNNNETLXXXXXXXXXXXXXGLTAYYLSLQPDVSSQ-FHDSLMTPDQLKRKIIDFSTN 448
           IG +   T              GL  Y+LSLQPD  S+ F  S +TP QLK+K+I +ST 
Sbjct: 410 IG-SETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTK 468

Query: 449 GMLKELPLDTANKLVYNGGGKDLSGFWNATRKE 481
            +L ELP DT N L+YNGGG+DLS FW  + ++
Sbjct: 469 DVLYELPEDTPNYLIYNGGGQDLSDFWGKSEEQ 501

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  324 bits (831), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 180/423 (42%), Positives = 246/423 (58%), Gaps = 21/423 (4%)

Query: 63  IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSR----------FQ 112
           +P +YI++F  D T+  I    Q +    +    K   +D++ + +S             
Sbjct: 69  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGID 128

Query: 113 ISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRIS 172
           IS D  G+  R     F ++V   +F    ++K IE +S V ++  + Q D+ WGL RIS
Sbjct: 129 ISFDINGLF-RGYTGYFTDEVIEIVFQ-DPLVKFIEHESTVRISNSSRQEDAPWGLHRIS 186

Query: 173 QRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDS 232
            R   K  QD  Y Y+D  +G GV  Y+LDTGI++ H +FEGRA WG  +P  + +  D 
Sbjct: 187 HRERAKYGQDLEYLYED-AAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEA-SDL 244

Query: 233 NGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXXXXX 292
           NGHGTHCAGIIGS+ +GVAK TN++AVKVL   G+G++SDVI G+E+VA           
Sbjct: 245 NGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSKKRG 304

Query: 293 XXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSP 352
                  +FKGS  NLSLG+ KSP++++A+ +A   G+H  +AAGNEDEDAC++SPA + 
Sbjct: 305 S------KFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAE 358

Query: 353 AVITVGXXXXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXXXXXG 412
             ITVG            NWG CVDVFAPGINI STYIG + N TL             G
Sbjct: 359 KSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIG-SRNATLSLSGTSMAAPHVAG 417

Query: 413 LTAYYLSLQPDVSSQFHDSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKDLS 472
           + +Y LSLQP   S+F    ++P QLK KI+ FST G+L ++  +T N+LVYNGGGK L 
Sbjct: 418 ILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLD 477

Query: 473 GFW 475
            FW
Sbjct: 478 EFW 480

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  323 bits (828), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 166/343 (48%), Positives = 216/343 (62%), Gaps = 13/343 (3%)

Query: 143 IIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILD 202
           I++ +ERDS VH + F TQ ++ WGL+RIS R+ L L     Y YD N  G+GV  Y++D
Sbjct: 87  IVEFVERDSVVHASNFDTQNNAPWGLARISHRDRLNLGNFNKYLYD-NAGGEGVTAYVID 145

Query: 203 TGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVL 262
           TGIN  H+EF+GRA WG ++P+ +  + D NGHGTHCAG I SK YG+AK+ N++AVKVL
Sbjct: 146 TGINVKHVEFDGRAQWGKTIPLNDLDI-DGNGHGTHCAGTIASKHYGIAKKANVVAVKVL 204

Query: 263 DFKGDGSMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIAL 322
              G G+MSDVI G+E+ A                  +FKGS  N+SLG  KSP+LD+A+
Sbjct: 205 KSDGSGTMSDVIKGVEYAAQAHLKESKNNK-------KFKGSTANMSLGGGKSPALDMAV 257

Query: 323 ESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGXXXXXXXXXXXXNWGPCVDVFAPG 382
            +A   GIH  VAAGNE++DAC TSPA +   ITVG            NWG CVD+FAPG
Sbjct: 258 NAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLSDDRAYFSNWGKCVDIFAPG 317

Query: 383 INIKSTYIGPNNNETLXXXXXXXXXXXXXGLTAYYLSLQPDVSSQFHDSL---MTPDQLK 439
           +NI STYIG  N ET              GL  Y+LSLQPD  S+F+D+    +TP QLK
Sbjct: 318 LNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHGVTPAQLK 377

Query: 440 RKIIDFSTNGMLKELP-LDTANKLVYNGGGKDLSGFWNATRKE 481
           +K+I +ST  +L +LP  D+ N L+YNG G DL  FWN+T  +
Sbjct: 378 KKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNSTSAD 420

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  322 bits (826), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 179/421 (42%), Positives = 247/421 (58%), Gaps = 19/421 (4%)

Query: 63  IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNY---SKVLSRFQISN---- 115
           +P +YI+ F  D++   I   ++ +  +  E   K   +D +   +   S  Q       
Sbjct: 67  LPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFGGIDSF 126

Query: 116 -DTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQR 174
            D  G+  R     F E+V   +     IIK IE++S V +   T Q ++ WGL RIS R
Sbjct: 127 FDINGLF-RGYTGYFTEEVIKRVLQ-DPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHR 184

Query: 175 NHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNG 234
              K  QD  Y Y+D  +G+GV  Y+LDTGI+ NH +FEGRA WG  +P  + +  D NG
Sbjct: 185 EKAKYGQDLEYLYED-AAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEA-SDLNG 242

Query: 235 HGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXXXXXXX 294
           HGTHCAGIIGS+ +GV K TNL+AVKVL   G+G++SDVI G+E+V              
Sbjct: 243 HGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSKKGGP- 301

Query: 295 XXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAV 354
                +FKGS  NLSLG+ KSP++++A+ +A + G+H  +AAGNEDEDAC++SPA +   
Sbjct: 302 -----KFKGSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKS 356

Query: 355 ITVGXXXXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXXXXXGLT 414
           ITVG            +WG CVDVFAPG+NI STYIG + N +L             G+ 
Sbjct: 357 ITVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIG-SRNASLSLSGTSMAAPHVAGIL 415

Query: 415 AYYLSLQPDVSSQFHDSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKDLSGF 474
           +Y+LSLQP   S+F DS ++P QLK KII+FST G+L ++  DT N+L+YNGGG+ L  F
Sbjct: 416 SYFLSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNF 475

Query: 475 W 475
           W
Sbjct: 476 W 476

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  323 bits (827), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 181/428 (42%), Positives = 245/428 (57%), Gaps = 26/428 (6%)

Query: 63  IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQI--------- 113
           IP +YIV+F++     ++    + +S    +   K + ND + +     ++         
Sbjct: 80  IPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSREG 139

Query: 114 ----SNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLS 169
               S D  GM+ R  I  F +++ + I     ++  +E+DS V+ N+F TQ  + WGLS
Sbjct: 140 GILDSFDVNGML-RGYIGYFTQEIVDFI-RMNPLVAFVEQDSMVYANEFDTQNGAPWGLS 197

Query: 170 RISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSL 229
           RIS R  L L     Y YDD  +GKGV  Y++DTGIN +H +FEGRA+WG ++P  +   
Sbjct: 198 RISHREKLNLGSFNKYLYDD-AAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLD- 255

Query: 230 EDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXX 289
           +D NGHGTHCAG I SK YGVAK  N++AVKVL   G GSMSDV+ G+EF A        
Sbjct: 256 QDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVK 315

Query: 290 XXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPA 349
                      FKGS  N+SLG  KSP+LD+A+ +A K GIH  VAAGNE++DAC +SPA
Sbjct: 316 KNKKG------FKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 369

Query: 350 DSPAVITVGXXXXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXXX 409
            +   ITVG            NWG CVD+FAPG+N+ STYIG +   T            
Sbjct: 370 AAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIG-SETATATLSGTSMASPH 428

Query: 410 XXGLTAYYLSLQPDVSSQFHDSL--MTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGG 467
             GL  Y+LSLQPD  S++  +   +TP QLK+K+I +ST   L +LP DT N L+YNGG
Sbjct: 429 VAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGG 488

Query: 468 GKDLSGFW 475
           G+DL  FW
Sbjct: 489 GQDLDDFW 496

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  320 bits (821), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 194/525 (36%), Positives = 269/525 (51%), Gaps = 60/525 (11%)

Query: 1   MTLGGTLLILSWFARSITSLIIPEI------------------------IHSGNNDA--- 33
           M    TLL ++  +   T+L+IPE+                         H  N  A   
Sbjct: 1   MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASSDLDKPQHHANGKARSK 60

Query: 34  SHAKLNERDTLDK-------NQIPFIIPTHGPQKNFIPDQYIVLFENDTTDLQISRFEQF 86
           S  +  +    DK       + I   + T     N IP++YI++F+ D +  ++   ++ 
Sbjct: 61  SRGRCADSKKFDKLRPVDDASAILAPLSTVNDIANKIPNRYIIVFKKDASADEVKFHQEL 120

Query: 87  LSSLIEEDNQKYNVNDNYSKVLSRFQISNDTKGMIIRAPIDDFLEDVKNNIFNY------ 140
           +S    +       ND +    S        K   +   I D   D+  ++  Y      
Sbjct: 121 VSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSF-DIAGSLSGYVGYFTK 179

Query: 141 --------QKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGS 192
                     +++ +E DS V  N F TQ  + WGL+RIS R  L L     Y YDD+ +
Sbjct: 180 EVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDD-A 238

Query: 193 GKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAK 252
           GKGV  Y++DTG+N NH +F+GRA WG ++P  +P + D NGHGTHCAG IGS  YGVAK
Sbjct: 239 GKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDV-DGNGHGTHCAGTIGSVHYGVAK 297

Query: 253 ETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGA 312
             +++AVKVL   G G+MSDV+ G+E+VA                   FKGS  N+SLG 
Sbjct: 298 NADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKG------FKGSTANMSLGG 351

Query: 313 PKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGXXXXXXXXXXXXNW 372
            KSP+LD+A+ +A K G+H  VAAGNE++DAC TSPA +   ITVG            NW
Sbjct: 352 GKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNW 411

Query: 373 GPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXXXXXGLTAYYLSLQPDVSSQFHDSL 432
           G CVD+F PG+NI STYIG ++  T              GL  Y+LSLQPD  S++  + 
Sbjct: 412 GKCVDIFGPGLNILSTYIG-SDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAA 470

Query: 433 --MTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKDLSGFW 475
             +TP QLK+K+IDFST  +L +LP DT N L+YNGGG+DL   W
Sbjct: 471 GGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLW 515

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  318 bits (814), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 189/440 (42%), Positives = 241/440 (54%), Gaps = 38/440 (8%)

Query: 58  PQKNFIPDQYIVLFENDTTDLQISRFEQFLSSL-------IEEDNQKY------NVNDN- 103
           P    IP  YIV+F    T  +IS   + +S L       +  D++ +      +VN N 
Sbjct: 30  PNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNG 89

Query: 104 -YSKVLSRFQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQI 162
               V   F+I ND  G            D          ++K IERDS VH  + TTQ 
Sbjct: 90  LLGGVRDMFKIGNDLHGYT------GMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQY 143

Query: 163 DSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSL 222
           ++ WGL+RIS R+ L L     Y YDD G GKGV  Y++DTGIN  +++F GRA WG ++
Sbjct: 144 NAPWGLARISHRSRLNLSTFNKYLYDDLG-GKGVKAYVIDTGINITNVDFGGRAYWGKTI 202

Query: 223 PVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAX 282
           P  E ++ D NGHGTH AG I S  YGVAK+  + AVKVL   G GSMSDV+ G+E+V  
Sbjct: 203 PAGEANV-DGNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYVVG 261

Query: 283 XXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDED 342
                             FKGSV N+SLG  KS SLD+A+ +A   G+H  VAAGNE++D
Sbjct: 262 AHQRDVGTAG--------FKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQD 313

Query: 343 ACMTSPADSPAVITVGXXXXXXXXXXXXNWGPCVDVFAPGINIKSTYIG-PNNNETLXXX 401
           AC TSPA +   ITVG            NWG CV +FAPG+NI STYIG P+   TL   
Sbjct: 314 ACNTSPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATL--S 371

Query: 402 XXXXXXXXXXGLTAYYLSLQPDVSSQFHD----SLMTPDQLKRKIIDFSTNGMLKELPLD 457
                     GL AY+LSLQP V SQF+     + +TPDQLK+KI+ F T   L++LP +
Sbjct: 372 GTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPAN 431

Query: 458 TANKLVYNGGGKDLSGFWNA 477
           T N + YNG GK L  FWNA
Sbjct: 432 TPNVIAYNGAGKSLEDFWNA 451

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  318 bits (814), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/426 (41%), Positives = 246/426 (57%), Gaps = 19/426 (4%)

Query: 59  QKNFIPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQISNDTK 118
           +  F+P +Y+++F  D +  QI    Q +         K   ND + +V+S    S    
Sbjct: 63  KTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSVSSKSQF 122

Query: 119 GMI---------IRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLS 169
           G I          R     F +++   I +   IIK +E+++ V ++  + Q ++ WGL 
Sbjct: 123 GGIDNFFDINGLFRGYTGYFTDEIIK-IISQDPIIKFVEQETTVKISNSSLQEEAPWGLH 181

Query: 170 RISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSL 229
           R+S R   K  QD  Y Y+D  +GKGV  Y+LDTGI++ H +FEGRA WG  +P  + + 
Sbjct: 182 RVSHREKPKYGQDLEYLYED-AAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEA- 239

Query: 230 EDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXX 289
            D NGHGTHCAGIIGSK +GVAK T ++AVKVL   G+G++SDVI G+E+V         
Sbjct: 240 SDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSK 299

Query: 290 XXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPA 349
                     EFKGS  NLSLG+ KS ++++A+ +A   G+H  +AAGNEDEDAC++SPA
Sbjct: 300 KKNK------EFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPA 353

Query: 350 DSPAVITVGXXXXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXXX 409
            +   ITVG            NWG CVDVFAPGINI STYIG + N TL           
Sbjct: 354 GAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIG-SRNATLSLSGTSMASPH 412

Query: 410 XXGLTAYYLSLQPDVSSQFHDSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGK 469
             G+ +Y+LSLQP   S+F +   +P +LK K++ FST G+L ++  DT NKL+YNGGGK
Sbjct: 413 VAGILSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGK 472

Query: 470 DLSGFW 475
            L GFW
Sbjct: 473 KLDGFW 478

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  321 bits (823), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/436 (42%), Positives = 249/436 (57%), Gaps = 34/436 (7%)

Query: 63  IPDQYIVLFENDTTDLQISRFE--------QFLSSLIEEDNQKYNVNDNY------SKVL 108
           IP++YIV+F+    + +++  +        Q + +L  ED    +  D Y        + 
Sbjct: 152 IPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAGGIQ 211

Query: 109 SRFQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGL 168
             F I N     I    I  F +++ + +     ++  +ERDS V   +F TQ  + WGL
Sbjct: 212 DSFNIDN-----IFSGYIGYFTQEIID-LIRQNPLVDFVERDSVVEATEFDTQNSAPWGL 265

Query: 169 SRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPS 228
           +RIS R  L L     Y YDD+ +G+GV  Y++DTG+N NH +FE RA WG ++P+ +  
Sbjct: 266 ARISHRERLNLGSFNKYLYDDD-AGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDED 324

Query: 229 LEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXX 288
           L D NGHGTHCAG I SK YGVAK  N++AVKVL   G G+MSDV+ G+E+ A       
Sbjct: 325 L-DGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKQA 383

Query: 289 XXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSP 348
                       FKGS  N+SLG  KSP+LD+A+ +A + GIH  VAAGNE++DAC TSP
Sbjct: 384 QEKKKG------FKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSP 437

Query: 349 ADSPAVITVGXXXXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXX 408
           A +   ITVG            NWG CVDVFAPG+NI STYIG ++  T           
Sbjct: 438 ASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIG-SDEATATLSGTSMASP 496

Query: 409 XXXGLTAYYLSLQPDVSSQF----HDSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVY 464
              GL  Y+LSLQP   S+F     DSL TP QLK+K+I +ST  +L ++P DT N L+Y
Sbjct: 497 HVAGLLTYFLSLQPGSDSEFFELGQDSL-TPQQLKKKLIHYSTKDILFDIPEDTPNFLIY 555

Query: 465 NGGGKDLSGFWNATRK 480
           NGGG+DLS FWN T+K
Sbjct: 556 NGGGQDLSAFWNDTKK 571

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  316 bits (810), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/426 (41%), Positives = 249/426 (58%), Gaps = 19/426 (4%)

Query: 59  QKNFIPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQISNDTK 118
           +   IP +YIV+F  D +   I    + +         K   +D + +V+S   I+ D +
Sbjct: 63  KTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSS-SIAPDLQ 121

Query: 119 GMIIRAPID---------DFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLS 169
              I +  D          +  D   N+ +   +IK IE++S V ++  + Q D+ WGL 
Sbjct: 122 LGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLH 181

Query: 170 RISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSL 229
           RIS R   K  QD  Y Y+D  +G+GV  Y+LDTGI++ H +FEGRA WG  +P  + + 
Sbjct: 182 RISHREKAKYGQDLEYLYED-AAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEA- 239

Query: 230 EDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXX 289
            D NGHGTHCAGIIGSK YGVAK T L+AVKVL   G+G++SDVI G+E+VA        
Sbjct: 240 SDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSR 299

Query: 290 XXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPA 349
                     EFKGS  NLSLG+ KS ++++A+++A   G+H  +AAGNE+EDAC++SPA
Sbjct: 300 KKSK------EFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPA 353

Query: 350 DSPAVITVGXXXXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXXX 409
            +   ITVG            NWG CVDVFAPGINI STYIG + N TL           
Sbjct: 354 GAQKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIG-SRNATLSLSGTSMAAPH 412

Query: 410 XXGLTAYYLSLQPDVSSQFHDSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGK 469
             G+ +Y+LSLQP   S++ D+ ++P +LK K++ FST+G+L ++  +T N+L+YNGGGK
Sbjct: 413 VAGMLSYFLSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGK 472

Query: 470 DLSGFW 475
            L   W
Sbjct: 473 ILDDLW 478

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  323 bits (827), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 183/458 (39%), Positives = 257/458 (56%), Gaps = 41/458 (8%)

Query: 50  PFIIPTHG--------PQKNFIPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVN 101
           P I PT G             +P++YI++F++     +IS  ++ +S + ++   +   +
Sbjct: 218 PLITPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPH 277

Query: 102 DNY--------------SKVLSRFQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKII 147
            ++                ++S F I+N     I+      F ++V + +     ++K +
Sbjct: 278 HHFFHSTSEEEEESFRNGGIISSFNINN-----ILSGYSGYFTQEVID-LIRLNPLVKYV 331

Query: 148 ERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINS 207
           ERDS V   +F TQ ++ WGLSRIS R  L L     Y YDD+ +GKGV C+++DTGIN 
Sbjct: 332 ERDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDD-AGKGVTCFVIDTGINV 390

Query: 208 NHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGD 267
           NH++F  RA WG ++P  +  + D NGHGTHCAG I S  YGVAK   ++AVKVL   G 
Sbjct: 391 NHVDFGKRAIWGKTIPSNDQDI-DGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGS 449

Query: 268 GSMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKK 327
           GSMSDVI G+EF A                  ++KGS  N+SLG  KSP+LD+A+ +A +
Sbjct: 450 GSMSDVIKGVEFAAETHLNNEKNKK-------DYKGSTANMSLGGGKSPTLDLAVNAAVE 502

Query: 328 IGIHITVAAGNEDEDACMTSPADSPAVITVGXXXXXXXXXXXXNWGPCVDVFAPGINIKS 387
            GIH +VAAGNE++DAC +SPA +   ITVG            NWG CVDVFAPG+NI S
Sbjct: 503 AGIHFSVAAGNENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILS 562

Query: 388 TYIGPNNNETLXXXXXXXXXXXXXGLTAYYLSLQPDVSSQF----HDSLMTPDQLKRKII 443
           TY+G  N+ T              GL  Y+LSLQPD  S F     D  +TP+QLK+K+I
Sbjct: 563 TYVGDGNDNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLI 622

Query: 444 DFSTNGMLKELPLDTANKLVYNGGGKDLSGFWNATRKE 481
            +ST+ +L +LP  T NKL+YNG G D+S  WN   +E
Sbjct: 623 AYSTSDILYDLPDGTPNKLIYNGAGGDISDLWNGKVQE 660

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  318 bits (814), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 186/462 (40%), Positives = 251/462 (54%), Gaps = 23/462 (4%)

Query: 27  HSGNNDASHAKLNERDTLDKNQIPFIIPTHGPQKNFIPDQYIVLFENDTTDLQISRFEQF 86
           H G++DA          + +   P  IP      N  P +YIV+ ++ + +      E  
Sbjct: 80  HEGHHDALPEHRGIVHKMGEGVAPLSIPP-----NAFPHRYIVVLKHSSPEEIALHMEAI 134

Query: 87  LSSLIEEDNQKYNVNDNYS----KVLSRFQISNDTKGMIIRAPIDDFLEDVKNNIFNYQK 142
             S ++   +    +  +S    +     Q S D  G++       +  D    +     
Sbjct: 135 TQSQLQSVGELAQDDPFFSAQGVRTTGGIQDSFDVAGLL--NGYVGYFTDAVVELIRKSP 192

Query: 143 IIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILD 202
           ++  +E DS VH ++F TQ  + WGLSRIS R  L L     Y +DD  +GKGV  Y++D
Sbjct: 193 MVDFVEMDSPVHASEFDTQNGAPWGLSRISHRERLNLGSFNKYLFDDE-AGKGVTSYVID 251

Query: 203 TGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVL 262
           TGIN  H +FEGRA WG ++P  +  L D NGHGTHCAG I SK YGVAK  +++AVKVL
Sbjct: 252 TGINVKHQDFEGRAHWGKTIPTNDEDL-DGNGHGTHCAGTIASKHYGVAKGADVVAVKVL 310

Query: 263 DFKGDGSMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIAL 322
              G GSMSDVI G+EF A                   FKGS  N+SLG  KSP+LD+A+
Sbjct: 311 RSNGSGSMSDVIKGVEFAAQSHQKAVKDKKKG------FKGSTANMSLGGGKSPALDLAV 364

Query: 323 ESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGXXXXXXXXXXXXNWGPCVDVFAPG 382
            +A K GIH  VAAGNE++DAC TSPA +   +TVG            N+G CVD+FAPG
Sbjct: 365 NAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPG 424

Query: 383 INIKSTYIGPNNNETLXXXXXXXXXXXXXGLTAYYLSLQPDVSSQFHDS---LMTPDQLK 439
           +NI STYIG +++ T              GL  Y+LSLQPD  S F D+    +TP+QLK
Sbjct: 425 LNILSTYIG-SDDATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLK 483

Query: 440 RKIIDFSTNGMLKELPLDTANKLVYNGGGKDLSGFWNATRKE 481
           +K+I +ST  +L +LP DT N L+YNGGG  L GFW+   K+
Sbjct: 484 KKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFWDGHDKQ 525

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  320 bits (819), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 179/431 (41%), Positives = 246/431 (57%), Gaps = 24/431 (5%)

Query: 63  IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQISNDTKGMI- 121
           IP++YI++F+      +I   ++ +     +  +  +  D +        +S    G I 
Sbjct: 179 IPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQ 238

Query: 122 --------IRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQ 173
                       I  F +++ + +     ++  +ERDS V   +F TQ  + WGL+RIS 
Sbjct: 239 DSFNIDNLFSGYIGYFTQEIVD-LIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISH 297

Query: 174 RNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSN 233
           R  L L     Y YDD+ +G+GV  Y++DTG+N NH +FE RA WG ++P+ +  L D N
Sbjct: 298 RERLNLGSFNKYLYDDD-AGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDL-DGN 355

Query: 234 GHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXXXXXX 293
           GHGTHCAG I SK YGVAK  N++AVKVL   G G+MSDV+ G+E+ A            
Sbjct: 356 GHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKEAQEKKK 415

Query: 294 XXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPA 353
                  FKGS  N+SLG  KSP+LD+A+ +A ++GIH  VAAGNE++DAC TSPA +  
Sbjct: 416 G------FKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADK 469

Query: 354 VITVGXXXXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXXXXXGL 413
            ITVG            NWG CVDVFAPG+NI STYIG +++ T              GL
Sbjct: 470 AITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIG-SDDATATLSGTSMASPHVAGL 528

Query: 414 TAYYLSLQPDVSSQF----HDSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGK 469
             Y+LSLQP   S+F     DSL TP QLK+K+I +ST  +L ++P DT N L+YNGGG+
Sbjct: 529 LTYFLSLQPGSDSEFFELGQDSL-TPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQ 587

Query: 470 DLSGFWNATRK 480
           DLS FWN T+K
Sbjct: 588 DLSAFWNDTKK 598

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  318 bits (814), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 186/451 (41%), Positives = 256/451 (56%), Gaps = 41/451 (9%)

Query: 50  PFIIPTHG----PQKNFIPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYS 105
           P I P +     PQ N IP +YI+ F+ D    +I   +Q ++ L ++   +   +  Y 
Sbjct: 109 PAIAPLYSQSLHPQ-NIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYF 167

Query: 106 KVLSRFQISNDTKGMIIRAPIDD--------------FLEDVKNNIFNYQKIIKIIERDS 151
                    N  +G+ ++ PI D              F +DV + I     +++ +E+DS
Sbjct: 168 ---------NSVEGLDLQQPIIDSFNINSLLQGYIGYFTDDVIDFI-RLNPLVQFVEQDS 217

Query: 152 YVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIE 211
            V++N+F TQ  + WGL+RIS R  L L     Y +DD  +G+GV  Y++DTG+N  H +
Sbjct: 218 TVNINEFDTQNGAPWGLARISHRERLNLGSFNKYLFDDK-AGEGVTAYVIDTGVNVEHND 276

Query: 212 FEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMS 271
           FEGRASWG ++P  +  L D NGHGTHCAG I SK YGVAK  N++AVKVL   G GSMS
Sbjct: 277 FEGRASWGKTIPNNDEDL-DGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMS 335

Query: 272 DVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIH 331
           DV+ G+E+                     FKGS  N+SLG  KSPSLD+A+ +A K GIH
Sbjct: 336 DVLKGVEYATASHLADVKNKKSG------FKGSTANMSLGGGKSPSLDLAVNAAVKAGIH 389

Query: 332 ITVAAGNEDEDACMTSPADSPAVITVGXXXXXXXXXXXXNWGPCVDVFAPGINIKSTYIG 391
             VAAGNE++DAC TSPA +   ITVG            NWG CVDVFAPG+NI STYIG
Sbjct: 390 FAVAAGNENQDACNTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIG 449

Query: 392 PNNNETLXXXXXXXXXXXXXGLTAYYLSLQPDVSSQFHDSL---MTPDQLKRKIIDFSTN 448
            +++ T              GL +Y+LSLQP+  S+F  S    +TP QLK+++I + T 
Sbjct: 450 -SDDATATLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTK 508

Query: 449 GMLKELPLDTANKLVYNGGGKDLSGFWNATR 479
            +L ++P  T N LV+NG G+DLS FWN ++
Sbjct: 509 DILLDIPELTPNVLVFNGAGQDLSDFWNISK 539

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  311 bits (798), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 155/324 (47%), Positives = 203/324 (62%), Gaps = 10/324 (3%)

Query: 143 IIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILD 202
            ++++E +S V+    T Q D  WGL R+SQR+ +++  +Q Y YD  GS K V+ YILD
Sbjct: 104 FVEMVETNSKVYALNVTVQEDVPWGLMRLSQRDRVRIGDEQVYRYDTRGSAKDVNVYILD 163

Query: 203 TGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVL 262
           TGI  +H EFEGRA WG ++   +P   D NGHGTHCAGI+G  TYGVAKE NLIAVKVL
Sbjct: 164 TGIQVDHEEFEGRARWGKTIAWNDPD-RDDNGHGTHCAGIVGGATYGVAKEANLIAVKVL 222

Query: 263 DFKGDGSMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIAL 322
              GDG MSDVI G+EF                    E +GS++NLSLGA +SP+L   +
Sbjct: 223 HATGDGEMSDVIRGIEFAVNEHLTRNQD---------EVRGSIINLSLGAGESPALQRVV 273

Query: 323 ESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGXXXXXXXXXXXXNWGPCVDVFAPG 382
            +A   G+H  VAAGNED++AC +SPA+   V+TVG            NWGPC+DVFAPG
Sbjct: 274 TAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGSTFSDDRAFFSNWGPCIDVFAPG 333

Query: 383 INIKSTYIGPNNNETLXXXXXXXXXXXXXGLTAYYLSLQPDVSSQFHDSLMTPDQLKRKI 442
           +N+KS+Y+G   N+TL             GL AY LSL+PD  SQFH +   P QLK+K+
Sbjct: 334 VNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSLEPDTKSQFHTAWSNPAQLKQKL 393

Query: 443 IDFSTNGMLKELPLDTANKLVYNG 466
           +  +T G L E+P DTAN +++NG
Sbjct: 394 VSLATEGKLFEVPDDTANLMIFNG 417

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  317 bits (812), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 184/438 (42%), Positives = 247/438 (56%), Gaps = 34/438 (7%)

Query: 63  IPDQYIVLFE----NDTTDLQISRFEQF----LSSLIEEDNQKYNVNDN------YSKVL 108
           IP++YI++F+     + TD       Q     + +L  ED    +  D+         + 
Sbjct: 152 IPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTRDSSLSTSETGGIQ 211

Query: 109 SRFQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGL 168
             F I N   G I       F +++ + +     ++  +ERDS V    F TQ  + WGL
Sbjct: 212 DSFNIDNMFSGYIGY-----FTQEIID-LIRQNPLVDFVERDSVVEATDFDTQNSAPWGL 265

Query: 169 SRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPS 228
           +RIS R  L L     Y YDD+ +G+GV  Y++DTG+N NH +FE RA WG ++P+ +  
Sbjct: 266 ARISHRERLNLGSFNKYLYDDD-AGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDED 324

Query: 229 LEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXX 288
           L D NGHGTHCAG I SK YGVAK  N++AVKVL   G G+MSDV+ G+E+ A       
Sbjct: 325 L-DGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAARAHQKQA 383

Query: 289 XXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSP 348
                       FKGS  N+SLG  KSP+LD+A+ +A + GIH  VAAGNE++DAC TSP
Sbjct: 384 QEKKKG------FKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSP 437

Query: 349 ADSPAVITVGXXXXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXX 408
           A +   ITVG            NWG CVD+FAPG+NI STYIG +++ T           
Sbjct: 438 ASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIG-SDDATATLSGTSMASP 496

Query: 409 XXXGLTAYYLSLQPDVSSQF----HDSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVY 464
              GL  Y+LSLQP   S+F     DSL TP QLK K+I +ST  +L ++P DT N L+Y
Sbjct: 497 HVAGLLTYFLSLQPGSDSEFFEMGQDSL-TPQQLKNKLIHYSTKDILFDVPEDTPNALIY 555

Query: 465 NGGGKDLSGFWNATRKEN 482
           NGGG+DLS FWN T+K +
Sbjct: 556 NGGGQDLSAFWNDTKKSH 573

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  315 bits (806), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 170/434 (39%), Positives = 241/434 (55%), Gaps = 36/434 (8%)

Query: 63  IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNY------------------ 104
           IP +YIV+F++  TD  +   +  +++   E   + +   ++                  
Sbjct: 109 IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 168

Query: 105 SKVLSRFQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDS 164
             +   F+I+   +G         +  D   ++     ++K+IE+DS VH + F TQ  +
Sbjct: 169 GGIEEMFEIAGSLRGYF------GYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGA 222

Query: 165 SWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPV 224
            WGL+R+S R  L L     Y YDDN +GKGV  Y++DTGIN +H+EFEGRA WG ++P 
Sbjct: 223 PWGLARVSHRERLNLGSFNKYLYDDN-AGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPS 281

Query: 225 TEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXX 284
            +    D NGHGTHCAG I SKTYGVAK   ++AVKVL   G G+MSDV+ G+E+V    
Sbjct: 282 NDADY-DGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEH 340

Query: 285 XXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDAC 344
                           FKGS  N+SLG  KS +L++A+++A   GIH  VAAGNE++DAC
Sbjct: 341 RKASGDP--------NFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDAC 392

Query: 345 MTSPADSPAVITVGXXXXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXX 404
            TSPA S   ITV             NWG CVD+FAPG+NI STYIG ++          
Sbjct: 393 NTSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIG-SDTAVATLSGTS 451

Query: 405 XXXXXXXGLTAYYLSLQPDVSSQFH-DSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLV 463
                  GL AY+LSLQPD  S+++  S ++P+ LK+KI+ + +  +L  +P  TAN L+
Sbjct: 452 MASPHVAGLLAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLI 511

Query: 464 YNGGGKDLSGFWNA 477
           +NGGG  L  FWN+
Sbjct: 512 FNGGGGSLDSFWNS 525

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  311 bits (798), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 186/490 (37%), Positives = 271/490 (55%), Gaps = 39/490 (7%)

Query: 14  ARSITSLIIPEIIHSGNN-DASHAKLNERDTLDKNQIPFIIPTHGPQKNF--IPDQYIVL 70
           A +  +L + ++I +G +  +S +K   +D   K +   + P       +  IP +YIV+
Sbjct: 27  ASNTVALKVKDVITAGESIVSSFSKQMTKDAASKGESVELSPLVSSSGKYLAIPHRYIVV 86

Query: 71  FENDTTDLQISRFEQFLS-------SLIEEDNQKYNVNDN----------YSKVLSR--- 110
           F+ + +  ++   +Q +S       + +E  ++ +   +N          Y +  S    
Sbjct: 87  FKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQRSFSAQTR 146

Query: 111 ---FQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWG 167
               Q S D  G++    I  F +++ + I     ++  +E+DS V   +F TQ  + WG
Sbjct: 147 EGGIQDSFDVSGLLT-GYIGYFTDEIVDFI-RMNPLVDFVEQDSVVFAQEFGTQNGAPWG 204

Query: 168 LSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEP 227
           LSRIS R  L L     Y YDD+ +GKGV  Y++DTG+N +H +FEGRASWG ++P  + 
Sbjct: 205 LSRISHREKLNLGSFNKYLYDDD-AGKGVTSYVIDTGVNVDHKDFEGRASWGKTIPTNDL 263

Query: 228 SLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXX 287
             +D NGHGTHCAG I SK YGVAK  N++AVKVL   G GSMSDV+ G+EF A      
Sbjct: 264 D-QDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDA 322

Query: 288 XXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTS 347
                        FKGS  N+SLG  KSP+LD+A+ +A K GIH  VAAGNE++DAC +S
Sbjct: 323 VKENKKG------FKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSS 376

Query: 348 PADSPAVITVGXXXXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXX 407
           PA +   +TVG            NWG CVD+FAPG+N+ STYIG ++  T          
Sbjct: 377 PASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIG-SDTATATLSGTSMAS 435

Query: 408 XXXXGLTAYYLSLQPDVSSQFHDSL--MTPDQLKRKIIDFSTNGMLKELPLDTANKLVYN 465
               GL  Y+LSLQPD  S++  +   +TP QLK+K+I +ST  +L ++P DT N L++N
Sbjct: 436 PHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFN 495

Query: 466 GGGKDLSGFW 475
           GGG+ L  FW
Sbjct: 496 GGGEGLDDFW 505

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  312 bits (800), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 176/431 (40%), Positives = 243/431 (56%), Gaps = 24/431 (5%)

Query: 63  IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQISNDTKGMI- 121
           IP++YI++F+ D    + +   + +     +  +     D +        +S+   G I 
Sbjct: 207 IPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAGGIQ 266

Query: 122 --------IRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQ 173
                       I  F +++ + +     ++  +E+DS V    F TQ  + WGL+R+S 
Sbjct: 267 DSFNIDSLFSGYIGYFTQEIVD-LIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARVSH 325

Query: 174 RNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSN 233
           R  L L     Y YDD+ +G+GV  Y++DTG+N NH +FE RA WG ++P+ +  L D N
Sbjct: 326 RERLNLGSFNKYLYDDD-AGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDL-DGN 383

Query: 234 GHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXXXXXX 293
           GHGTHCAG I SK YGVAK  N++AVKVL   G G+MSDV+ G+E+ A            
Sbjct: 384 GHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVLKGVEYAAKAHQKQAEEKKK 443

Query: 294 XXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPA 353
                  FKGS  N+SLG  KSP+LD+A+ +A + GIH  VAAGNE++DAC TSPA +  
Sbjct: 444 G------FKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADK 497

Query: 354 VITVGXXXXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXXXXXGL 413
            ITVG            N+G CVDVFAPG+NI STYIG ++  T              GL
Sbjct: 498 AITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIG-SDEATATLSGTSMASPHVAGL 556

Query: 414 TAYYLSLQPDVSSQF----HDSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGK 469
             Y+LSLQP   S+F     DSL TP QLK+K+I +ST  +L ++P DT N L+YNGGG+
Sbjct: 557 LTYFLSLQPGSDSEFFEMGQDSL-TPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQ 615

Query: 470 DLSGFWNATRK 480
           DLS FWN T+K
Sbjct: 616 DLSAFWNDTKK 626

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  311 bits (797), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 182/466 (39%), Positives = 257/466 (55%), Gaps = 40/466 (8%)

Query: 41  RDTLDKNQIPFIIPTHGP-----------QKNFIPDQYIVLFENDTTDLQISRFEQFLSS 89
           +D+++    P + PT  P             N IP++YIV+F+      ++   ++ ++ 
Sbjct: 66  QDSVNLKMAPLVTPTPYPVVSGASANSNANSNIIPNRYIVVFKKSILPEEVDFHKELINQ 125

Query: 90  LIEEDNQKYNVND-------------NYSKVLSRFQISNDTKGMIIRAPIDDFLEDVKNN 136
           +  E   K   +D             N   +L+ F ISN   G +     D+ LE ++ N
Sbjct: 126 IQLESAAKLPKDDKFFSASAIEDESINQGGILTTFNISNLLNGYVGYF-TDEVLELIRMN 184

Query: 137 IFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGV 196
                 +++ +E+DS V   +F  Q ++ WGL+RIS R  L L     Y YDD+ +GKGV
Sbjct: 185 -----PLVEYVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLYDDD-AGKGV 238

Query: 197 DCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNL 256
            CY++DTGIN+ H +F  RA WG ++P+ +  + D NGHGTHCAG I S  YGVAK   +
Sbjct: 239 TCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDI-DGNGHGTHCAGTIASTHYGVAKNAEV 297

Query: 257 IAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSP 316
           +AVKVL   G GSMSDVI G+EF A                   FKGS  N+SLG  KSP
Sbjct: 298 VAVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKKG------FKGSTANMSLGGGKSP 351

Query: 317 SLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGXXXXXXXXXXXXNWGPCV 376
           +LD+A+ +A   GIH  VAAGNE++DAC TSPA +   ITVG            NWG CV
Sbjct: 352 TLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKCV 411

Query: 377 DVFAPGINIKSTYIGPNNNETLXXXXXXXXXXXXXGLTAYYLSLQPDVSSQFHD-SLMTP 435
           D+FAPG+NI STYIG +++ T              GL  Y+LSLQP   S+F D + +TP
Sbjct: 412 DIFAPGLNILSTYIG-DDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTELTP 470

Query: 436 DQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKDLSGFWNATRKE 481
            Q+K+K+I++S+  +L +LP  T NKL++NG G +L   WN   +E
Sbjct: 471 AQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKKSQE 516

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  306 bits (785), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 174/428 (40%), Positives = 237/428 (55%), Gaps = 25/428 (5%)

Query: 63  IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNV-----------NDNYSKVLSRF 111
           IP +YIV+F    +D + +   + + +   E   + +            N+ +    +R 
Sbjct: 71  IPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAATRA 130

Query: 112 QISNDTK---GMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGL 168
           +   + +   G  +R  +  F ED+   +      +  +E DS V  + FTTQ  + WGL
Sbjct: 131 EGGIEGEFALGEQLRGYVGYFTEDMVG-LLRSNPHVHFVEEDSMVFASDFTTQNGAPWGL 189

Query: 169 SRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPS 228
           +R+S R  L       Y YDDN SG+GV  Y++DTGIN +H++FE RA WG ++P  +  
Sbjct: 190 ARVSHREKLNSGSFNKYLYDDN-SGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDAD 248

Query: 229 LEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXX 288
             D NGHGTHCAG I SKTYGVAK+ N++AVKVL   G GSMSDV+ G+E+         
Sbjct: 249 Y-DGNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAVKAHRKAA 307

Query: 289 XXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSP 348
                       FKGS  N+SLG  +S +LD+A+++A   GIH  VAAGNE++DAC TSP
Sbjct: 308 EKADKG------FKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTSP 361

Query: 349 ADSPAVITVGXXXXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXX 408
           A S   ITVG            NWG CVD+FAPG+NI STYIG ++              
Sbjct: 362 AASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIG-SDTAVATLSGTSMASP 420

Query: 409 XXXGLTAYYLSLQPDVSSQFHD-SLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGG 467
              GL  Y+LSLQPD  S+F +   ++P+ LK+K+IDF T   L  LP  TAN L+YNGG
Sbjct: 421 HVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGG 480

Query: 468 GKDLSGFW 475
           G DLS FW
Sbjct: 481 GADLSDFW 488

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  304 bits (779), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 177/439 (40%), Positives = 245/439 (55%), Gaps = 24/439 (5%)

Query: 50  PFIIPTHGPQKNFIPDQYIVLFENDTTDLQISRFEQFL--------SSLIEEDN--QKYN 99
           P ++P        + ++YI+LF+      +I    + +        S L EE +  +   
Sbjct: 78  PLVVPED--TLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFFEGIR 135

Query: 100 VNDNYSKVLSRFQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFT 159
           ++  Y   L     + D  GM++      +      ++     +I+++E+DS V+  K  
Sbjct: 136 LDGVYDSPLGGIDHTFDINGMLMG--YSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKAD 193

Query: 160 TQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWG 219
           T+  + WGL+RIS R  L L     Y YD+ G G GV  Y++DTG+N +H +F GRA WG
Sbjct: 194 TENGAPWGLARISHRERLNLGSYNKYLYDEQG-GSGVTSYVIDTGVNVHHNQFGGRAKWG 252

Query: 220 VSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEF 279
            ++P  +   ED NGHGTHCAG IGS TYGVAK  +++AVKVL   G GSMSDV+ G+E+
Sbjct: 253 KTIPAGDLD-EDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEW 311

Query: 280 VAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNE 339
            A                   FKGS  N+SLG  KSPSLD A+ +A   G++  VAAGNE
Sbjct: 312 AAQDHQNAVKQKKPG------FKGSTANMSLGGGKSPSLDQAVNAAVAAGLNFAVAAGNE 365

Query: 340 DEDACMTSPADSPAVITVGXXXXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLX 399
           D+DAC TSPA +   ITVG            N+G CVDVFAPG+NI STYIG +++ T  
Sbjct: 366 DQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIG-SDSSTAT 424

Query: 400 XXXXXXXXXXXXGLTAYYLSLQPDVSSQF-HDSLMTPDQLKRKIIDFSTNGMLKELPLDT 458
                       GL AY+LSLQP   S+F   S ++PDQLK+K++ FST  +L ++P  T
Sbjct: 425 LSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSDIPSGT 484

Query: 459 ANKLVYNGGGKDLSGFWNA 477
            N L+YNGGG DLSGFW +
Sbjct: 485 PNLLIYNGGGGDLSGFWGS 503

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  302 bits (774), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 169/422 (40%), Positives = 244/422 (57%), Gaps = 22/422 (5%)

Query: 65  DQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYN---------VNDNYSKVLSRFQISN 115
           D+YI++F+      Q+ +  + +S+L    +++           + D + +V+  F+++ 
Sbjct: 134 DRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRPAAAPGASALRDGFDRVMDTFEVAG 193

Query: 116 DTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQRN 175
              G I        ++ ++ N      ++  +E+DS VH +   TQ ++ WGL+RIS R 
Sbjct: 194 AFSGYIATVASPKIVDFIRLN-----PLVDYVEKDSVVH-SLDETQNNAPWGLARISHRE 247

Query: 176 HLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNGH 235
            L L     Y Y  N +GKGV  Y++DTGI+ +H+EF  RA WG ++P+ +  + D NGH
Sbjct: 248 GLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDI-DGNGH 306

Query: 236 GTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXXXXXXXX 295
           GTHCAG IGS+ YGVAK  NL+AVKVL   G G+MSDV+ G+E+VA              
Sbjct: 307 GTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDK 366

Query: 296 XXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAVI 355
                +KG+  N+SLG  KSP+LD A+ +A K G+H  VAAGNE++DAC +SPA +   I
Sbjct: 367 NS--NYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAI 424

Query: 356 TVGXXXXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXXXXXGLTA 415
           TVG            N+G CVD+FAPG+NI STYIG  N+ T              GL  
Sbjct: 425 TVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIG-TNDATATLSGTSMASPHVAGLLT 483

Query: 416 YYLSLQPDVSSQFH--DSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKDLSG 473
           Y LSLQPD  S+F+  +S +TP Q+K+KIID++T   L +LP DT NKL+YN GG + + 
Sbjct: 484 YLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYN-GGFNSTD 542

Query: 474 FW 475
           FW
Sbjct: 543 FW 544

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  299 bits (765), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 182/426 (42%), Positives = 242/426 (56%), Gaps = 29/426 (6%)

Query: 63  IPDQYIVLFENDTTDLQI----SRFEQFLSSLIEEDNQKYNVNDNYSKVLSR-------F 111
           IP++YIVLF++  TD +I    S  E+  SS I   +  +     Y+ + +R       F
Sbjct: 74  IPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQYNDISTRGIGLQHEF 133

Query: 112 QISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRI 171
            I     G I       F E     I N   +++++E DS V +N +  Q    WGL RI
Sbjct: 134 SIGRSMTGYI-----GYFTETTAKFIAN-SPLVELVEHDSIVRINNYKMQEHVPWGLGRI 187

Query: 172 SQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLED 231
           SQR  L +L  +FY YDD G GK    +++DTGI  +H +FEGRASWG ++ V   +  D
Sbjct: 188 SQREKLPILGKRFYHYDDRG-GKDTVTFVIDTGIYVDHEDFEGRASWGKTI-VENDNDYD 245

Query: 232 SNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXXXX 291
            NGHGTHCAG I SK YG+AK+  +IAVKVL   G GSMSDVI G+E+            
Sbjct: 246 LNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYNDLKKTK 305

Query: 292 XXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADS 351
                     KG+  N+SLGA KS +L+ A+++A   GI   VAAGNE +DAC +SPA +
Sbjct: 306 S-------NLKGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASA 358

Query: 352 PAVITVGXXXXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXXXXX 411
            + ITVG            N+G CVD+FAPG+NI STYIG + N T              
Sbjct: 359 WSPITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIG-SKNATESLSGTSMSSPHVA 417

Query: 412 GLTAYYLSLQPDVSSQFH--DSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGK 469
           G+ AYYLSLQPD  SQF+   S ++P  LK+K+++++TNG L  LP +T N LVYNGGGK
Sbjct: 418 GVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGK 477

Query: 470 DLSGFW 475
           +LS FW
Sbjct: 478 NLSKFW 483

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  298 bits (764), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 179/424 (42%), Positives = 242/424 (57%), Gaps = 33/424 (7%)

Query: 63  IPDQYIVLFENDTT--DLQISRFEQFLSSLIEEDNQKY-NVNDNYSK-----VLSRFQIS 114
           IP++YI++F+ D +  D+QI +       LI     +Y +V+D  S      +   F ++
Sbjct: 232 IPNKYIIVFKKDVSVKDMQIHK------DLIARAQFQYASVSDETSSSILGGIEEAFNVA 285

Query: 115 NDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQR 174
           N     +    I  F E +   I     I+  +E+DS VH N+  TQ ++ WGL+RIS R
Sbjct: 286 N-----LFHGYIGHFNEQLVQFI-RLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHR 339

Query: 175 NHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNG 234
           + L L     Y YDD  +G+GV  Y++DTGIN  H EF GRA WG ++P  +  + D NG
Sbjct: 340 DGLNLGSYNKYLYDDV-AGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDV-DGNG 397

Query: 235 HGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXXXXXXX 294
           HGTHCAG I SK YGVAK   ++AVKVL   G G+MSDV+ G+E+ A             
Sbjct: 398 HGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKG 457

Query: 295 XXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAV 354
                 FKGS  N+SLG  KS SLD+A+++A K GIH  VAAGNE++DAC +SPA S   
Sbjct: 458 ------FKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENA 511

Query: 355 ITVGXXXXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXXXXXGLT 414
           ITVG            NWG CVDVFAPG+NI STYIG ++  T              GL 
Sbjct: 512 ITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIG-SDEATATLSGTSMASPHVAGLL 570

Query: 415 AYYLSLQPDVSSQFHDS---LMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKDL 471
           +Y+LS+QPD  S+F  S    ++P QLK+K+I +ST  + ++LP  T N LVYN  G ++
Sbjct: 571 SYFLSMQPDADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNI 629

Query: 472 SGFW 475
           S FW
Sbjct: 630 SDFW 633

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  199 bits (507), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 138/436 (31%), Positives = 205/436 (47%), Gaps = 36/436 (8%)

Query: 59  QKNFIPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNY-------------- 104
           Q N +P +YIV+F+N     +I    Q ++ L    +     ND +              
Sbjct: 65  QNNIVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFFHHTRDKEFSTEEL 124

Query: 105 SKVLSRFQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDS 164
             VL  F I +   G +       +  D        Q I+  +E DS + ++   T  +S
Sbjct: 125 GGVLYTFDIGSGFNGYV------GYFTDEVVEFIRKQSIVDYVEMDSILTIDDKETDSNS 178

Query: 165 SWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPV 224
            W L+RIS R  L L     Y +D NG G+ +D YILDTG+   H  +  R   G+ +  
Sbjct: 179 HWHLARISHRPKLGLSNFNEYKFDPNG-GQNIDAYILDTGVYQTHAYYIERTIRGIVITP 237

Query: 225 TEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXX 284
            E    D NGHGT  AG++G +  GVA++  LI VKVL+++G G++S++I GL FV    
Sbjct: 238 NEDE-RDMNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSFVNHHH 296

Query: 285 XXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDAC 344
                             G+VV  S+   KS SL+ A +     GIH+ V AG +  +AC
Sbjct: 297 PQRIEKNGVL--------GAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINAC 348

Query: 345 MTSPADSPAVITVGXXXXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNE---TLXXX 401
            +SPA S   ITV             NWG CVD++ PG  +++TY     N+    +   
Sbjct: 349 NSSPASSSKPITVAGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVT 408

Query: 402 XXXXXXXXXXGLTAYYLSLQPDVSSQFHDSL-MTPDQLKRKIIDFSTNGMLKELPLDTAN 460
                     GL AY+ SLQP + +   D + +TP++LK ++IDF T G L  L   + N
Sbjct: 409 GSSAAAAQVAGLLAYFASLQPGLGTP--DVIPLTPEELKERLIDFGTKGKLTNLERMSPN 466

Query: 461 KLVYNGGGKDLSGFWN 476
            + +NG G +L  F+N
Sbjct: 467 IIAFNGAGGNLDSFFN 482

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  181 bits (459), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 136/428 (31%), Positives = 217/428 (50%), Gaps = 45/428 (10%)

Query: 63  IPDQYIVLFENDTTDLQISR-----FEQFLSSLIEEDNQKYNVND--NYSKVLSRFQISN 115
           + ++Y+V F+N T   Q +      + QF+   IE   +K+++      +  LS+  ++ 
Sbjct: 56  LAEEYLVRFKNPTAFQQFTSTSNRSWRQFIDHRIE---KKFSIGSFRGVTMNLSKNLVNK 112

Query: 116 DTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNK---FTTQIDSSWGLSRIS 172
             K  +I   + +F  +  +       +     + +Y  +++    T Q D+   L+RIS
Sbjct: 113 LKKSPLIADIVPNFKFEAFDTDAELSYMFNTTAKYAYQDIDEAQNVTYQPDAPRHLARIS 172

Query: 173 QRNHLKL-LQDQ-------FYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPV 224
           + + L   L+D+        Y+Y+D   G+GV+ YI+DTGI++ H EFE R   GV L  
Sbjct: 173 RHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAYIMDTGIHAEHPEFEDRVIQGVDL-- 230

Query: 225 TEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXX 284
           T+    D NGHGTH AG++GS+T+G AK+ +L+ VKVL   G G  S+V+ GLEF+    
Sbjct: 231 TKEGFGDENGHGTHVAGLVGSRTFGAAKKVSLVEVKVLGKDGSGEASNVLSGLEFIV--- 287

Query: 285 XXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDAC 344
                          + K  V NLSLG+ +SP +++A+E A + GI    AAGN + DA 
Sbjct: 288 ------EHCTKVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNFNLDAY 341

Query: 345 MTSPADSPAVITVGXX-XXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXX 403
             SPA +  VITVG             NWGPCV++FAPG+ I+S     N+NE+L     
Sbjct: 342 WASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLS-HLNDNESLVLSGT 400

Query: 404 XXXXXXXXGLTAYYLS--LQPDVSSQFHDSLMTPDQLKRKIIDFSTNGMLKELPLDTANK 461
                   G+ A  LS  ++P++ +Q  + L T +   R+ + F  +         T N+
Sbjct: 401 SMSTPIVTGVAAVLLSKGIEPELIAQEIEYLSTRNVFHRRTLFFKPS---------TPNQ 451

Query: 462 LVYNGGGK 469
           ++YNG  K
Sbjct: 452 ILYNGVDK 459

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  179 bits (454), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 139/431 (32%), Positives = 218/431 (50%), Gaps = 51/431 (11%)

Query: 65  DQYIVLFENDTTDLQISR-----FEQFLSSLIEEDNQKYNVND------NYSK-VLSRFQ 112
           ++Y+V F+N T   Q +      + QF+ + IE   +K+++        N SK ++++ +
Sbjct: 18  EEYLVRFKNPTAFQQFTSNSNRSWRQFIDNKIE---KKFSIGSFRGVTMNLSKNLVNKLK 74

Query: 113 ISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNK---FTTQIDSSWGLS 169
            S     ++     + F  D   ++  Y        + SY ++++    T Q D+   L+
Sbjct: 75  KSPLVADIVPNFRFEAFENDSARDV-EYNYTFNATAKYSYENLDEEQNITYQSDAPRHLA 133

Query: 170 RISQRNHLKL-LQDQF-------YFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVS 221
           RIS+   L   ++D+        Y+Y+D+  G+ V+ YI+DTGI ++H EFE R   G+ 
Sbjct: 134 RISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFADHPEFEDRVIQGID 193

Query: 222 LPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVA 281
           L  T+    D NGHGTH AG++GSKTYG AK+ NL+ VKVL   G G  S+V+ GLEF+ 
Sbjct: 194 L--TKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEASNVLSGLEFIV 251

Query: 282 XXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDE 341
                             + K  V NLSLG+ +SP +++A+E A + GI    AAGN + 
Sbjct: 252 ---------EHCTRVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNFNL 302

Query: 342 DACMTSPADSPAVITVGXX-XXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXX 400
           DA   SPA +  VITVG             NWGPCV++FAPG+ I+S     N N+TL  
Sbjct: 303 DAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLS-HLNFNDTLVL 361

Query: 401 XXXXXXXXXXXGLTAYYLS--LQPDVSSQFHDSLMTPDQLKRKIIDFSTNGMLKELPLDT 458
                      G+ A  LS  ++P++ +Q  + L T +   R+ + F  +         T
Sbjct: 362 SGTSMSTPIVTGVAAVLLSKGIEPEMIAQELEYLSTRNVFHRRTLFFKPS---------T 412

Query: 459 ANKLVYNGGGK 469
            N+++YNG  K
Sbjct: 413 PNQILYNGVDK 423

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  178 bits (452), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 135/413 (32%), Positives = 197/413 (47%), Gaps = 53/413 (12%)

Query: 78  LQISRFEQFLSSLIEEDNQKYNVNDNY-SKVLSRFQISNDTKGMIIRAPIDDFLEDVKNN 136
           +++ + E   S L    +Q   + D+  + +  RF      + ++I  P +D +E +K N
Sbjct: 24  IKLKKSESIQSFLKSTKSQSLQIKDDIKNHIRERFTFGA-FRALVIDLP-NDMIEKLKKN 81

Query: 137 -----IFNYQKIIKIIERDSYVHM----NKFTTQIDSSWGLSRISQR-------NHLKLL 180
                I    K+       +Y  +    +K   Q ++   LSR+S+R       N++   
Sbjct: 82  PTISEIIPNLKVNAFANSSTYSELLTYSDKIIIQREAPRHLSRLSRRGQLPYDINNIDRY 141

Query: 181 QDQF-YFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHC 239
            + F Y++D    G  V+ YI+DTGI   H EFEGR  + + L    P   D NGHGTH 
Sbjct: 142 DNAFDYYFDAKYQGSSVNAYIIDTGIYKEHPEFEGRVKFAIDLTQEGPG--DENGHGTHI 199

Query: 240 AGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXXXXXXXXXXXX 299
           AGI+GSKT+GVAK+ N+I VK LD KG G +S ++  LEF                    
Sbjct: 200 AGIVGSKTFGVAKKVNIIDVKALDKKGQGQLSTILKALEFTIRHCKESVD---------- 249

Query: 300 EFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGX 359
             K  V NLS GA ++  +D A++ A   GI + VAAGN + DAC  SPA S  VITVG 
Sbjct: 250 --KKCVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAGNSNIDACWNSPASSKDVITVGA 307

Query: 360 X-XXXXXXXXXXNWGPCVDVFAPGINIKS-TYIGPNNNETLXXXXXXXXXXXXXGLTAYY 417
                       NWG CVDVFAPG+ +KS ++I  N ++ L             G+ A  
Sbjct: 308 FDDRTETIARFSNWGSCVDVFAPGVKVKSLSHI--NGSDVLLLSGTSMASPSVSGIAAIL 365

Query: 418 LSLQPDVSSQFHDSLMTPDQLKRKIIDFSTNGMLKE----LPLDTANKLVYNG 466
           L           D  + P  +K KII+ ST  +  +    +  +T N +V+NG
Sbjct: 366 L-----------DKGLNPKFVKSKIIESSTKNIFHQGTIMIKPNTPNLIVFNG 407

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  177 bits (448), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 117/325 (36%), Positives = 163/325 (50%), Gaps = 40/325 (12%)

Query: 168 LSRISQRNHLKL--------LQDQF-YFYDDNGSGKGVDCYILDTGINSNHIEFEGRASW 218
           LSR+S+R+ L           +  F Y+YD+   G G++ YI+DTGI   H EF GRA +
Sbjct: 121 LSRLSRRSQLPYDFEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVF 180

Query: 219 GVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLE 278
           G  L    P   D NGHGTH AGI+GS  YGVAK+  L+ VK L  KG G+++ VI  +E
Sbjct: 181 GEDLTGEGPG--DGNGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAME 238

Query: 279 FVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGN 338
           F                    E KG V+NLSLGA ++  ++ A+++A + GI + VAAGN
Sbjct: 239 FAV------------NHCRSSEGKGCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGN 286

Query: 339 EDEDACMTSPADSPAVITVGXX-XXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNET 397
            + +AC+ SPA +P  ITVG             NWG CVD+FAPG+ +KS    P+    
Sbjct: 287 SNINACLNSPASAPEAITVGAFDDRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPHLKPI 346

Query: 398 LXXXXXXXXXXXXXGLTAYYLSLQPDVSSQFHDSLMTPDQLKRKIIDFSTNGMLKELPL- 456
           L             GL A  L           D  +  D++K  I+  +TN + +   L 
Sbjct: 347 L-FSGTSMASPSITGLAAILL-----------DEGVPYDKIKDYILKMATNDVFQRRTLV 394

Query: 457 ---DTANKLVYNGGGKDLSGFWNAT 478
               T N++ +NG  K+   F NA 
Sbjct: 395 FKPGTPNRVAFNGVKKNDDKFSNAV 419

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  176 bits (447), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 146/447 (32%), Positives = 217/447 (48%), Gaps = 53/447 (11%)

Query: 54  PTHGPQKNFI--------PDQYIVLFENDTTDLQISR-----FEQFLSSLIEED---NQK 97
           PT  PQ   I         ++Y+V F+N T   Q +      + QF+ + IE+       
Sbjct: 48  PTMKPQCILISLLVNLAYAEEYLVRFKNPTAFQQFTSNSNRSWRQFIDNKIEKKFSIGSF 107

Query: 98  YNVNDNYSK-VLSRFQISNDTKGMIIRAPIDDFLEDVKNNI---FNYQKIIKIIERDSYV 153
             V  N SK ++++ + S     ++     + F  D  N+    + +    K +  D   
Sbjct: 108 RGVTMNLSKNLVNKLKKSPLVADIVPNFRFEAFENDGTNDAELNYTFNATAKYLYEDIDE 167

Query: 154 HMNKFTTQIDSSWGLSRISQRNHLKL-LQDQF-------YFYDDNGSGKGVDCYILDTGI 205
             N  T Q D+   L+RIS+   L   ++D+        Y+Y+D+  G+ V+ YI+DTGI
Sbjct: 168 AQN-ITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIMDTGI 226

Query: 206 NSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFK 265
            S+H EFE R   G+ L  T+    D NGHGTH AG++GSKTYG AK+ NL+ VKVL   
Sbjct: 227 FSDHPEFEDRVIQGIDL--TKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKD 284

Query: 266 GDGSMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESA 325
           G G  S+V+ GLEF+                   + K  V NLSLG+ +SP +++A+E A
Sbjct: 285 GSGEASNVLSGLEFIV---------EHCTRVSRPQGKKCVANLSLGSFRSPIINMAVEGA 335

Query: 326 KKIGIHITVAAGNEDEDACMTSPADSPAVITVGXX-XXXXXXXXXXNWGPCVDVFAPGIN 384
            + GI    AAGN + DA   SPA +  VITVG             NWGPCV++FAPG+ 
Sbjct: 336 IEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVE 395

Query: 385 IKSTYIGPNNNETLXXXXXXXXXXXXXGLTAYYLS--LQPDVSSQFHDSLMTPDQLKRKI 442
           I+S     N  +TL             G+ A  LS  ++P + +Q  + L T +   R+ 
Sbjct: 396 IESLS-HLNYEDTLILSGTSMSTPIVTGVAAVLLSKGIEPALIAQEIEYLSTRNVFHRRT 454

Query: 443 IDFSTNGMLKELPLDTANKLVYNGGGK 469
           + F  +         TAN+++YNG  K
Sbjct: 455 LFFKPS---------TANQILYNGVDK 472

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  173 bits (439), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 118/323 (36%), Positives = 172/323 (53%), Gaps = 34/323 (10%)

Query: 159 TTQIDSSWGLSRISQRNHLKLL---QDQF-----YFYDDNGSGKGVDCYILDTGINSNHI 210
           T Q D+   L+RIS+   L      +D++     Y+Y+ +  G+ V+ YI+DTGI ++H 
Sbjct: 123 TYQPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYIMDTGIFADHP 182

Query: 211 EFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSM 270
           EFE R   G+ L  T+    D NGHGTH AG++GSKTYG AK  NL+ VKVL   G G  
Sbjct: 183 EFEDRVIQGIDL--TKEGFGDQNGHGTHVAGLVGSKTYGAAKRVNLVEVKVLGKDGSGEA 240

Query: 271 SDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGI 330
           S+V+ GLEF+                   + K  V NLSLG+ +SP +++A+E A + GI
Sbjct: 241 SNVLSGLEFIV---------EHCTKVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGI 291

Query: 331 HITVAAGNEDEDACMTSPADSPAVITVGXX-XXXXXXXXXXNWGPCVDVFAPGINIKS-T 388
               AAGN + DA   SPA +  VITVG             NWGPCV++FAPG+ I+S +
Sbjct: 292 VFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLS 351

Query: 389 YIGPNNNETLXXXXXXXXXXXXXGLTAYYLS--LQPDVSSQFHDSLMTPDQLKRKIIDFS 446
           ++  N N+TL             G+ A  LS  ++P++ +Q  + L T +   R+ + F 
Sbjct: 352 HL--NYNDTLILSGTSMSTPIVTGVAAILLSKGIEPEMIAQEIEYLSTRNVFHRRTLFFK 409

Query: 447 TNGMLKELPLDTANKLVYNGGGK 469
            +         T N+++YNG  K
Sbjct: 410 PS---------TPNQILYNGVDK 423

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  167 bits (422), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 133/428 (31%), Positives = 201/428 (46%), Gaps = 64/428 (14%)

Query: 65  DQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQI----------S 114
           ++++V   +D      SR E+F++S++ +D + +       K+  RFQI          S
Sbjct: 20  EEFLVTLNDD------SRSERFMNSVLSKDLKWFM----GGKINKRFQIGELKGLTMNLS 69

Query: 115 NDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQR 174
           +D    I R P   F+++V  NI         +E +S+  + K   Q  +   L+RIS+R
Sbjct: 70  HDVLDKIKRHP---FVKEVVPNIMVKAFEGDAVEDESW--LPKMKRQRGAPRHLARISRR 124

Query: 175 NHLKL-------LQDQF-YFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTE 226
             L          +D F Y+YD    G     YILDTG+  +H EFE R  +G     T 
Sbjct: 125 MQLPYDMNNKTRYRDSFNYYYDRWAQGATTRAYILDTGVMRDHKEFEDRVEFGTD--CTG 182

Query: 227 PSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXX 286
               D NGHGTH AG++GSKT+GVAK   L+ VK LD  G G++  ++  LEF       
Sbjct: 183 EGEGDLNGHGTHVAGLVGSKTFGVAKHVQLVDVKCLDALGAGTLVSILSALEFAV----- 237

Query: 287 XXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMT 346
                        E    V+N+SLG+ KS  L+ A+   +K GI + VAAGN + +AC T
Sbjct: 238 -------QDCQEHEDSQCVLNMSLGSVKSNILNQAINEVEKKGIVVVVAAGNFNMNACWT 290

Query: 347 SPADSPAVITVGX-XXXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXX 405
           SP+ +   ITVG             NWGPCVD+FAPG+N+ S  +  +    +       
Sbjct: 291 SPSSATGAITVGAFDDRFDTIAKFSNWGPCVDIFAPGVNVAS-LVNRDWPSFVKYSGTSM 349

Query: 406 XXXXXXGLTAYYLSLQPDVSSQFHDSLMTPDQLKRKIIDFSTNGMLKELPL----DTANK 461
                 G+ A  L           D  + P+ ++  + + +T+G+ K+  L     T N 
Sbjct: 350 ASPIVCGMVALLL-----------DDGVPPEDIRDYLQELATDGVFKKRTLVFKPGTPNS 398

Query: 462 LVYNGGGK 469
           ++YNG  K
Sbjct: 399 VLYNGNKK 406

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  165 bits (418), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 107/323 (33%), Positives = 162/323 (50%), Gaps = 39/323 (12%)

Query: 157 KFTTQIDSSWGLSRISQR--------NHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSN 208
           K   Q ++   L+R+S+R        + L+  +   Y+Y     G+ ++ YI+DTGI   
Sbjct: 122 KVKVQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGIYKE 181

Query: 209 HIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDG 268
           H +F GRA +G       P   D NGHGTH AGI+GS  +GVAK+ NLI VK L+ +G G
Sbjct: 182 HKDFCGRAIFGRDFTGEGPG--DRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRGQG 239

Query: 269 SMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKI 328
           +++ VI  +EF                      KG V NLSLGA ++  ++ A+++A + 
Sbjct: 240 NLTTVISAVEFAVNHCKSSGK------------KGCVANLSLGAVRNSVINQAIKAAHEA 287

Query: 329 GIHITVAAGNEDEDACMTSPADSPAVITVGX-XXXXXXXXXXXNWGPCVDVFAPGINIKS 387
           G+ I VAAGN + +AC  SPA +P  ITVG             NWGPCVD+FA G+ +KS
Sbjct: 288 GLIIVVAAGNSNINACWNSPASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFASGVKVKS 347

Query: 388 TYIGPNNNETLXXXXXXXXXXXXXGLTAYYLSLQPDVSSQFHDSLMTPDQLKRKIIDFST 447
               P  ++ +             GL A  L           D  + P+ +K K+++ +T
Sbjct: 348 LSAFP-PHKPIAFSGTSMASPSVTGLVAILL-----------DKGVEPENIKAKLVELAT 395

Query: 448 NGMLKELPL----DTANKLVYNG 466
           + +L+   L     T N++ +NG
Sbjct: 396 HDLLQRRTLFFKPGTPNRIAFNG 418

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  163 bits (413), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 115/349 (32%), Positives = 172/349 (49%), Gaps = 41/349 (11%)

Query: 133 VKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKL------LQDQFYF 186
           V N++FN   +    E+ +  +  ++  Q D+   L+R+S+R  L         Q+  Y+
Sbjct: 86  VPNSVFN---VFDQKEQIAEEYSRRYKVQEDAPRHLARLSRRGPLPYSEEDGWYQEFNYY 142

Query: 187 YDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSK 246
           YD    G  V+ YI+DTGI   H +  GRA +G  +    P   D NGHGTH AGI+GS+
Sbjct: 143 YDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADMVGEGPG--DYNGHGTHVAGIVGSR 200

Query: 247 TYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVV 306
           T+GVAK+ NL+ VK L+ KG G+++ VI  +EF                         V 
Sbjct: 201 TFGVAKKVNLVEVKALNAKGQGNLTSVISSIEFSVNHCKKSGML-------------CVA 247

Query: 307 NLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGXX-XXXXX 365
           NLSLG+ ++  L+ A+E+A + G+ + VAAGN + +AC  SPA + + ITVG        
Sbjct: 248 NLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPASAISAITVGAFDDRTDT 307

Query: 366 XXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXXXXXGLTAYYLSLQPDVS 425
                NWG CVDVFA G+ + S    P   + +             GL A  L       
Sbjct: 308 IAKFSNWGMCVDVFASGVKVMSLSNMP-PFKPVAYSGTSMASPSVAGLAAVLL------- 359

Query: 426 SQFHDSLMTPDQLKRKIIDFSTNGMLKELPL----DTANKLVYNGGGKD 470
               DS + P  +K+KIID +T  + ++  L     T N++ +NG  K+
Sbjct: 360 ----DSGIDPPDIKQKIIDLATENVFQKRTLVFKPGTPNRIAFNGVRKE 404

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  163 bits (413), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 115/340 (33%), Positives = 168/340 (49%), Gaps = 46/340 (13%)

Query: 160 TQIDSSWGLSRISQRNHL--------KLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIE 211
           TQ ++   L+R+S+R+ L        +   D  Y+Y     G+ V+ Y+LD+G+  +H +
Sbjct: 159 TQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHCD 218

Query: 212 FEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMS 271
           FEGRA +G    +   +  D NGHGTH AG+IGSKTYGV+K+ N+I VKVLD  G G++ 
Sbjct: 219 FEGRAYYGADF-IRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTLD 277

Query: 272 DVILGLEFVAXXXXXXXXXXXXXXXXX------------XEFKGSVVNLSLGAPKSPSLD 319
            V+ GLEFV+                              E K  V+NLSLG  +S  ++
Sbjct: 278 TVMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCVINLSLGTFRSTIIN 337

Query: 320 IALESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGXX-XXXXXXXXXXNWGPCVDV 378
            A+E   K GI + VAAGN + +AC TSPA    VITVG             NWG CVD+
Sbjct: 338 EAIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGAFDDRIDSIAKFSNWGNCVDI 397

Query: 379 FAPGINIKSTYIGPNNNE----TLXXXXXXXXXXXXXGLTAYYLSLQPDVSSQFHDSLMT 434
           FAPG+ +KS      +N+     +             GL A  L           DS + 
Sbjct: 398 FAPGVLVKSL-----SNKFPYYPIEQTGTSMATPIVTGLVALLL-----------DSGIK 441

Query: 435 PDQLKRKIIDFSTNGMLKELPL----DTANKLVYNGGGKD 470
           P Q+K+++ + +T+ +     L     T N++ +NG  +D
Sbjct: 442 PTQIKKRLNELATDNIFPRRTLLFKPGTPNRIAFNGVKRD 481

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  162 bits (411), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 109/312 (34%), Positives = 158/312 (50%), Gaps = 40/312 (12%)

Query: 168 LSRISQRNHLKLLQDQF--------YFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWG 219
           L+RIS+R  L    +          Y+YDD  SG  V+ Y++DTGI   H + EGRA +G
Sbjct: 142 LARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQLEGRAKFG 201

Query: 220 VSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEF 279
             L    P   D NGHGTH AG+IGS+ +GVAK+ +LI VK L+ KG G+++ VI  +EF
Sbjct: 202 ADLVGEGPG--DFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSVISAIEF 259

Query: 280 VAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNE 339
                                 +G V NLSLG+ ++  L+ A+E+A + G+ I VAAGN 
Sbjct: 260 TVNHCRKSR-------------RGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNS 306

Query: 340 DEDACMTSPADSPAVITVGXX-XXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETL 398
           + +AC +SPA S + ITVG             NWG CVD+FAPG+ I+S    P   + +
Sbjct: 307 NANACWSSPASSLSAITVGAFDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVP-PFKPV 365

Query: 399 XXXXXXXXXXXXXGLTAYYLSLQPDVSSQFHDSLMTPDQLKRKIIDFSTNGMLKELPL-- 456
                        G+ A  L           DS + P  +K ++ID +T+ +  +  L  
Sbjct: 366 AFSGTSMASPIVSGMVANLL-----------DSGIHPFDIKTELIDLATDSVFHKRTLLF 414

Query: 457 --DTANKLVYNG 466
              T N++ + G
Sbjct: 415 KPGTPNRVAFTG 426

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  161 bits (407), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 109/313 (34%), Positives = 154/313 (49%), Gaps = 36/313 (11%)

Query: 168 LSRISQRNHLKL---LQDQF-----YFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWG 219
           L RIS R  L      +++F     Y+Y+D   G  +  YILDTGI + H +FE R   G
Sbjct: 161 LGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHPDFENRVIVG 220

Query: 220 VSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEF 279
             +    P   DSNGHGTH AGI+GSKT+GVAK   L+ VKVL  +G G+++ V+ G++F
Sbjct: 221 ADMTGEGPG--DSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLTTVLSGIQF 278

Query: 280 VAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNE 339
                               + K  V N+SLG  ++  ++ A+  A K G+ + VAAGN 
Sbjct: 279 AV---------DHCRLMRETQGKQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAGNS 329

Query: 340 DEDACMTSPADSPAVITVGXX-XXXXXXXXXXNWGPCVDVFAPGINIKSTYIGP-NNNET 397
           +  AC TSPA +   ITVG             NWG CVD+FAPG+ I+S    P ++++ 
Sbjct: 330 NVSACWTSPASAKNAITVGAFDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPESHHKH 389

Query: 398 LXXXXXXXXXXXXXGLTAYYLSLQPDVSSQFHDSLMTPDQLKRKIIDFSTNGMLKELPL- 456
           +             GL A  L           D  + P  +K K++  ST  +  +L L 
Sbjct: 390 VTHSGTSMASPVVAGLAAILL-----------DKGVEPFDVKDKLLHLSTKDVFNKLTLF 438

Query: 457 ---DTANKLVYNG 466
               T NK+ YNG
Sbjct: 439 FKYGTPNKIAYNG 451

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  160 bits (405), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 114/330 (34%), Positives = 160/330 (48%), Gaps = 44/330 (13%)

Query: 155 MNKFTTQIDSSWG----LSRISQRNHL--------KLLQDQFYFYDDNGSGKGVDCYILD 202
           M K    +   +G    L+R+S+R  L          L    YFYD    G  V+ YI+D
Sbjct: 119 MQKGKCSVKVQYGAPRHLARLSRRKQLPYDFEDKEAYLDSLKYFYDKRSQGASVNAYIID 178

Query: 203 TGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVL 262
           +GI   H EF GRA  G+ L  T     D NGHGTH AGI+GSK+YGVAK+  LI +KVL
Sbjct: 179 SGIYLEHEEFNGRAIPGIDL--TGEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVL 236

Query: 263 DFKGDGSMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKG-SVVNLSLGAPKSPSLDIA 321
           +  G GS++ V+ G+EF                      KG  V NLSLG+ ++  L+ A
Sbjct: 237 NRLGQGSLAMVLGGIEFAVKHCQETSK------------KGRCVANLSLGSMRTAILNKA 284

Query: 322 LESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGX-XXXXXXXXXXXNWGPCVDVFA 380
           +++A   G+ + VAAGN + +AC  SPA +P  ITVG             NWG C+D+FA
Sbjct: 285 IKAAIDAGLVVVVAAGNNNLNACWYSPASAPEAITVGAFDDRIDAIAKFSNWGQCLDIFA 344

Query: 381 PGINIKSTYIGPNNNETLXXXXXXXXXXXXXGLTAYYLSLQPDVSSQFHDSLMTPDQLKR 440
           PG+ IKS  I   + E +             GL A  L           D  ++ +++K 
Sbjct: 345 PGVVIKSLSIF-KDKEDVTYSGTSMASPTVAGLAALTL-----------DQGVSAEEVKD 392

Query: 441 KIIDFSTNGMLKELPL----DTANKLVYNG 466
            I++  T+ +     L     T NK+ +NG
Sbjct: 393 YILEMGTDNVFHRRSLLFKPGTPNKICFNG 422

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  152 bits (384), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 93/240 (38%), Positives = 123/240 (51%), Gaps = 22/240 (9%)

Query: 157 KFTTQIDSSWGLSRISQRNHLKL-------LQDQF-YFYDDNGSGKGVDCYILDTGINSN 208
           KF  Q  +   L+RIS R+ L          ++Q  Y+YDDN  G+GV  Y++DTGI   
Sbjct: 283 KFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILKE 342

Query: 209 HIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDG 268
           H +FE R  +G  L  T     D NGHGTH AG+IGSKTYGV K+  +I VK +   G  
Sbjct: 343 HKDFEDRVEFGTDL--TGEGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGST 400

Query: 269 SMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKI 328
            +S +I  +E+                      K  VVN+SLG+     ++ A+ESA   
Sbjct: 401 QLSHIIEAIEYTVNDCNSRVDK-----------KACVVNMSLGSFYVKVINEAVESAIAE 449

Query: 329 GIHITVAAGNEDEDACMTSPADSPAVITVGX-XXXXXXXXXXXNWGPCVDVFAPGINIKS 387
           G+   VAAGN + DAC +SP  S   ITVG             NWG CVD+FA G+ +KS
Sbjct: 450 GVVFVVAAGNNNIDACWSSPGSSKNAITVGAFDDRLDVIAKFSNWGECVDIFASGVEVKS 509

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  149 bits (376), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 110/327 (33%), Positives = 168/327 (51%), Gaps = 42/327 (12%)

Query: 158 FTTQIDSSWGLSRISQRNHLKLLQDQF--------YFYDDNGSGKGVDCYILDTGINSNH 209
           F  Q ++   L+RIS+R+ L    +          Y+YDD+  G  V+ Y++DTGI   H
Sbjct: 130 FVAQKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKEH 189

Query: 210 IEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGS 269
            +F+GRA +G  L    P   D NGHGTH AG+IGS+ YGVAK+ +LI VK L+ KG G+
Sbjct: 190 RQFQGRAKFGADLVGEGPG--DLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGN 247

Query: 270 MSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIG 329
           ++ VI  +EF                      +G V NLSLG+ ++  L+ A+E+A + G
Sbjct: 248 LTSVISAIEFTVNHCRKSK-------------RGCVANLSLGSFRNSVLNQAVEAALEAG 294

Query: 330 IHITVAAGNEDEDACMTSPADSPAVITVGXX-XXXXXXXXXXNWGPCVDVFAPGINIKS- 387
           + + VAAGN + +AC +SPA S + I+VG             NWG CVD+FAPG+ I S 
Sbjct: 295 VVVVVAAGNSNANACWSSPASSLSAISVGAFDDRTDTIARFSNWGNCVDLFAPGVKIASL 354

Query: 388 TYIGPNNNETLXXXXXXXXXXXXXGLTAYYLSLQPDVSSQFHDSLMTPDQLKRKIIDFST 447
           + I P   +++             G+ A  L           DS + P  +K ++I+ +T
Sbjct: 355 SNIPP--FKSVAYSGTSMASPLVTGMVAVLL-----------DSGIHPFDIKEELINTAT 401

Query: 448 NGMLKELPL----DTANKLVYNGGGKD 470
           + +  +  L     T N++ + G  K+
Sbjct: 402 DSVFHKRALLFKPGTPNRVAFTGVEKE 428

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  148 bits (373), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 107/325 (32%), Positives = 161/325 (49%), Gaps = 40/325 (12%)

Query: 158 FTTQIDSSWGLSRISQRNHLKLLQDQ------FYFYDDNGSGKGVDCYILDTGINSNHIE 211
           F +Q  +   L+RIS+R  L +++         Y Y +   G+GV  Y+LD+G+N +H +
Sbjct: 151 FISQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHPD 210

Query: 212 FEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMS 271
           FEGRA  G+    T     D  GHGTH AG+IGSKTYGVAK+ N++ VKVLD  G G+++
Sbjct: 211 FEGRAMKGID--TTGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTVT 268

Query: 272 DVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPS-LDIALESAKKIGI 330
           ++I GLE+V                     +  V+N+SLGAP + S LD A+ +  + G+
Sbjct: 269 NIIEGLEYVVNQCIGKK-------------RKCVINMSLGAPGTHSILDKAVSAVIEEGV 315

Query: 331 HITVAAGNEDEDACMTSPADSPAVITVGXX-XXXXXXXXXXNWGPCVDVFAPGINIKSTY 389
            + VA GN   +AC  SPA     ITV              NWG C+D++APG+N+KS  
Sbjct: 316 VVVVAGGNSGLNACWYSPAKVRKAITVAAMDDRTDLMAPFSNWGACIDIWAPGVNVKS-- 373

Query: 390 IGPNNNETLXXXXXXXXXXXXXGLTAYYLSLQPDVSSQFHDSLMTPDQLKRKIIDFSTNG 449
           +      T              G  A YL    D           P ++++ +   +T G
Sbjct: 374 LSNKGRGTFVLSGTSMASPIVAGAAAIYLDQGAD-----------PAEVRKILSKTATRG 422

Query: 450 MLKELPL----DTANKLVYNGGGKD 470
           + K+  +     T NK++Y G  ++
Sbjct: 423 VFKKRAIAVRPRTPNKVLYTGNNQE 447

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  150 bits (378), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 104/332 (31%), Positives = 162/332 (48%), Gaps = 39/332 (11%)

Query: 155 MNKFTTQIDSSWGLSRISQRNHLKL-----LQDQF-YFYDDNGSGKGVDCYILDTGINSN 208
           ++++  Q+D+   L+R  +R  L        +  F Y+YD+   G+GV+ Y+LD+GI  +
Sbjct: 422 LHQYAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKS 481

Query: 209 HIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDG 268
           H EF+GRA +G+    T+    D NGHGTH AG++GS+T+G+AK+ N+  +KV+   G G
Sbjct: 482 HPEFDGRAHFGID--TTKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRG 539

Query: 269 SMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPK--SPSLDIALESAK 326
           S S++I G+EF                      K  V N+SLG       +LD A+E+A 
Sbjct: 540 STSNIIAGVEFAVKHCQQSG-------------KRCVANMSLGGLSFGHSALDSAVEAAI 586

Query: 327 KIGIHITVAAGNEDEDACMTSPADSPAVITVGX-XXXXXXXXXXXNWGPCVDVFAPGINI 385
           + G+   VAAGN  E AC  SPA     ITVG             N+G CVD+FAPG+ +
Sbjct: 587 EEGLVFVVAAGNSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAV 646

Query: 386 KSTYIGPNNNETLXXXXXXXXXXXXXGLTAYYLSLQPDVSSQFHDSLMTPDQLKRKIIDF 445
            S    P+N   +             G+ A  L           D  + P ++K  ++  
Sbjct: 647 ASLSNSPSNTMRV-LNGTSMSAPITAGVVAVLL-----------DQGIEPHEVKDHLLSI 694

Query: 446 STNGMLKELPL---DTANKLVYNGGGKDLSGF 474
           ST G+  +  L    T ++ ++ G  ++   F
Sbjct: 695 STKGLFHKRRLVSSRTPDRALFTGVKREDDSF 726

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  148 bits (373), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 107/319 (33%), Positives = 152/319 (47%), Gaps = 36/319 (11%)

Query: 161 QIDSSWGLSRISQRNHLKL-LQDQ-------FYFYDDNGSGKGVDCYILDTGINSNHIEF 212
           Q  +   L ++S R+ L   ++D+        Y+YD    G     YI+DTG+   H EF
Sbjct: 150 QFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHKEF 209

Query: 213 EGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSD 272
             R  +G           D NGHGTH AG+IGSKT+GVAK   L  VKVLD KG G+++ 
Sbjct: 210 GNRVHFGGDF--IGEGKGDYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLTS 267

Query: 273 VILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHI 332
           V+ G+EF                      K  V+N+SLG  ++P ++ A++ A   GI  
Sbjct: 268 VLEGIEFAVNNCKLKQQPMG---------KNCVINMSLGTIRNPIINEAIKEAFLSGITP 318

Query: 333 TVAAGNEDEDACMTSPADSPAVITVGXXXXXXXXXXX-XNWGPCVDVFAPGINIKSTYIG 391
            VAAGN +  AC TSPA S   ITVG             NWG CVD+FAPG+ IKS    
Sbjct: 319 VVAAGNNNFSACWTSPASSNFAITVGAMDDRTDTIAVFSNWGQCVDIFAPGVRIKSL--- 375

Query: 392 PNNNETLXXXXXXXXXXXXXGLTAYYLSLQPDVSSQFHDSLMTPDQLKRKIIDFSTNGML 451
             +N  L              + A  +++         +     D++K+K+ID S+  + 
Sbjct: 376 --SNRMLENGVIHSGTSMASPIVAGLVAI-------LMEKGYKCDEIKQKLIDDSSKSIF 426

Query: 452 KELPL----DTANKLVYNG 466
            +L L     T N+++YNG
Sbjct: 427 SKLTLFFKYGTPNRVIYNG 445

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  147 bits (371), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 140/288 (48%), Gaps = 33/288 (11%)

Query: 185 YFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIG 244
           Y+YD    G+ V+ YILD+GI+ +H EFEGRA +G+      P   D NGHGTH AG++G
Sbjct: 300 YYYDAEHLGETVNVYILDSGIHKSHPEFEGRAVFGIDTTNEGPG--DLNGHGTHVAGLVG 357

Query: 245 SKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGS 304
           SKTYG AK+  +  VKV+   G GS S++I G+EF                      K  
Sbjct: 358 SKTYGAAKKATIYEVKVMTVDGRGSTSNIIAGVEFAVKHCQQSG-------------KKC 404

Query: 305 VVNLSLGAPK--SPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGX-XX 361
           V N+SLG       +LD A+E+A + G+   VAAGN  E AC  SPA     ITVG    
Sbjct: 405 VANMSLGGLSFGHSALDSAVEAAIEEGLVFVVAAGNSKERACWYSPAKVKTAITVGAFDD 464

Query: 362 XXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXXXXXGLTAYYLSLQ 421
                    N+G CVD+FAPG+ + S    P N   +               T+    + 
Sbjct: 465 RSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNTVRVLNG------------TSMSAPIT 512

Query: 422 PDVSSQFHDSLMTPDQLKRKIIDFSTNGMLKELPL---DTANKLVYNG 466
             V +   D  +  + +K ++ID ST G+     L    T ++ ++NG
Sbjct: 513 AGVVAVLLDQGVKHEDVKERLIDLSTKGVFHRRRLVSSRTPDRTLFNG 560

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  145 bits (366), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 89/238 (37%), Positives = 127/238 (53%), Gaps = 23/238 (9%)

Query: 159 TTQIDSSWGLSRISQRNHLKL-------LQDQF-YFYDDNGSGKGVDCYILDTGINSNHI 210
             Q ++   L+RIS+R+ L          +  F Y+Y     G  V  YILD+G++ N  
Sbjct: 117 VVQSEAPRHLARISRRDKLPYDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLT 176

Query: 211 EFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSM 270
           +FEGR  +G     T     DSNGHGTH AG++GSKTYGVAK   ++ VK LD  G G++
Sbjct: 177 DFEGRVEFGFDF--TGDGEGDSNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTL 234

Query: 271 SDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGI 330
             V+  +EF                      K  V NLSLG+ K+  ++ A+++A + G+
Sbjct: 235 ITVLSAIEFAVNDCHEHPE------------KRCVANLSLGSFKNAIINKAIQAATEDGV 282

Query: 331 HITVAAGNEDEDACMTSPADSPAVITVGX-XXXXXXXXXXXNWGPCVDVFAPGINIKS 387
            + VAAGN + +AC TSPA +   ITVG             NWGPCVD++APG+ ++S
Sbjct: 283 VMVVAAGNFNINACWTSPASAEEAITVGAFDDRIDTIAKFSNWGPCVDIYAPGVAVES 340

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  139 bits (349), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 92/210 (43%), Positives = 114/210 (54%), Gaps = 15/210 (7%)

Query: 185 YFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIG 244
           Y+Y     G  V+ YI+D+GI+ N  EFEGRA+ G+ L    P   D NGHGTH AG++G
Sbjct: 161 YYYSKWHQGTDVNAYIIDSGIDINQEEFEGRATHGLDLTGEGPG--DRNGHGTHVAGLVG 218

Query: 245 SKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGS 304
           SKTYGVAK   L+ VK LD +G GS+  VI  LEFV                     K  
Sbjct: 219 SKTYGVAKNVTLVEVKALDRQGSGSLITVISALEFVVNHCGKSKS------------KKC 266

Query: 305 VVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGX-XXXX 363
           V NLSLGA   P L+ A+++    G+ + VAAGN + DAC  SPA   + ITVG      
Sbjct: 267 VANLSLGAFMMPLLNEAIKATVDSGVVVVVAAGNGNIDACWCSPASEKSAITVGAFDDRI 326

Query: 364 XXXXXXXNWGPCVDVFAPGINIKSTYIGPN 393
                  NWG CVD+FAPG+ I S  I  N
Sbjct: 327 DTIAKFSNWGSCVDIFAPGVAISSLSIKDN 356

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  137 bits (346), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 86/234 (36%), Positives = 119/234 (50%), Gaps = 17/234 (7%)

Query: 157 KFTTQIDSSWGLSRISQRNHLKLLQD--QFYFYDDNGSGKGVDCYILDTGINSNHIEFEG 214
           K++TQ ++   LSR S+   L    +    Y+Y  +  G  V  Y+LD+GI  +H EFEG
Sbjct: 141 KYSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEG 200

Query: 215 RASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVI 274
           R         T+  + D+ GHGT  AGIIGSKTYGVAK  NLI +KVL+ KG G++  ++
Sbjct: 201 RILEAYDF--TDSGVGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSIL 258

Query: 275 LGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITV 334
            GL+F+                        ++N SLGA     L+ A E     GI +  
Sbjct: 259 QGLQFITKHCEENTNG------------NCIINASLGAINIQILNKAFEEVHNAGIPVIC 306

Query: 335 AAGNEDEDACMTSPADSPAVITVGXX-XXXXXXXXXXNWGPCVDVFAPGINIKS 387
           AAGN   +AC  +PA S  V TVG             NWG CVD+ APG+ +++
Sbjct: 307 AAGNNAVNACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRT 360

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  132 bits (331), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 101/339 (29%), Positives = 159/339 (46%), Gaps = 20/339 (5%)

Query: 85  QFLSSLIEEDNQKYNVNDNYSKVLSRFQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKII 144
           QF++ L +  +    + + Y+++     +   + G   RA   DF + +  N++ Y   I
Sbjct: 18  QFIAELSDTSSVADILGERYAQMSDNGGVGAISLGNSFRAIYGDFPQRLLENLY-YDGRI 76

Query: 145 KIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTG 204
             +  D  +   ++  Q  +   L+R+SQ++ L+   D  Y Y  NG G GVD Y+LDTG
Sbjct: 77  TAMSMDHILTPAEYIVQEHAPAHLARLSQKSTLRG-SDGTYIYHSNG-GNGVDVYLLDTG 134

Query: 205 INSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDF 264
           I+  H E EGR      L     S  D +GHGT  AG+IGS T+G AK+ NL  V+V D 
Sbjct: 135 IDDLHPELEGRVQKIADLTSNPVSHGDPHGHGTAVAGVIGSATFGSAKKCNLFDVRVADS 194

Query: 265 KGDGSMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALES 324
            G+ ++  VI  LE  +                    + SVV +     K+  L+ A+E+
Sbjct: 195 TGNATLIGVIRALEHASKLASVTQ-------------RPSVVVIPFTMRKNVILNSAIEA 241

Query: 325 A-KKIGIHITVAAGNEDEDACMTSPADSPAVITVGXXXXXXXXXXX--XNWGPCVDVFAP 381
             +   + + VA GN +++AC +SPA +   +T+G              N+G C+D FA 
Sbjct: 242 VIRDQSLPVVVAGGNFNQNACDSSPASAYGALTIGSIDVTKGDSLAPFTNYGDCIDTFAA 301

Query: 382 GINIKSTYIGPNNNETLXXXXXXXXXXXXXGLTAYYLSL 420
           G+NI S   G   + T              G+ AYY+SL
Sbjct: 302 GVNITSLTTGDYESNT-QYSGTSISAGIASGVVAYYMSL 339

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  129 bits (324), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 93/357 (26%), Positives = 167/357 (46%), Gaps = 23/357 (6%)

Query: 70  LFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQISNDTKGMIIRAPIDDF 129
           LF      L+ +   +F++ L +  + +  + + Y+  ++   +   T G   RA   +F
Sbjct: 3   LFMAALFGLRAAGAVRFVAELGDTASVEEVLGEQYAATVAGGGVGAITLGNSFRAIYGEF 62

Query: 130 LEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKL---LQDQFYF 186
            + +  + +   +I+ +   D  + + ++  Q  +   L+R+SQ++ L+      +  Y 
Sbjct: 63  PQQLLEDFYRSGQIVAM-SMDRPLGVAEYMVQQHAPNHLARLSQKSSLRGGNGSDNGAYI 121

Query: 187 YDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSK 246
           Y  N +G GVD Y+LDTGI+  H  FEGR            +  D +GHGT  AG+IGS 
Sbjct: 122 YHSN-AGNGVDVYLLDTGIDGTHPAFEGRVQKAADFSSDPVATGDPHGHGTAVAGVIGSS 180

Query: 247 TYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVV 306
            +GVAK+ NL  V+V +  G  S+  V+  LE  +                    + S++
Sbjct: 181 VFGVAKKCNLFDVRVANSTGHASLIGVLRALEHASKLAAVTK-------------RPSLI 227

Query: 307 NLSLGAPKSPSLDIALES-AKKIGIHITVAAGNEDEDACMTSPADSPAVITVGXXXXXXX 365
            + L  P++  L+ A+E+  + + I + VAAGNE+  AC  SPA +   +T+G       
Sbjct: 228 TIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVSPAGAYGALTIGSIDVARN 287

Query: 366 XXXX--XNWGPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXXXXXGLTAYYLSL 420
                  N+  CVD+F  G+++ +  +G +++                GL AYY+S+
Sbjct: 288 DALAPFTNFAECVDLFTAGVDVAT--LGLDHSSEHHLSGTSISAGVASGLVAYYMSI 342

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  100 bits (250), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 85/304 (27%), Positives = 142/304 (46%), Gaps = 26/304 (8%)

Query: 128 DFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQ--RNHLKLLQDQFY 185
           +F ++V + ++   ++  I   D  +++ ++  Q D+   L+R+S    N     +++  
Sbjct: 67  EFEDEVMSELYGDPRVASI-SIDRMLYLQEYLRQNDAPEHLARLSNGVSNSRVSAKNENA 125

Query: 186 FYDDNGSGKGVDCYILDTGINSNHIEFEGR-ASWGVSLPVTEPSLEDSNGHGTHCAGIIG 244
           F   + +G GVD YI+D+GI+S H  F  R  S  + L      + D +GHGT  AG++ 
Sbjct: 126 FIFHSHAGIGVDVYIVDSGIDSQHPAFMNRHISKLIDLTDNPIPVGDPHGHGTAIAGLVT 185

Query: 245 SKTYGVAKETNLIAVKVLDFKGDG-SMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKG 303
           S T+GV K+ NL  V+V+D + +G  +S ++  LEF+                     + 
Sbjct: 186 SDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEFIENHSRAT-------------MRP 232

Query: 304 SVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPA---DSPAVITVGXX 360
           SV  L     K+  L+ A+ES     I I V AGN+   AC  SPA   +S ++++VG  
Sbjct: 233 SVAVLPFSMSKNAILNSAIESMPN-SIAIVVPAGNQHHMACNFSPASARNSQSILSVGSL 291

Query: 361 --XXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXX--XXXXXXXXXGLTAY 416
                       N+G CVDVF  G+ + + +   N++E                 G   Y
Sbjct: 292 DYRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAIAAGTVGY 351

Query: 417 YLSL 420
           Y+SL
Sbjct: 352 YMSL 355

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score = 94.7 bits (234), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 99/340 (29%), Positives = 146/340 (42%), Gaps = 48/340 (14%)

Query: 107 VLSRFQISNDTKGMII---------RAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNK 157
           VL+ + +S+D +G  I         RA   DF   +   ++N   ++ I  RD  + + +
Sbjct: 30  VLNSYALSSDQQGPEITDIFELGSFRAFTGDFSGPILQKLYNDPNVLAI-SRDGSLKLQE 88

Query: 158 FTTQIDSS---WGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEG 214
              Q ++     GLS IS  +H      Q + Y  NG G GVD Y+LDTGI+  H     
Sbjct: 89  IVLQNNAPSHLVGLSSISPLSH------QPFIYRSNG-GNGVDVYLLDTGIDIKHPNLSK 141

Query: 215 ----RASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSM 270
               R +     PV  P   D  GHGT  AGII S+T+GV K+ NL+ V+V D  GD  +
Sbjct: 142 LNILRMADLTQSPV--PQGTDPQGHGTAMAGIIASETFGVLKKCNLVDVRVADSNGDVKL 199

Query: 271 SDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDIALESAKKIGI 330
           S ++  L                           V+ L +    +P L  A+ S  +  +
Sbjct: 200 STILQALTLTQRHIEGTKRPSVV-----------VIPLEVEDGNNPILTEAIASFDQ-SV 247

Query: 331 HITVAAGNEDEDACMTSPAD-SPA---VITVGXXXXXXXXXXXXNWGPCVDVFAPG---I 383
            I + AGN  +DA   SPA+ +P    +I VG            N+G  VDVF  G    
Sbjct: 248 PIIIPAGNNAQDALNFSPANVNPKPKNIIVVGSVDVNNNPTKFTNYGSNVDVFTVGEQIT 307

Query: 384 NIKSTYI---GPNNNETLXXXXXXXXXXXXXGLTAYYLSL 420
            ++ST +   G +N+ T              G+  YY+SL
Sbjct: 308 TLQSTDLDSQGLSNSLTRQVSGTSASSAITAGVIGYYMSL 347

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score = 90.5 bits (223), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 84/326 (25%), Positives = 136/326 (41%), Gaps = 38/326 (11%)

Query: 147 IERDSYVHMNKFTTQIDSSWGLSRISQ----RNHLKLLQDQFYFYDDNGSGKGVDCYILD 202
           I  + Y+ +  +  Q D+   L R+++     +      +Q+ F D   SG GVD YI+D
Sbjct: 83  ISTEKYLELQGYLKQTDAPKHLGRLTKDSIKSSQYHYANNQYIFSDT--SGNGVDIYIVD 140

Query: 203 TGINSNH-IEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKV 261
           TGI+  H I  +      + L  +     D NGHGT  AGII S  +GV K  NL+ V+V
Sbjct: 141 TGIDIQHPIYLQNNIHKLIDLTTSPIPSGDFNGHGTAMAGIINSDPFGVLKSANLVDVRV 200

Query: 262 LDFKGD-GSMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFKGSVVNLSLGAPKSPSLDI 320
           +D      +MS V+  L  +                     + S++ L     K+  L+ 
Sbjct: 201 VDANTKHATMSRVLSALSLIEKHEQKT-------------MRPSIIVLPFQTEKNTILES 247

Query: 321 ALESAKKIGIHITVAAGNEDEDACMTSPADSPA---VITVGXXXXXXXX-----XXXXNW 372
           A+E+  K  I + + AGN+ ++AC  SP        V+ VG                 N+
Sbjct: 248 AIENISK-KIPVIIPAGNKHQNACKLSPMGIKKLSNVLVVGSLEYSEEQNYLDIAKFSNY 306

Query: 373 GPCVDVFAPGINIKSTYIGPNNNETLXXXXXXXXXX--XXXGLTAYYLSLQPDVSSQFHD 430
           G CVD++  G++I +     N  + L               G+  YY+S   + +     
Sbjct: 307 GSCVDIYTSGVDISTLKTSSNGGKELIHNVTGTSYSCGIVAGVVGYYMSKGMNGTDAVSK 366

Query: 431 SLMTPDQLKRKIIDFSTNGMLKELPL 456
            L +P      ++   +N  +KEL L
Sbjct: 367 VLSSP------LVATRSNTSIKELKL 386

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 88/362 (24%), Positives = 157/362 (43%), Gaps = 49/362 (13%)

Query: 65  DQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQISNDTKGMIIRA 124
           ++++V   +DT+ +++SR   F   + +   +   V D +  +   F +           
Sbjct: 14  ERFVVQLASDTSLVELSRDCSFSIGVGKNFIEMITVGDQFKALAGEFSV----------- 62

Query: 125 PIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQF 184
                 ED++  +++ ++++ I  RD  + + ++  Q  S   LS++S           F
Sbjct: 63  ------EDLEY-LYHDERVVAI-SRDRDLKLQEYKVQYGSPRHLSQLSSGG-------SF 107

Query: 185 YFYDDNGSGKGVDCYILDTGINSNHIEFEG----RASWGVSLPVTEPSLEDSNGHGTHCA 240
            F  D  SG  VD Y+ DTGI+  H   +     + +   S PV  P   D +GHGT  A
Sbjct: 108 TF--DPVSGNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPV--PRGADPHGHGTMMA 163

Query: 241 GIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXXXXXXXXXXXXE 300
           G+I S+T+GV K  +L+ V+V D  G+  +S ++ G+                       
Sbjct: 164 GLIASETFGVLKSCSLVDVRVADKDGEVKLSTLMKGISASVAHARFTKRPSVF------- 216

Query: 301 FKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGXX 360
               V+ +++G  K+  LD  L++  K  I I + AGN+  DAC  SP +   ++ +G  
Sbjct: 217 ----VLPMTIGK-KNHILDNFLQAIPK-DIAIVLPAGNQQTDACDLSPPNDHNILVIGSL 270

Query: 361 XXXXXXXXXXNWGPCVDVFAPGINIKSTYIGPNNNETLXXXX--XXXXXXXXXGLTAYYL 418
                     N+G CVDV+  G +I +     + NE L               G+  Y++
Sbjct: 271 DRDNRLADFSNYGNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVGYHM 330

Query: 419 SL 420
           S+
Sbjct: 331 SM 332

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 74.7 bits (182), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 79/266 (29%), Positives = 113/266 (42%), Gaps = 39/266 (14%)

Query: 139 NYQKIIKIIERDS----YVHMNKFTTQIDSSWG-----LSRISQRNHLKLLQ----DQFY 185
           N+Q    I+E+D     Y  +N     ID         + + + R+  KLL+    D  +
Sbjct: 58  NFQAFSAILEQDHLRSLYNDLNIAAISIDRQLEPQEMIVQKDAPRHLTKLLETEAGDNEF 117

Query: 186 FYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLP-VTEPSLEDSN--GHGTHCAGI 242
            YD   +G GVD YI DTGI  N       AS    +P +  P + D     HGT  +G+
Sbjct: 118 VYDST-AGNGVDIYIFDTGIARNSPGLS--ASRIHDMPGMPGPPIRDQEILEHGTAMSGL 174

Query: 243 IGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVAXXXXXXXXXXXXXXXXXXEFK 302
           IGS  +GV K+ NLI V V D  G   MS V+ GL  V                     +
Sbjct: 175 IGSPAFGVLKKCNLIDVNVGDENGKVFMSKVLKGLNLVQQHVKHTN-------------R 221

Query: 303 GSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPA---DSPAVITVGX 359
            SV+N S    K+  L+ A ++  +  + I VAAGN  +  C  SP     + +++  G 
Sbjct: 222 PSVINFSYCTLKNAILNSAFDNFPR-DVPIAVAAGNYKQPGCSFSPVGCQRNKSLLAFGS 280

Query: 360 XXXX---XXXXXXXNWGPCVDVFAPG 382
                         N+G CV  +APG
Sbjct: 281 LLMNDDGITLSDFSNYGSCVGSYAPG 306

>Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}
           similar to Ashbya gossypii ABL203W
          Length = 781

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 47/102 (46%), Gaps = 14/102 (13%)

Query: 189 DNGSGKGVDCYILDTGIN------SNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGI 242
           +N +G GV   I+D G++       ++   EG   +  +  + +P L D N HGT CAG 
Sbjct: 155 NNITGHGVVAAIVDDGLDYESEDLKDNFCAEGSWDFNANTALPKPILGDDN-HGTRCAGE 213

Query: 243 IGSKT-----YGVAKETNLIAVKVL--DFKGDGSMSDVILGL 277
           I +        GVA    +  +++L  D   +   + ++ GL
Sbjct: 214 IAAAKNKVCGVGVAYNAKVSGIRILSADITSEDEAASLVYGL 255

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 49/106 (46%), Gaps = 19/106 (17%)

Query: 189 DNGSGKGVDCYILDTGINSNHIE----FEGRASW----GVSLPVTEPSLEDSNGHGTHCA 240
           +N +G GV   I+D G++  + +    F    SW      +LP  +P L D + HGT CA
Sbjct: 162 NNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLP--KPRLSD-DYHGTRCA 218

Query: 241 GIIGSKT------YGVAKETNLIAVKVL--DFKGDGSMSDVILGLE 278
           G I +K        GV     +  +++L  D   +   + +I GL+
Sbjct: 219 GEIAAKKGNNFCGVGVGYNAKISGIRILSGDITTEDEAASLIYGLD 264

>CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa]
           {ON} similar to uniprot|P13134 Saccharomyces cerevisiae
           YNL238w KEX2 endoproteinase of late golgi compartment
          Length = 789

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 42/87 (48%), Gaps = 17/87 (19%)

Query: 190 NGSGKGVDCYILDTGINSNHIE----FEGRASWGVS----LPVTEPSLEDSNGHGTHCAG 241
           N +GKGV   I+D G++    +    F    SW  +    LP+  P L D N HGT CAG
Sbjct: 167 NITGKGVVAAIIDDGVDYTSPDLKDNFCKEGSWDFNENQQLPM--PLLSDDN-HGTRCAG 223

Query: 242 IIGS---KTY---GVAKETNLIAVKVL 262
            I +     Y   GVA +  +  +++L
Sbjct: 224 EIAAIRNNNYCGVGVAYDAKVSGIRIL 250

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 49/106 (46%), Gaps = 19/106 (17%)

Query: 189 DNGSGKGVDCYILDTGINSNHIE----FEGRASW----GVSLPVTEPSLEDSNGHGTHCA 240
           +N +G GV   I+D G++  + +    F    SW      +LP  +P L D + HGT CA
Sbjct: 162 NNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLP--KPRLSD-DYHGTRCA 218

Query: 241 GIIGSKT------YGVAKETNLIAVKVL--DFKGDGSMSDVILGLE 278
           G I +K        GV     +  +++L  D   +   + +I GL+
Sbjct: 219 GEIAAKKGNNFCGVGVGYNAKISGIRILSGDITTEDEAASLIYGLD 264

>TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {ON}
           Anc_5.406 YHR102W
          Length = 987

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 42/93 (45%), Gaps = 2/93 (2%)

Query: 102 DNYSKVLSRFQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQ 161
           D+Y KV  +    ++T G   +    D   DVK +  +      I+E D  + M +    
Sbjct: 315 DDYQKVDEKKPEKDETSGEKTQDDTKDADVDVKWDFDSLSSSDYIMEND--IDMEEIPEG 372

Query: 162 IDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGK 194
            ++ W   +  + N+    +DQFY+Y  N +GK
Sbjct: 373 CNNDWTSPQHDRYNYAYPEEDQFYYYPTNPNGK 405

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.136    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,867,619
Number of extensions: 2376401
Number of successful extensions: 7033
Number of sequences better than 10.0: 95
Number of HSP's gapped: 7060
Number of HSP's successfully gapped: 96
Length of query: 482
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 369
Effective length of database: 40,524,141
Effective search space: 14953408029
Effective search space used: 14953408029
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)