Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0I022702.532ON27727714090.0
NCAS0D026402.532ON2602736451e-83
KAFR0A018502.532ON2562764809e-59
CAGL0K02981g2.532ON2782834375e-52
SAKL0A09460g2.532ON2402724302e-51
Kpol_1018.342.532ON2922803923e-45
TPHA0C041802.532ON2642763871e-44
TDEL0A030602.532ON2442403702e-42
KNAG0C058202.532ON2712843557e-40
Smik_13.2482.532ON2552783172e-34
YMR069W (NAT4)2.532ON2852723183e-34
ZYRO0B01980g2.532ON1881702912e-31
Skud_13.2252.532ON2542252692e-27
TBLA0G022202.532ON2782882669e-27
KLTH0D06820g2.532ON2602342571e-25
Suva_13.2442.532ON2572242239e-21
Kwal_26.80162.532ON2402781781e-14
KLLA0E18569g2.532ON2151801119e-06
Ecym_72562.532ON2431871065e-05
KLLA0A12089gsingletonON181131820.034
Kwal_26.88778.697ON16274730.47
NDAI0A064703.183ON60658731.1
ZYRO0D10912g8.697ON16478691.6
AAL102C8.697ON15976691.8
KLTH0G04818g5.573ON61271702.5
KLLA0C09823g8.698ON66969693.2
Kpol_529.128.426ON111353685.1
SAKL0H06006g8.697ON16973656.0
TBLA0B016503.183ON48996667.0
Kpol_1072.48.698ON66176668.1
KLTH0B03564g5.194ON38191659.0
NOTE: 1 genes in the same pillar as NDAI0I02270 were not hit in these BLAST results
LIST: Agos_YGOB_Anc_2.532

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0I02270
         (277 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.53...   547   0.0  
NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON...   253   1e-83
KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.53...   189   9e-59
CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly...   172   5e-52
SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly ...   170   2e-51
Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {...   155   3e-45
TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.53...   153   1e-44
TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.53...   147   2e-42
KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {...   141   7e-40
Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W...   126   2e-34
YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N alph...   127   3e-34
ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some si...   116   2e-31
Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W...   108   2e-27
TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.53...   107   9e-27
KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some si...   103   1e-25
Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)...    91   9e-21
Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W ...    73   1e-14
KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa] ...    47   9e-06
Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON} ...    45   5e-05
KLLA0A12089g Chr1 (1052066..1052611) [546 bp, 181 aa] {ON} simil...    36   0.034
Kwal_26.8877 s26 (987655..988143) [489 bp, 162 aa] {ON} YOR253W ...    33   0.47 
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    33   1.1  
ZYRO0D10912g Chr4 (921315..921809) [495 bp, 164 aa] {ON} similar...    31   1.6  
AAL102C Chr1 complement(163467..163946) [480 bp, 159 aa] {ON} Sy...    31   1.8  
KLTH0G04818g Chr7 (383522..385360) [1839 bp, 612 aa] {ON} simila...    32   2.5  
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    31   3.2  
Kpol_529.12 s529 (24687..28028) [3342 bp, 1113 aa] {ON} (24687.....    31   5.1  
SAKL0H06006g Chr8 complement(532245..532754) [510 bp, 169 aa] {O...    30   6.0  
TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.1...    30   7.0  
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    30   8.1  
KLTH0B03564g Chr2 (287100..288245) [1146 bp, 381 aa] {ON} simila...    30   9.0  

>NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.532
           YMR069W
          Length = 277

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/277 (96%), Positives = 267/277 (96%)

Query: 1   MHTSTSDALLNIVCEEFPTILQSADGVTTWRRRIHHKPSHDEVSIPIEHSSEVYNLSSDP 60
           MHTSTSDALLNIVCEEFPTILQSADGVTTWRRRIHHKPSHDEVSIPIEHSSEVYNLSSDP
Sbjct: 1   MHTSTSDALLNIVCEEFPTILQSADGVTTWRRRIHHKPSHDEVSIPIEHSSEVYNLSSDP 60

Query: 61  QQRSDVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQ 120
           QQRSDVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQ
Sbjct: 61  QQRSDVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQ 120

Query: 121 EPLLFLSFMLTEGDGFIGTHSXXXXXXXXXXQLMSVIYLYEIQILPQLRGQGIGTKLLSV 180
           EPLLFLSFMLTEGDGFIGTHS          QLMSVIYLYEIQILPQLRGQGIGTKLLSV
Sbjct: 121 EPLLFLSFMLTEGDGFIGTHSNDDDENEHNDQLMSVIYLYEIQILPQLRGQGIGTKLLSV 180

Query: 181 HLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVYQIE 240
           HLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVYQIE
Sbjct: 181 HLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVYQIE 240

Query: 241 KRQTRNLRRINNAGTREVTKQIIKKPVYYLYYLPIDL 277
           KRQTRNLRRINNAGTREVTKQIIKKPVYYLYYLPIDL
Sbjct: 241 KRQTRNLRRINNAGTREVTKQIIKKPVYYLYYLPIDL 277

>NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON}
           Anc_2.532 YMR069W
          Length = 260

 Score =  253 bits (645), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 137/273 (50%), Positives = 183/273 (67%), Gaps = 19/273 (6%)

Query: 7   DALLNIVCEEFPTILQSA--DGVTTWRRRIHHKPSHDEVSIPIEHSSEVYNLSSDPQQRS 64
           +A  +++ EEFP  L+    + +   +R+I      +  S   ++S +V  +     Q  
Sbjct: 5   EAFSHMILEEFPLTLEVTLQEQLKCLKRKILIIEPDNCTSG--KNSQDVVYMKCSTDQGD 62

Query: 65  DVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQEPLL 124
            +L++FL+ILDVNLG KYTKVSK IYEN + WK NKLEEM SPGL+YVSYWDE+  EP+L
Sbjct: 63  KMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESDEPML 122

Query: 125 FLSFMLTEGDGFIGTHSXXXXXXXXXXQLMSVIYLYEIQILPQLRGQGIGTKLLSVHLHQ 184
           FLSFMLTE DGF               +L+SV+YLYEIQILP LR + +GT+LL+ HL  
Sbjct: 123 FLSFMLTEEDGF-----------TEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQD 171

Query: 185 CCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVYQIEKRQT 244
            CS L ++ G + L YPL+GIELTVFSDN  AI FYKSIGM+LTPDSP D V  +E+R+T
Sbjct: 172 ACSRLRSENG-ELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRT 230

Query: 245 RNLRRINNAGTREVTKQIIKKPVYYLYYLPIDL 277
           R + +  N  T  V + I++KP+YYL+YLP+ +
Sbjct: 231 RGMAQ--NIST-SVGRTIVQKPIYYLFYLPLSI 260

>KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.532
           YMR069W
          Length = 256

 Score =  189 bits (480), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 119/276 (43%), Positives = 158/276 (57%), Gaps = 34/276 (12%)

Query: 7   DALLNIVCEEFPTILQSADGVTTWRRRIHHKPSHDEVSIPIEHSSEVYNLSSDPQQ---- 62
           +  L IV +EFP  L++       +R+I +  S DE +   + S  V N   D  +    
Sbjct: 8   NGFLKIVSDEFPKELRTKG--QNLKRKILYIASEDEEN---KESDSVINEQDDLTKFTEG 62

Query: 63  -RSDVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQE 121
             S +L+ FL ILD NLG KY K+S+ IY+N+ SWK NKL EM SPGLIYVSYW E+ ++
Sbjct: 63  IGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEK 122

Query: 122 P--LLFLSFMLTEGDGFIGTHSXXXXXXXXXXQLMSVIYLYEIQILPQLRGQGIGTKLLS 179
               LFLSFMLTE D  +              +  SVIYLYEIQ++ + RG  +GT+L+ 
Sbjct: 123 KTCALFLSFMLTEEDFVVDD-----------IRKFSVIYLYEIQLIEKYRGCQLGTRLIK 171

Query: 180 VHLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVYQI 239
             L   C     K    F   PL+GI+LTVFSDN +AI FY+ IGMK T  SP DEV +I
Sbjct: 172 -GLSNVCQIAQVKIRPAF---PLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKI 227

Query: 240 EKRQTRNLRRINNAGTREVTKQIIKKPVYYLYYLPI 275
           E R+TR             T ++++KP+YYL YLP+
Sbjct: 228 ESRKTR-------TSVNRKTLKVVRKPIYYLLYLPV 256

>CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069w
          Length = 278

 Score =  172 bits (437), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 115/283 (40%), Positives = 165/283 (58%), Gaps = 24/283 (8%)

Query: 3   TSTSDALLNIVCEEFPTILQSADGV------TTWRRRIHHKPSHDEVSIPIEHSSEVYNL 56
           T+ +D+ L+ V + FP ++ +   +         +R++      D        ++EV   
Sbjct: 9   TNVNDSFLHHVLDCFPKVITTKSNLPKDIEDVQLQRKVLVIDGDDYCLANKALTNEVVLR 68

Query: 57  SSDPQQRSDVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYW- 115
           S   ++  ++L+  L +LD NLG KY   SK +Y N K WK NK+EEM + G+IYVSYW 
Sbjct: 69  SKHIKESKNILSSLLELLDQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSYWT 128

Query: 116 --DEKYQEPLLFLSFMLTEGDGFIGTHSXXXXXXXXXXQLMSVIYLYEIQILPQLRGQGI 173
             D+++  PLLFLSFMLTE +    TH+           + SVI+LYEIQI  +LR QG+
Sbjct: 129 KVDDEHTVPLLFLSFMLTEEENL--THN---------DPVSSVIFLYEIQISKELRKQGL 177

Query: 174 GTKLLSVHLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPT 233
           G   LS  L QC   L+     + L +P  GIELTVF+DN+ AIN Y+ +GM  TP+SP 
Sbjct: 178 GQYFLSNCLFQCAKRLLDNDSLN-LEFPFAGIELTVFADNLPAINLYQKLGMTHTPESPK 236

Query: 234 DEVY-QIEKRQTRNLRRINNAGTREVTKQIIKKPVYYLYYLPI 275
           D +Y Q  +R+TRN R+INN    E  + +IKKP+YY+Y+ PI
Sbjct: 237 DVLYDQNTRRRTRNSRKINNKN--ESPRILIKKPLYYMYWKPI 277

>SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069W NAT4 N alpha-acetyl-transferase involved in
           acetylation of the N-terminal residues of histones H4
           and H2A
          Length = 240

 Score =  170 bits (430), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 109/272 (40%), Positives = 151/272 (55%), Gaps = 39/272 (14%)

Query: 6   SDALLNIVCEEFPTILQSADGVTTWRRRIHHKPSHDEVSIPIEHSSEVYNLSSDPQQRSD 65
           ++ LL  V + FPT +   DG    R+ +      DE S  I  S +V   S D Q  + 
Sbjct: 6   ANVLLPYVLDSFPTSITLKDGSLATRKVL----VIDEPSSGIAPSGQVCTWSGDRQSSNS 61

Query: 66  VLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQEPLLF 125
           +L +FL +LD+NLG+KY  VS T+Y N +SW  NKLEEM + GL+YV Y+  +   PL+F
Sbjct: 62  LLIQFLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYF--QGVSPLMF 119

Query: 126 LSFMLTEGDGFIGTHSXXXXXXXXXXQLMSVIYLYEIQILPQLRGQGIGTKLLSVHLHQC 185
           LSF+LT+   F+                + V+YLYEIQ+LP+++GQ +GT++L V+L   
Sbjct: 120 LSFLLTDEPDFLPDP-------------VKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNT 166

Query: 186 CSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVYQIEKRQTR 245
             SL        L   L GIELTVFSDN  A++ Y SIGM L P SPTDE+   ++R   
Sbjct: 167 VHSL------SRLDPLLKGIELTVFSDNDAALHLYYSIGMALAPGSPTDEIATSQRR--- 217

Query: 246 NLRRINNAGTREVTK--QIIKKPVYYLYYLPI 275
                    TR  T   Q + +P YYL +LP+
Sbjct: 218 ---------TRHSTTDLQTVSRPDYYLMFLPV 240

>Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {ON}
           complement(109063..109941) [879 nt, 293 aa]
          Length = 292

 Score =  155 bits (392), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 105/280 (37%), Positives = 156/280 (55%), Gaps = 20/280 (7%)

Query: 9   LLNIVCEEFPTILQ--SADGVTTWRRRIHHKP--SHDEVSIPIEHSSEVYNLSSDPQQRS 64
           L+++    FP  L+  + +  T+ ++++ H+   + D  +  I+  + V +   D  +  
Sbjct: 7   LVDVAENIFPETLELLNDNSSTSNQKKVLHRQLIAIDSKNNQIDVRNNVLSYYKDNVKCD 66

Query: 65  DVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQEPLL 124
            VLNK L+ILD NLG  Y + S  IY N+K WK NK+ EM S GL+YV Y D+  +EPLL
Sbjct: 67  VVLNKLLDILDNNLGPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIYNDDITKEPLL 126

Query: 125 FLSFMLTEGDGFIGTHSXXXXXXXXXXQLMSVIYLYEIQILPQLRGQGIGTKLLSVHLHQ 184
           F+SFM+T+    +                 +VIYLYEIQ+L  +R Q +GT L++ +L +
Sbjct: 127 FMSFMITDDPSLVVPTDNDSNELSNSTA--AVIYLYEIQLLELIRNQKLGTILITNYLKK 184

Query: 185 CCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVYQIEKRQT 244
               L   Y K+     ++ +ELTVFS+NI AINFYK IGM  TPDSP D++   +KR+T
Sbjct: 185 TIEILNKDYQKN-----IIALELTVFSNNINAINFYKKIGMLYTPDSPRDKIILPQKRRT 239

Query: 245 RN----LRRINNAGTREVTKQIIKKPV-----YYLYYLPI 275
           R+    L   NN  +  +T     K +     YYL +LPI
Sbjct: 240 RSTTIALESKNNEPSSRLTTSKPIKKIIKKPDYYLLFLPI 279

>TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.532
           YMR069W
          Length = 264

 Score =  153 bits (387), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 105/276 (38%), Positives = 151/276 (54%), Gaps = 27/276 (9%)

Query: 9   LLNIVCEEFPTILQSADGVTTWRRRIHHKPSHDEVSIPIEHSSEVYN-----LSSDPQQR 63
            + IV   +P  +     +T   ++I    S  E    I++S+E+YN      S + ++ 
Sbjct: 7   FVKIVDSHYPDEIYVNKNLTKLVKKIIVVDSETE---DIKNSAELYNGRYLTYSQNKEEC 63

Query: 64  SDVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQEPL 123
               +K L ILD NLG  YT  +K +Y N K WK NK++EM + GLIYV Y  E  ++ +
Sbjct: 64  EIEFSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHLEDEKKTV 123

Query: 124 -LFLSFMLTEGDGFIGTHSXXXXXXXXXXQLMSVIYLYEIQILPQLRGQGIGTKLLSVHL 182
            L+LSF LT+  GF+                  VIYLYEIQ+ P++R  G+GTKL++ +L
Sbjct: 124 SLYLSFTLTKESGFLPDIDV----------FSPVIYLYEIQLTPEVRNNGLGTKLIAGYL 173

Query: 183 HQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVYQIEKR 242
             C   +     KD     ++GIELTVFSDN  AI FY++IGMKLTPDSP D+      R
Sbjct: 174 KDCLVDVHENIHKD-----IIGIELTVFSDNTNAIRFYETIGMKLTPDSPNDKTINYGHR 228

Query: 243 -QTRNLRRINNAGTRE--VTKQIIKKPVYYLYYLPI 275
            +TR+        + +   +  ++KKP YYLYYLP+
Sbjct: 229 IKTRSQNSSKKGSSSDKPTSLSVVKKPDYYLYYLPL 264

>TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.532
           YMR069W
          Length = 244

 Score =  147 bits (370), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 88/240 (36%), Positives = 129/240 (53%), Gaps = 30/240 (12%)

Query: 15  EEFPTILQSADGVTTWRRRIHHKPSHDEVSIPIEHSSEVYNLSSDPQQRSDVLNKFLNIL 74
           + FPT + +A G+   R+ +    + D    P+E + +  +    P++   +L + L IL
Sbjct: 15  QNFPTTINAA-GIQLTRKLL----AIDTEEYPVE-TDQCISYVHSPREAEKLLWQLLEIL 68

Query: 75  DVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQ----------EPLL 124
           D NLG KY   S+ +Y N + W+ NK  EML+PGL+YV Y                 PLL
Sbjct: 69  DENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSTAATTTATQRRNAPFSPLL 128

Query: 125 FLSFMLTEGDGFIGTHSXXXXXXXXXXQLMSVIYLYEIQILPQLRGQGIGTKLLSVHLHQ 184
           FLSFMLTE DG +              ++ +V+YLYE+Q+LP++R  G+  +LL  HL Q
Sbjct: 129 FLSFMLTEEDGLVADDP---------TEVWTVLYLYELQLLPRVRRLGLAARLLGDHLAQ 179

Query: 185 CCSSLVTK-YGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSP----TDEVYQI 239
           C   L T+     F      G+ELTVF+DN  AI  Y+S+GM+L  DSP    TD +Y++
Sbjct: 180 CGRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSPTVLDTDSLYRL 239

>KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {ON}
           Anc_2.532 YMR069W
          Length = 271

 Score =  141 bits (355), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 101/284 (35%), Positives = 141/284 (49%), Gaps = 42/284 (14%)

Query: 9   LLNIVCEEFPTILQS--ADGVTTWRRRIHH--------KPSHDEV-SIPIEHSSEVYNLS 57
            L  V  +FPT++         + +RRIH+          SH+++ S P           
Sbjct: 9   FLQTVDRQFPTVIGCDLNGTAVSLKRRIHYIEGVGDDDDESHNKIMSYPGGLPPLPPTTD 68

Query: 58  SDPQQRSD-----VLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYV 112
            +P  + D      L  FL ILD NLG  Y ++S+ IY N K W+ NK  EMLS  L+YV
Sbjct: 69  DNPTAKEDNTCERCLRIFLEILDNNLGPVYARLSRKIYGNSKHWRENKWLEMLSAQLVYV 128

Query: 113 SYWDEKYQEPLLFLSFMLTEGDGFIGTHSXXXXXXXXXXQLMSVIYLYEIQILPQLRGQG 172
           SYW     EP+L+ SFMLTE +G     S              V+YLYEIQ++  +R Q 
Sbjct: 129 SYWVSD-SEPVLYTSFMLTEENGISSIESTD-----------RVVYLYEIQLIEAIRRQK 176

Query: 173 IGTKLLSVHLHQCCSSLVTKYGKDFLPYP-LVGIELTVFSDNIKAINFYKSIGMKLTPDS 231
           +G  ++S +L +C            L  P +  + LTVFSDN KA+ FY+ +    T DS
Sbjct: 177 LGQAIVS-YLTECA-----------LESPEVAAVALTVFSDNEKALKFYERLNFTYTIDS 224

Query: 232 PTDEVYQIEKRQTRNLRRINNAGTREVTKQIIKKPVYYLYYLPI 275
           P DEV +  +R+T     ++ A   +V K  IKKP YYL YL +
Sbjct: 225 PRDEVTEKPRRRTAARTALDPARDSDV-KVTIKKPTYYLLYLEV 267

>Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W
           (REAL)
          Length = 255

 Score =  126 bits (317), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 92/278 (33%), Positives = 132/278 (47%), Gaps = 43/278 (15%)

Query: 9   LLNIVCEEFPTILQ--SADG------VTTWRRRIHHKP-----SHDEVSIPIEHSSEVYN 55
            L I  ++FP  L+  + DG       T  +R +   P     S D + IP        N
Sbjct: 5   FLKICMQDFPETLEYTNTDGNNGTATTTVLKREMLFIPEGDSNSQDNIEIPT-----CVN 59

Query: 56  LSSDPQQRSDVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYW 115
                 + + +L+  + ++D +LGAKY + S+T+Y N K WK+NKL EM SP L+YVSYW
Sbjct: 60  YRLHKSRGNHILDSCVQLIDEHLGAKYRRASRTMYGNRKPWKANKLAEMKSPNLVYVSYW 119

Query: 116 DEKYQEPLLFLSFMLTEGDGFIGTHSXXXXXXXXXXQLMSVIYLYEIQILPQLRGQGIGT 175
           D        F SFMLTE  G +   +            + VIYLYE+ +    RG GIG 
Sbjct: 120 DNGALAA--FASFMLTEETGLVEGDAAHEVS-------VPVIYLYEVHVACVHRGHGIGR 170

Query: 176 KLLSVHLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDE 235
           +LL   L +  +  V    ++F      G+ LTVFSDN +A   Y+++G    P SP   
Sbjct: 171 RLLERALCEGVARHVRCLYEEFF-----GVALTVFSDNTRARRLYEALGFYRAPGSPAAG 225

Query: 236 VYQIEKRQTRNLRRINNAGTREVTKQIIKKPVYYLYYL 273
                 R TR      + G R V   + + P+YY+Y L
Sbjct: 226 A--PTTRPTR------HGGERVV---VPRDPLYYVYCL 252

>YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N
           alpha-acetyl-transferase, involved in acetylation of the
           N-terminal residues of histones H4 and H2A
          Length = 285

 Score =  127 bits (318), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 88/272 (32%), Positives = 125/272 (45%), Gaps = 32/272 (11%)

Query: 9   LLNIVCEEFPTILQSADG-------VTTWRRRIHHKPSHDEVSIPIEHSSEVYNLSSDPQ 61
            LN+  E+FP  ++  D             R I + P  D  SI    S +  N      
Sbjct: 36  FLNLCVEKFPESIEHKDTDGNGNFTTAILEREIIYIPEDDTDSIDSVDSLKCINYKLHKS 95

Query: 62  QRSDVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQE 121
           +   VL+  + ++D +LGAKY + S+ +Y N K WK+NKL EM S GL+YV YWD     
Sbjct: 96  RGDQVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYWDNGVLG 155

Query: 122 PLLFLSFMLTEGDGFIGTHSXXXXXXXXXXQLMSVIYLYEIQILPQLRGQGIGTKLLSVH 181
              F SFMLTE  G +   +            + VIYLYE+ +    RG GIG +LL   
Sbjct: 156 A--FTSFMLTEETGLVEGDALHEVS-------VPVIYLYEVHVASAHRGHGIGRRLLE-- 204

Query: 182 LHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVYQIEK 241
            H  C   V ++ +        G+ LTVFSDN +A   Y+++G    P SP         
Sbjct: 205 -HALCDG-VARHTRRMCD-NFFGVALTVFSDNTRARRLYEALGFYRAPGSPAP------- 254

Query: 242 RQTRNLRRINNAGTREVTKQIIKKPVYYLYYL 273
             +  +R   + G R V   +   P+YY+Y L
Sbjct: 255 -ASPTIRHTRHGGGRVV---VPCDPLYYVYCL 282

>ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl-transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 188

 Score =  116 bits (291), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 95/170 (55%), Gaps = 24/170 (14%)

Query: 66  VLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQEPLLF 125
           +L K L ++++NLG+ Y K +KTIY+N+K W+SNK +EM S  L +VSYW+ +  E + F
Sbjct: 20  ILEKQLQLIEINLGSYYNKYNKTIYKNNKRWQSNKWQEMCSENLFHVSYWNVESNELVCF 79

Query: 126 LSFMLTEGDGFIGTHSXXXXXXXXXXQLMSVIYLYEIQILPQLRGQGIGTKLLSVHLHQC 185
            S M  E     G             ++ ++IYLYEI + P+ R Q  G  +L+    + 
Sbjct: 80  CSIMPCEESIVEG-------------EMSNIIYLYEIHVAPEWRNQKFGKSILNALKEKL 126

Query: 186 CSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDE 235
           C               L GIELTVFS N +AINFY++ G  L+ DSP+D+
Sbjct: 127 CPKA-----------HLSGIELTVFSSNERAINFYRNNGFTLSYDSPSDK 165

>Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W
           (REAL)
          Length = 254

 Score =  108 bits (269), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 110/225 (48%), Gaps = 23/225 (10%)

Query: 9   LLNIVCEEFPTILQ------SADGVTT--WRRRIHHKPSHDEVSIPIEHSSEVYNLSSDP 60
            L+I  +EFP  L+      +A  VTT   +R I + P  +     I+   +  N +   
Sbjct: 5   FLSICIDEFPETLEYTESNENATVVTTTVLKREIMYIPEENGEVDSID-GPQCTNYNLHK 63

Query: 61  QQRSDVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQ 120
                VL+  + ++D +LG KY + S+T+Y N   WK+NKL EM S GL+YVSYW     
Sbjct: 64  SHGDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWGNGAL 123

Query: 121 EPLLFLSFMLTEGDGFIGTHSXXXXXXXXXXQLMSVIYLYEIQILPQLRGQGIGTKLLSV 180
               F SFMLTE  G +   +            + VIYLYEI +    RG G+G +LL  
Sbjct: 124 GA--FASFMLTEETGLVEGDAAHEVS-------VPVIYLYEIHVAHAHRGHGLGRRLLER 174

Query: 181 HLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGM 225
            L +  +  V +   DF      G+ LTVF DN +A   Y++IG 
Sbjct: 175 ALCEGVARRVRRVRCDFF-----GVALTVFGDNTRARRLYEAIGF 214

>TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.532
           YMR069W
          Length = 278

 Score =  107 bits (266), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 87/288 (30%), Positives = 137/288 (47%), Gaps = 36/288 (12%)

Query: 9   LLNIVCEEFPTILQSADGVTTWRRRIHHKPSHDEVSIPIEHSS-----EVYNLSSD---P 60
           L+ +V   FP  + +  G+T   R+I+     +  S+  + ++     E+Y    D   P
Sbjct: 6   LVQLVDNAFPKSISTKQGITL-ERKIYIIGDSENNSLLSDQNNNSNDDEIYWYFKDRKNP 64

Query: 61  QQRSDVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQ 120
              + +  +   ++D NLG  Y K SK IYEND  W  NK EEM +  +IY++YWD K  
Sbjct: 65  TVENIIKTQIFQLIDENLGKLYKKKSKKIYENDLDWSINKREEMFTSNMIYITYWDCKQN 124

Query: 121 EPLLFLSFMLTEGDGFIGTHSXXXXXXXXXXQLMSVIYLYEIQILPQLRGQGIGTKLLSV 180
              LFLS +  E    +  +               V+YLYEI I  + + QGIG +L+  
Sbjct: 125 SVALFLSILSCEETYILENNDQG-----------EVLYLYEIHITKEYQRQGIGERLIKD 173

Query: 181 HLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFY-KSIGMKLTPDSPTDEVYQI 239
           +L      L+     +      +G+ELTVFS+N  A NFY   I M+ T  SP DE+  +
Sbjct: 174 YL---IEKLIKPLKIERQDNNFIGLELTVFSENNDAQNFYFNKIQMQYTFGSPRDEIINV 230

Query: 240 EKRQTRNL-RRIN-----------NAGTREVTKQIIKKPVYYLYYLPI 275
            KR TR+   ++            N   +++ ++ I+KP YY+   P+
Sbjct: 231 MKRITRSFDEKLGEHCEDNKLPSLNDKKKQLYRKSIRKPEYYILVFPV 278

>KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 260

 Score =  103 bits (257), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/234 (31%), Positives = 117/234 (50%), Gaps = 31/234 (13%)

Query: 13  VCEEFPTILQSADGVTTWRRRIHHKPS----HDEVSIPIEHS-------SEVYNLSSDPQ 61
           V + FP +L   +G     R ++  PS    H+E   P           +      S P+
Sbjct: 13  VTQCFPLVLTLPNGQQQLTRAVYGIPSDATQHEERREPRAAGPKPEPGPTPASECDSVPR 72

Query: 62  QRSDVLNKFLNILDVNLGAKYTKVSKTIY-ENDKSWKSNKLEEMLSPGLIYVSYWDEKYQ 120
             +D+L++ L+++  NLG  YT+ ++ IY    +SW + K  EM +PGL+YV Y D  + 
Sbjct: 73  PPADLLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGLVYVVYSD-SHS 131

Query: 121 EPLLFLSFMLTEGDGFIGTHSXXXXXXXXXXQLMSVIYLYEIQILPQLRGQGIGTKLLSV 180
           +PL+F+S +LT+ +  +G                 V+YL+EI +   +RGQG+GT LL  
Sbjct: 132 QPLVFMSLLLTD-EPELGQELAAR-----------VLYLFEIHVSDIIRGQGLGTHLLRD 179

Query: 181 HLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTD 234
            L    +SL            ++G ELTVFS+N +A+  Y ++GM +   SP D
Sbjct: 180 CLGGTLASLSRASPS------VLGAELTVFSENQRALRLYLALGMHVAAWSPQD 227

>Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)
           [771 bp, 257 aa] {ON} YMR069W (REAL)
          Length = 257

 Score = 90.5 bits (223), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 108/224 (48%), Gaps = 24/224 (10%)

Query: 9   LLNIVCEEFPTIL-------QSADGVTTWRRRIHHKPSHDEVSIPIEHSSEVYNLSSDPQ 61
            L+I  EEFP  L       ++ D  TT  RR       D+       + E  N      
Sbjct: 5   FLSICMEEFPQTLDYTGSDDENGDSTTTLLRRQMMYMPEDDGDDGGIDTPECMNYKLHKA 64

Query: 62  QRSDVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYW--DEKY 119
                L+  + ++D +LGAKY + S+T+Y N   WK+NKL EM S GL+YV YW  D + 
Sbjct: 65  DGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGNDAQG 124

Query: 120 QEPL-LFLSFMLTEGDGFIGTHSXXXXXXXXXXQLMSVIYLYEIQILPQLRGQGIGTKLL 178
           +  L  F SFMLTE  G +   +          Q + VIYLYE+    +   +G+G +LL
Sbjct: 125 ERALGAFASFMLTEETGLVEGDT-------AHEQSVPVIYLYEVHXXHRG--RGLGRRLL 175

Query: 179 SVHLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKS 222
           +  L +  ++ V +   D     L G+ LTVF DN +A   Y+S
Sbjct: 176 AKALCEGVAARVRRTCDD-----LFGVALTVFGDNTRARRLYES 214

>Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W -
           Hypothetical ORF [contig 55] FULL
          Length = 240

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 76/278 (27%), Positives = 120/278 (43%), Gaps = 55/278 (19%)

Query: 6   SDALLNIVCEEFPTILQSADGVTTWRRRIHHKPSHDEVSIPIEHSSEVYNLSSDP-QQRS 64
           +D L+  V + FPT L  A G     +RI                  VY +  D  + R+
Sbjct: 6   ADYLVPHVTDSFPTTLTLASG-----QRIQRA---------------VYGVPMDTVRSRA 45

Query: 65  DV-----LNKFLNILDVNLGAKYTKVSKTIYEND-KSWKSNKLEEMLSPGLIYVSYW--D 116
           ++     L + L ++D NLG  Y + +K +Y +   SWK  K +EM++PGL+YV Y   D
Sbjct: 46  EIPDPCLLEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVD 105

Query: 117 EKYQEPLLFLSFMLTEGDGFIGTHSXXXXXXXXXXQLMSVIYLYEIQILPQLRGQGIGTK 176
           E+  +          EG                     +V+YL EI +   +RG      
Sbjct: 106 EETGK----------EGLPLAFLSLLLTDEPELGPAPAAVVYLMEIHVADIIRG----LG 151

Query: 177 LLSVHLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEV 236
           L    L +  +  V +  +   P+ + G ELTVF+DN  A+  Y  +GM++   SP D  
Sbjct: 152 LGGTLLREGVAGTV-RGARRAHPF-IQGTELTVFTDNEGALRLYLRLGMQIAAWSPQDTC 209

Query: 237 YQIEKRQTRNLRRINNAGTREVTKQIIKKPVYYLYYLP 274
            ++ +R      R     +R+VT     +P YYL + P
Sbjct: 210 IEVHRRT-----RATRYESRKVT-----RPTYYLLFWP 237

>KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa]
           {ON} no similarity
          Length = 215

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 77/180 (42%), Gaps = 28/180 (15%)

Query: 57  SSDPQQRSDVLNKFLNILDVNLGAKYTKVSKTIY---ENDKS-----WKSNKLEEMLSPG 108
           S DP      L K L I+  NL   Y     +IY   ++DK      W   K +EML   
Sbjct: 39  SGDPNYLGSTLPKCLAIIKQNLSTFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKD 98

Query: 109 LIYVSYWDEKYQEPLLFLSFMLTEGDGFIGTHSXXXXXXXXXXQLMSVIYLYEIQILPQL 168
           L+Y+  +     + + F S  L++       HS               ++LYEI ++ + 
Sbjct: 99  LVYIVLFKRDTTKIVGFTSVALSDPLNPELDHSKLNR---------PCLFLYEIHLMGEY 149

Query: 169 RGQGIGTKLLSVHLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLT 228
           + +G+G+ + +         L+    +D L  P   IEL VF+ N  A  +YK +G +LT
Sbjct: 150 QSRGLGSLIFN--------GLLIPLARD-LTCP--SIELCVFTANDVACRWYKRLGFQLT 198

>Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON}
           similar to Saccharomyces cerevisiae YMR069W
          Length = 243

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 75/187 (40%), Gaps = 30/187 (16%)

Query: 63  RSDVLNKFLNILDVNLGAKYTKVSKTIYEN---DKSWKSNKLEEMLSPGLIYVSYWDEKY 119
           R     +   I++  LG  Y   +  +Y      + W+++K  E+   G  +V Y  E  
Sbjct: 43  RQKFAKQLTAIIERTLGCFYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLYRKENP 102

Query: 120 QEPLL-FLSFMLTE------GDGFIGTHSXXXXXXXXXXQL-------------MSVIYL 159
              +  F+S +  +      G+G     S          +                V+Y+
Sbjct: 103 GGAIAGFVSLLFCDEPHWPAGNGSRAAASTAERERGPSGRSAEPAFEETPPPPPCKVVYV 162

Query: 160 YEIQILPQLRGQGIGTKLLSVHLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINF 219
            EI + P  + QG+G+ +L       C+  + ++ +   P  L G+ELTVF+ N +A+  
Sbjct: 163 MEIHVSPSFQNQGLGSCML------LCARQLVQHMQPSFPQ-LKGLELTVFTGNRQALAL 215

Query: 220 YKSIGMK 226
           Y+  G K
Sbjct: 216 YRRQGFK 222

>KLLA0A12089g Chr1 (1052066..1052611) [546 bp, 181 aa] {ON} similar
           to uniprot|Q5WCY3 Bacillus clausii ABC3243 paiA
           Septation and degradation transcriptional repressor of
           sporulation
          Length = 181

 Score = 36.2 bits (82), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 53/131 (40%), Gaps = 20/131 (15%)

Query: 101 LEEMLSPGLIYVSYWDEKYQEPLLFLSFMLTEGDGFIGTHSXXXXXXXXXXQLMSVIYLY 160
            EE  +  ++     DE     LLF      E   FI  +           + + +  +Y
Sbjct: 50  FEESFNDAVLKKEILDEHSHICLLFFD---NEAAAFIKVNDHKSQTEDMGTEYVELQRIY 106

Query: 161 EIQILPQLRGQGIGTKLLS-VHLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINF 219
              IL + +G+G+G  L+  VH       +   YGK         I L V+  N KAI+F
Sbjct: 107 ---ILQKYQGKGLGRVLMDKVH------DIAQSYGKK-------KIWLGVWEHNQKAIDF 150

Query: 220 YKSIGMKLTPD 230
           YK  G ++T D
Sbjct: 151 YKKFGFEITGD 161

>Kwal_26.8877 s26 (987655..988143) [489 bp, 162 aa] {ON} YOR253W
           (ARD2) -  [contig 68] FULL
          Length = 162

 Score = 32.7 bits (73), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 12/74 (16%)

Query: 157 IYLYEIQILPQLRGQGIGTKLLSVHLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKA 216
           +Y+  + +L   RG+GIG++LL     QC         K    + L    + V +DN KA
Sbjct: 79  VYVQILAVLENYRGKGIGSQLLLFVEEQC---------KKHFQHNLY---VHVATDNEKA 126

Query: 217 INFYKSIGMKLTPD 230
           +++Y+  G K+  D
Sbjct: 127 LSWYQKKGFKVEGD 140

>NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON}
           Anc_3.183 YDL017W
          Length = 606

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 14/58 (24%)

Query: 199 PYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVYQIEKRQTRNLRRINNAGTR 256
           P P+V I+      N K +N     GM LT   P        K +TR ++R N AGTR
Sbjct: 325 PTPMVTIQ------NGKVVNLNNVNGMDLTKGYP--------KNETRRMKRANRAGTR 368

>ZYRO0D10912g Chr4 (921315..921809) [495 bp, 164 aa] {ON} similar to
           uniprot|Q08689 Saccharomyces cerevisiae YOR253W NAT5
           Subunit of the N-terminal acetyltransferase NatA (Nat1p
           Ard1p Nat5p) N-terminally acetylates many proteins which
           influences multiple processes such as the cell cycle
           heat-shock resistance mating sporulation and telomeric
           silencing
          Length = 164

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 35/78 (44%), Gaps = 12/78 (15%)

Query: 157 IYLYEIQILPQLRGQGIGTKLLSVHLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKA 216
           +Y+  + +L    G+GIGTKLL           V    K    + L    + V SDN++A
Sbjct: 81  MYIEVLAVLEHYSGKGIGTKLL---------EYVESEAKKHYQHALY---VHVASDNVRA 128

Query: 217 INFYKSIGMKLTPDSPTD 234
           I +YK  G +   D   D
Sbjct: 129 ITWYKKRGFEQDGDVLLD 146

>AAL102C Chr1 complement(163467..163946) [480 bp, 159 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR253W
          Length = 159

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 12/76 (15%)

Query: 155 SVIYLYEIQILPQLRGQGIGTKLLSVHLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNI 214
           S + +  + +L   RG+G+GTKLL           V K  K F P     I +TV +   
Sbjct: 76  SAVVIDTLAVLEAYRGKGVGTKLL---------DYVEKETKPFQPRA---IYVTVAASAT 123

Query: 215 KAINFYKSIGMKLTPD 230
             + +Y+S G +L  D
Sbjct: 124 GELQWYQSHGFELLGD 139

>KLTH0G04818g Chr7 (383522..385360) [1839 bp, 612 aa] {ON} similar
           to uniprot|Q04121 Saccharomyces cerevisiae YDR456W NHX1
           Endosomal Na+/H+ exchanger
          Length = 612

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 10/71 (14%)

Query: 38  PSHDEVSIPIEHSSEVYNLSSDPQQRSDVLNKFLNILDVNLGAKYTKVS-KTIYENDKSW 96
           PS + +S+PI  ++    LSSD  Q S           V+L  ++ + +  TI+  D  W
Sbjct: 525 PSVEPISVPISTATATNPLSSDTVQSSS---------RVSLDKQHLRETLSTIFSADSQW 575

Query: 97  KSNKLEEMLSP 107
            +N  E++L P
Sbjct: 576 FTNFDEQVLKP 586

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 197 FLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVYQIEKRQTRNLRRINNAGTR 256
           F PY L+G+ L+     IK+   Y+ + +K  PD  + ++ +IE+        + N   +
Sbjct: 110 FDPYELLGVTLSSTDKEIKSA--YRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYK 167

Query: 257 EVTKQIIKK 265
            +T +I K+
Sbjct: 168 ALTDEITKE 176

>Kpol_529.12 s529 (24687..28028) [3342 bp, 1113 aa] {ON}
           (24687..28028) [3342 nt, 1114 aa]
          Length = 1113

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 6/53 (11%)

Query: 60  PQQRSDVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYV 112
           PQ +S + N+  N      G K T  S T  + D++W SN   E  SP  IY+
Sbjct: 410 PQTKSPIFNEEKN------GVKNTDSSPTPRDRDQNWISNSFYESASPDKIYL 456

>SAKL0H06006g Chr8 complement(532245..532754) [510 bp, 169 aa] {ON}
           similar to uniprot|Q08689 Saccharomyces cerevisiae
           YOR253W NAT5 Subunit of the N-terminal acetyltransferase
           NatA (Nat1p Ard1p Nat5p) N-terminally acetylates many
           proteins which influences multiple processes such as the
           cell cycle heat-shock resistance mating sporulation and
           telomeric silencing
          Length = 169

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 12/73 (16%)

Query: 153 LMSVIYLYEIQILPQLRGQGIGTKLLSVHLHQCCSSLVTKYGKDFLPYPLVGIELTVFSD 212
           L + +Y+  + +L   R +GIG+KLL     QC         KD   +    I + V +D
Sbjct: 82  LPAGVYIEVLAVLSAYRDKGIGSKLLEFIEQQC---------KDHFQHD---IYVHVATD 129

Query: 213 NIKAINFYKSIGM 225
           N  A+ +YK  G 
Sbjct: 130 NSVALEWYKKKGF 142

>TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.183
           YDL017W
          Length = 489

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 36/96 (37%), Gaps = 14/96 (14%)

Query: 161 EIQILPQLRGQGIGTKLLSVHLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFY 220
           E   L  L  QG  +     H  Q C  L  K        P++ I       N K I+  
Sbjct: 190 EYNDLKSLEDQGSYSVTERRHQEQFCPCLTDKQHSHTSNMPMLTIH------NGKLIHLN 243

Query: 221 KSIGMKLTPDSPTDEVYQIEKRQTRNLRRINNAGTR 256
              G+ LT   P        K +TR ++R N AGTR
Sbjct: 244 NVSGVDLTKGYP--------KNETRRIKRANRAGTR 271

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 36/76 (47%), Gaps = 4/76 (5%)

Query: 197 FLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVYQIEKRQTRNLRRINNAGTR 256
           F PY L+G+ +T     IK+   Y+ + +K  PD    ++ + EK     +    +    
Sbjct: 119 FDPYDLLGVSVTASDKEIKSA--YRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAYE 176

Query: 257 EVTKQIIKKPVYYLYY 272
            +T +++K+   YL Y
Sbjct: 177 ALTDELVKQ--NYLMY 190

>KLTH0B03564g Chr2 (287100..288245) [1146 bp, 381 aa] {ON} similar
           to uniprot|P48362 Saccharomyces cerevisiae YGR187C
          Length = 381

 Score = 29.6 bits (65), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 48/91 (52%), Gaps = 9/91 (9%)

Query: 161 EIQILPQLRGQGIGTKLLSVHLHQCCSSLVTKYGKDFLP----YPLV-GIELTVFSDNIK 215
           E+Q+LP+ + +    +++ VHL        TK G+++L     YPLV  +E  V +++I 
Sbjct: 271 ELQLLPEDKQRDPIPEIICVHLESILLLCTTKKGREYLRSKSVYPLVRELEKNVENNDIS 330

Query: 216 AINFYKSIGMKLTPDSPTDEVYQIEKRQTRN 246
            +   + + M +  +  TD   QIE+  TRN
Sbjct: 331 EL-CDRIVNMLMRGEIGTD---QIEEMPTRN 357

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,650,313
Number of extensions: 1279319
Number of successful extensions: 4037
Number of sequences better than 10.0: 46
Number of HSP's gapped: 4081
Number of HSP's successfully gapped: 46
Length of query: 277
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 169
Effective length of database: 41,097,471
Effective search space: 6945472599
Effective search space used: 6945472599
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)