Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0I022606.18ON96796750830.0
NCAS0D026506.18ON95095330540.0
TDEL0G045106.18ON96996628110.0
ZYRO0C07854g6.18ON94495927480.0
KAFR0A050506.18ON94895926780.0
Suva_15.1806.18ON94896725870.0
Smik_15.1746.18ON94596225590.0
KNAG0F028706.18ON95496025540.0
YOR005C (DNL4)6.18ON94495825250.0
Kpol_1032.76.18ON96595725030.0
Skud_15.1666.18ON94796025000.0
CAGL0E02695g6.18ON94695524770.0
TPHA0M002606.18ON96697424140.0
TBLA0G010406.18ON97297723870.0
Kwal_56.224146.18ON96395823490.0
KLTH0C11286g6.18ON95198122610.0
ACR008W6.18ON98197320250.0
KLLA0D01089g6.18ON90795619570.0
SAKL0F10912g7.343ON6932762593e-22
Kwal_56.246167.343ON7154472542e-21
CAGL0I03410g7.343ON7242702496e-21
TPHA0D045707.343ON7362542462e-20
Kpol_2001.717.343ON7264282424e-20
NDAI0A019407.343ON7652702381e-19
KLTH0H01408g7.343ON7234162362e-19
KLLA0D12496g7.343ON7004612326e-19
ACL155W7.343ON6973042301e-18
ZYRO0F11572g7.343ON7312712263e-18
TBLA0E020507.343ON7203942255e-18
Suva_4.827.343ON7552692202e-17
Skud_4.937.343ON7552692193e-17
Smik_4.747.343ON8452742158e-17
YDL164C (CDC9)7.343ON7552692141e-16
TDEL0C020407.343ON7052752141e-16
NCAS0A141107.343ON7532792042e-15
KNAG0C037407.343ON7272101971e-14
KAFR0B008307.343ON7102761933e-14
CAGL0D06050g1.495ON52483830.32
ZYRO0G15180g1.276ON68838830.35
KAFR0K016603.447ON59296800.71
Kpol_367.97.46ON880272800.88
TDEL0D014401.276ON60359791.0
Kwal_56.241136.228ON469104791.0
CAGL0G07843g3.447ON598113762.2
Skud_10.1241.276ON76535762.8
SAKL0G05236g5.541ON986111753.0
CAGL0K04917g2.29ON687147743.8
YGL216W (KIP3)3.528ON80572744.8
CAGL0K07458g2.446ON70482735.0
Ecym_21886.228ON461104727.3
KAFR0C051907.46ON89670718.8
KLTH0E11418g8.491ON69342718.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0I02260
         (967 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...  1962   0.0  
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...  1181   0.0  
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...  1087   0.0  
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...  1063   0.0  
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...  1036   0.0  
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...  1001   0.0  
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   990   0.0  
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...   988   0.0  
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...   977   0.0  
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...   968   0.0  
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...   967   0.0  
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...   958   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   934   0.0  
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   924   0.0  
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...   909   0.0  
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...   875   0.0  
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   784   0.0  
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...   758   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   104   3e-22
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   102   2e-21
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   100   6e-21
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...    99   2e-20
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...    98   4e-20
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...    96   1e-19
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...    96   2e-19
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...    94   6e-19
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...    93   1e-18
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...    92   3e-18
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...    91   5e-18
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...    89   2e-17
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...    89   3e-17
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...    87   8e-17
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...    87   1e-16
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...    87   1e-16
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...    83   2e-15
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...    80   1e-14
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...    79   3e-14
CAGL0D06050g Chr4 (573888..575462) [1575 bp, 524 aa] {ON} simila...    37   0.32 
ZYRO0G15180g Chr7 (1223984..1226050) [2067 bp, 688 aa] {ON} simi...    37   0.35 
KAFR0K01660 Chr11 (347950..349728) [1779 bp, 592 aa] {ON} Anc_3....    35   0.71 
Kpol_367.9 s367 complement(31451..34093) [2643 bp, 880 aa] {ON} ...    35   0.88 
TDEL0D01440 Chr4 complement(282138..283949) [1812 bp, 603 aa] {O...    35   1.0  
Kwal_56.24113 s56 complement(855380..856789) [1410 bp, 469 aa] {...    35   1.0  
CAGL0G07843g Chr7 (744599..746395) [1797 bp, 598 aa] {ON} highly...    34   2.2  
Skud_10.124 Chr10 complement(230827..233124) [2298 bp, 765 aa] {...    34   2.8  
SAKL0G05236g Chr7 complement(429654..432614) [2961 bp, 986 aa] {...    33   3.0  
CAGL0K04917g Chr11 complement(477054..479117) [2064 bp, 687 aa] ...    33   3.8  
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...    33   4.8  
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    33   5.0  
Ecym_2188 Chr2 (371869..373254) [1386 bp, 461 aa] {ON} similar t...    32   7.3  
KAFR0C05190 Chr3 (1031636..1034326) [2691 bp, 896 aa] {ON} Anc_7...    32   8.8  
KLTH0E11418g Chr5 complement(1020231..1022312) [2082 bp, 693 aa]...    32   8.9  

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score = 1962 bits (5083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 954/967 (98%), Positives = 954/967 (98%)

Query: 1   MDGKAVTPTLDNDTRPATPHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINV 60
           MDGKAVTPTLDNDTRPATPHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINV
Sbjct: 1   MDGKAVTPTLDNDTRPATPHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINV 60

Query: 61  QYYEVIQHFINLWRKTVGNDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFT 120
           QYYEVIQHFINLWRKTVGNDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFT
Sbjct: 61  QYYEVIQHFINLWRKTVGNDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFT 120

Query: 121 EKRLLSWKQRAGRSVRLSSFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKG 180
           EKRLLSWKQRAGRSVRLSSFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKG
Sbjct: 121 EKRLLSWKQRAGRSVRLSSFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKG 180

Query: 181 SMGYRGLSDSPTFVFCLENMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVV 240
           SMGYRGLSDSPTFVFCLENMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVV
Sbjct: 181 SMGYRGLSDSPTFVFCLENMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVV 240

Query: 241 SDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMD 300
           SDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMD
Sbjct: 241 SDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMD 300

Query: 301 GERIQLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTF 360
           GERIQLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTF
Sbjct: 301 GERIQLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTF 360

Query: 361 DKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYL 420
           DKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYL
Sbjct: 361 DKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYL 420

Query: 421 EKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIK 480
           EKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIK
Sbjct: 421 EKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIK 480

Query: 481 VKPEYLEQFGENMDLIVIGKDPGKKDSLMCGLAVVXXXXXXXXXXXXXIVNLDSQDSIGE 540
           VKPEYLEQFGENMDLIVIGKDPGKKDSLMCGLAVV             IVNLDSQDSIGE
Sbjct: 481 VKPEYLEQFGENMDLIVIGKDPGKKDSLMCGLAVVEEDEPEIDEDGNEIVNLDSQDSIGE 540

Query: 541 GEDKEGNEIEREKTIKRFVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFG 600
           GEDKEGNEIEREKTIKRFVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFG
Sbjct: 541 GEDKEGNEIEREKTIKRFVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFG 600

Query: 601 SRVPAEWIDPKDSIVIEVKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLS 660
           SRVPAEWIDPKDSIVIEVKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLS
Sbjct: 601 SRVPAEWIDPKDSIVIEVKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLS 660

Query: 661 ELRRMKRFKLGSNKRANNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLY 720
           ELRRMKRFKLGSNKRANNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLY
Sbjct: 661 ELRRMKRFKLGSNKRANNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLY 720

Query: 721 FYVISDVVDATGSRVSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLI 780
           FYVISDVVDATGSRVSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLI
Sbjct: 721 FYVISDVVDATGSRVSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLI 780

Query: 781 DRGYDIIEPQWVLDCIKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSF 840
           DRGYDIIEPQWVLDCIKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSF
Sbjct: 781 DRGYDIIEPQWVLDCIKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSF 840

Query: 841 SRLIERNVRSLRNAPPSIQYDMVDTVPLFLFYGRTILLRIKDKALFTKLKVQIRLYGGKT 900
           SRLIERNVRSLRNAPPSIQYDMVDTVPLFLFYGRTILLRIKDKALFTKLKVQIRLYGGKT
Sbjct: 841 SRLIERNVRSLRNAPPSIQYDMVDTVPLFLFYGRTILLRIKDKALFTKLKVQIRLYGGKT 900

Query: 901 TGDLASCNLVVIQQNEIAVAKDVRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVP 960
           TGDLASCNLVVIQQNEIAVAKDVRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVP
Sbjct: 901 TGDLASCNLVVIQQNEIAVAKDVRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVP 960

Query: 961 EEDHPVV 967
           EEDHPVV
Sbjct: 961 EEDHPVV 967

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score = 1181 bits (3054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/953 (60%), Positives = 715/953 (75%), Gaps = 21/953 (2%)

Query: 18  TPHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFINLWRKTV 77
           TP NF+PSP+F+WLCDELFVKLE IQ   + +  K   KP+ V+YYEVI HFI LWRKTV
Sbjct: 16  TPCNFSPSPAFQWLCDELFVKLEDIQ---SKRDPKNIGKPVTVRYYEVINHFIALWRKTV 72

Query: 78  GNDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRL 137
           GNDI+PALILILPYRDRR++N+RDYTLIKAIC+YLKLP+NSFTEKRLLSWK RAG+ V+L
Sbjct: 73  GNDIFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKL 132

Query: 138 SSFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVFCL 197
           S F V+EIKKRKSEP+   + EITID+LN+CLD L+EERNSKG  G++ L+DSPTF FCL
Sbjct: 133 SQFCVNEIKKRKSEPK--DKIEITIDRLNECLDKLAEERNSKGR-GFKKLADSPTFKFCL 189

Query: 198 ENMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHL 257
           ENM+F+ELQFFFDI+LK+RVIGG EHKFLN WHPDAQDYLSVVSDL+TV  +LWDP + L
Sbjct: 190 ENMSFIELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRL 249

Query: 258 KNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSF 317
           +N+DL IN G  FAPQ AKKLSISYEKIC KLK+DF IEEKMDGERIQLHYQDYG KL F
Sbjct: 250 QNNDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKF 309

Query: 318 LSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSA 377
            SRRGTDYTYLYGESI DG + K+L L+ +V++C+LDGEM+T+DK +N +LPFGLVKSSA
Sbjct: 310 FSRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSA 369

Query: 378 RSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSK 437
           RS++T++G+ NEGY+PL MVFDL+++NG SL NIPL  RK YL  IFTPE HI+ELL S 
Sbjct: 370 RSMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSY 429

Query: 438 RCSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIV 497
              +E SI+ +LE AIS+GSEG+VLK Y+SRYTVASRNDDWIKVKPEYLEQFGENMDLIV
Sbjct: 430 HRFNEDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIV 489

Query: 498 IGKDPGKKDSLMCGLAVVXXXXXXXXXXXXXIVNLDSQDSIGEGEDKEGNEIEREKTIKR 557
           IG+DPGKKDSLMCGLAVV              +N ++ D++   +D E   +E+E+TI +
Sbjct: 490 IGRDPGKKDSLMCGLAVVEEDEKAD-------LNENNDDNVIILDDDEDAPVEQERTIHK 542

Query: 558 FVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSIVIE 617
           FVSFC IANG+SQEEFK I R T+G W +SDEIPPP  LL+FG+R+P EWIDPK S+VIE
Sbjct: 543 FVSFCVIANGLSQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIE 602

Query: 618 VKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSNKRAN 677
           VKARS++  E   +KF TG TLYGGYCR IREDKDW+TCYTLSE  R K  K  S +  +
Sbjct: 603 VKARSIDAAESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVK--SRRNGS 660

Query: 678 NDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISDVV-DATGSRVS 736
           +   H +   KR+K  R  Y  ++  E+    L  +  F  LYFYVISDV  D  G+R+ 
Sbjct: 661 DQVIHGV---KRQKKNRRKYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIE 717

Query: 737 REELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVLDCI 796
           +E +Y  I   GG ++HN+I+K  G    RI+ GK T EC +LI+RGYD+I PQW++DC+
Sbjct: 718 KERMYKYIQEGGGTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCV 777

Query: 797 KDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIERNVRSLRNAPP 856
           +   LLKLEPKYCFNVS EL K+ ++RVD FGDS+E  I+E+  S L+E  +  +R    
Sbjct: 778 QSKSLLKLEPKYCFNVSTELKKLTEKRVDTFGDSYEVPITEEQLSTLLETELNLVRVQGL 837

Query: 857 SIQY--DMVDTVPLFLFYGRTILLRIKDKALFTKLKVQIRLYGGKTTGDLASCNLVVIQQ 914
              Y  + +  +PLFLF  R +L    +    + L+ +I+LYGGK T D+  CNL+++  
Sbjct: 838 VTPYADEELIKIPLFLFQDRIMLFPNTESKTISFLQEKIKLYGGKLTTDIGKCNLIILPN 897

Query: 915 NEIAVAKDVRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVPEEDHPVV 967
               + +  R  L K   ++ + P +PYIV P WI+ SI E  QVPEED+PV+
Sbjct: 898 GNQQLLQRTRDLLTKNIMNSGEVPTIPYIVNPLWIERSIEENSQVPEEDYPVI 950

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score = 1087 bits (2811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/966 (55%), Positives = 696/966 (72%), Gaps = 34/966 (3%)

Query: 11  DNDTRPATPHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFI 70
           ++++    P NFAPSP F WLC+ELFVKLE +Q+           KP++V+YYEVI HFI
Sbjct: 19  ESESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLG---NKPLSVRYYEVISHFI 75

Query: 71  NLWRKTVGNDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQR 130
            LWRKTVGN+I+PAL+L LPYRDRRIYN++DYTL+KAICSYL LPK S TEKRLL WK+R
Sbjct: 76  RLWRKTVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRR 135

Query: 131 AGRSVRLSSFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDS 190
           A R VRLS+F V EI+KRKSEP  G R  ITIDKLN+CLD L EERN+KG  G++GLSDS
Sbjct: 136 ATRGVRLSNFCVEEIRKRKSEPSPGRR--ITIDKLNECLDHLVEERNAKG--GFKGLSDS 191

Query: 191 PTFVFCLENMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKL 250
           PTF FCL+NM+F+EL+FFFDI+LK+RVIGG EHK LN WHPDA DYLSVVSDL+TVA++L
Sbjct: 192 PTFNFCLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRL 251

Query: 251 WDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQD 310
           WDP   L+ DDL+IN+G  F PQ AKK++ISYEKIC KL +DF IEEKMDGERIQ+HY D
Sbjct: 252 WDPEHRLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMD 311

Query: 311 YGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPF 370
           YG K+ FLSRRG DYT LYGE+++ GTV+ YL+ D+NV++CVLDGEM+TFD +RN +LPF
Sbjct: 312 YGAKIRFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPF 371

Query: 371 GLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHI 430
           G+VKSSAR  ++ EG+ ++G+RP+LMV DLVYLNGVSL+ +PLYQRK +L ++  P  H 
Sbjct: 372 GMVKSSARQALSTEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHA 431

Query: 431 VELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFG 490
           VE+L   RCS+  +I+ +LE +IS+GSEG+VLK Y +RY + +RND WIKVKPEYLEQFG
Sbjct: 432 VEILPYVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFG 491

Query: 491 ENMDLIVIGKDPGKKDSLMCGLAVVXXXX---XXXXXXXXXIVNLDSQDSIGEGEDKEGN 547
           EN+DL++IG+ PGKKDSLMCGLAV                 IVNLDS       E  E +
Sbjct: 492 ENLDLVIIGRTPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDS-------EGDELD 544

Query: 548 EIEREKTIKRFVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEW 607
           + + +K IK F+SFC IANGISQ+EFK I R T+G W KSD+  P +DLL FGS++P EW
Sbjct: 545 DTDGKKIIKYFISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEW 604

Query: 608 IDPKDSIVIEVKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKR 667
           IDPK+SI++EVKARSL+N E + KKF  G TL+GGYCR+IR+DKDW  CY+ SEL + + 
Sbjct: 605 IDPKNSIMLEVKARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERL 664

Query: 668 FKLGSNKRANNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISDV 727
            K  +   + N          + K R+ID  F     +     D + IF GL FYV+SD 
Sbjct: 665 HKSSTGVGSFNKQYSK---KMKSKKRKID-PFSGQAAKKHDVFDSTNIFKGLQFYVLSDY 720

Query: 728 VDATGS-RVSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDI 786
           +D + + R+++ E  D IL   G +V N+I+KHH E+QFRI+ GKYTAEC++LI+RGYDI
Sbjct: 721 IDVSRNVRITKSEFDDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDI 780

Query: 787 IEPQWVLDCIKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIER 846
           + PQW+LDCI++ M++KLEP++CFNVS ELM I   RVD +GDSF   I+E     LI+ 
Sbjct: 781 LSPQWILDCIRNRMVVKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDT 840

Query: 847 NVRSLRNAPPSIQYDM---VDTVPLFLFYGRTILL--RIKDKALFTKLKVQIRLYGGKTT 901
           N   ++   P++  +    +D VPLFLF  R + +  ++ +      L  + +L+GG   
Sbjct: 841 N---MKQTEPNLMREANSELDVVPLFLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIA 897

Query: 902 GDLASCNLVVIQQNEIAVAK----DVRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGC 957
            D+ SCNL+++      +      ++R S+L+     D  P +PYIVTP+W++ SI E C
Sbjct: 898 SDIPSCNLIIMPNENQRLGTQSLVEMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENC 957

Query: 958 QVPEED 963
           QVPEED
Sbjct: 958 QVPEED 963

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score = 1063 bits (2748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/959 (54%), Positives = 692/959 (72%), Gaps = 35/959 (3%)

Query: 19  PHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFINLWRKTVG 78
           PHNFAPSP F+WLCDELFVK++ +Q+ +    +    K + V+Y+E+I  F+ LWRKTVG
Sbjct: 11  PHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGA---FKSLTVKYFEIISFFVKLWRKTVG 67

Query: 79  NDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRLS 138
           ++IYPALILILPYRDRRI+N++DYTLIKAICS+L+LP NS TEKRLL WK+RAGR ++LS
Sbjct: 68  DNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGIKLS 127

Query: 139 SFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVFCLE 198
            F V EI++R+SEP  G R  ITIDKLN+CLD L+EERN+KG  G++ L+DS  F +CLE
Sbjct: 128 DFCVEEIRRRRSEPLNGER--ITIDKLNECLDQLAEERNTKGR-GFKSLADSSVFKYCLE 184

Query: 199 NMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLK 258
           NM+F E++++FDIILKSRVIGG EHKFLN WHPDA+DYLSVVSDLKTVA+KLWDP+  LK
Sbjct: 185 NMSFTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRLK 244

Query: 259 NDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFL 318
           NDDL +N+G PFAP  AK+L ISY+K+  +LK DF+IEEKMDGERIQLHY DYG KL + 
Sbjct: 245 NDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWF 304

Query: 319 SRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSAR 378
           SRRG DYTYLYGE I  GTV+KYL LD  V+ CVLDGEM++FD E N++LPFGLVKSSAR
Sbjct: 305 SRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSAR 364

Query: 379 SIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKR 438
             +T EG+  +GYRPL MV D +YLNGVSL+N+PL  RK YL  I  P  H VE+++S  
Sbjct: 365 DSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMH 424

Query: 439 CSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 498
           C D+ SIK++LE AI +GSEG++LKH+ S+Y + +R D+WIK+KPEYLEQFGEN+DL+VI
Sbjct: 425 CYDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLVI 484

Query: 499 GKDPGKKDSLMCGLAVVXXXXXXXXXXXXXIVNLDSQDSIGEGEDKEGNEIEREKTIKRF 558
           G+DPGKKDSLMCGLAV+             +VNLDS++           E E  K +K+F
Sbjct: 485 GRDPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEE-----------EEEPRKAVKKF 533

Query: 559 VSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSIVIEV 618
           +SFC+IANGISQEEFK I R T G WK +++  PP  +LEFGS++P EWI P+DS+V+EV
Sbjct: 534 ISFCTIANGISQEEFKQIERKTAGKWKNTEDHKPPK-ILEFGSKLPEEWIYPEDSVVLEV 592

Query: 619 KARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSNKRANN 678
           KARSL+N E + +KFK G TL+GGYCR+IREDK+W  CYTL EL + +R K+  ++ +NN
Sbjct: 593 KARSLDNTESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNN 652

Query: 679 DATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSR---IFDGLYFYVISDVVDATGS-R 734
                + S K R+ R +         QT +  D+++   IFDGL FYVISD + +  S R
Sbjct: 653 --QKPMKSKKIRRPRIV-----SRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSER 705

Query: 735 VSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVLD 794
           +S+E+L D I   GG +  NVI+ H  +   RI+ GKYT EC++LI+RGYDI+ PQW++D
Sbjct: 706 ISKEQLCDLISGNGGKLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMD 765

Query: 795 CIKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIERNVRSLRNA 854
           C+    L+ +EP++CF+VSE++ KIA+ RVD FGDS++ +I+ED    ++         +
Sbjct: 766 CVNTGFLVTIEPRHCFSVSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFS 825

Query: 855 PPSIQY-DMVDTVPLFLFYGRTILLRIKDKALFTK-LKVQIRLYGGKTTGDLASCNLVVI 912
             S+     V+ +PLFLF  R + +      L T+ LK ++RLYGG+ T ++  CNL+++
Sbjct: 826 TGSLDVISDVEDIPLFLFSRRIVFIPEGFSYLDTQLLKHKVRLYGGQLTDNVNQCNLIIV 885

Query: 913 QQNEIA----VAKDVRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVPEEDHPVV 967
              +I     +  D+R  L    + T+ PP +P+IV P WID SI E  QVPEED   V
Sbjct: 886 PDGKINLRGRIISDLRRLLSTFAAMTELPPAIPWIVIPAWIDRSIEENIQVPEEDFLAV 944

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score = 1036 bits (2678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/959 (53%), Positives = 697/959 (72%), Gaps = 35/959 (3%)

Query: 18  TPHNFAPSPSFRWLCDELFVKLERI--QQASTSKASKEFQKPINVQYYEVIQHFINLWRK 75
            P NFAPSP F+WLC+ELF KLE +  Q+  T+K        I ++YYE+I +F+NLWR 
Sbjct: 10  VPRNFAPSPQFKWLCEELFSKLEEVPNQRHLTTKR-------ITLRYYEIITNFVNLWRT 62

Query: 76  TVGNDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSV 135
           TVG+DIYPALIL LPYRDRR+YNV+DYTLIKAIC+YLKLPKNSFTEKRLL+WKQRA RSV
Sbjct: 63  TVGDDIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSV 122

Query: 136 RLSSFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVF 195
           +LS   V+E++KRKSEP    +  IT+D+LN  LD LS++RN KG  GY+ LS+S  F +
Sbjct: 123 KLSVSCVNEMRKRKSEPV--EKSPITLDELNTLLDFLSQDRNIKGR-GYKNLSESSIFTY 179

Query: 196 CLENMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAV 255
           C+E M+F+EL++FFDIILK+RVIG HEHK LN WHPDA+DYLSVVSDLKTV  +LW+P +
Sbjct: 180 CIEKMSFMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNI 239

Query: 256 HLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKL 315
            L++D+L+IN+G  FAP  AKKLSISY+KIC KLK+DFFIEEKMDGERIQ+HY DYGN +
Sbjct: 240 RLRHDELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDI 299

Query: 316 SFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKS 375
            FLSRRG DYTYLYGE++  GT++ YL L+ +V+ CVLDGEMVT+D++++ LLPFG+VKS
Sbjct: 300 KFLSRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKS 359

Query: 376 SARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLR 435
           +A + +T+E ++ + Y PLLMVFDLV+LNG SLV  PLYQRK YL  +  P R  V+++ 
Sbjct: 360 AAMNALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVN 419

Query: 436 SKRCSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDL 495
             RCS+E  I+ +LEHAIS+GSEG+VLK+YNSRY + SRND WIK+KPEYLEQFGENMDL
Sbjct: 420 FTRCSNENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDL 479

Query: 496 IVIGKDPGKKDSLMCGLAVVXXXXXXXXXXXXX-IVNLDSQDSIGEGEDKEGNEIEREKT 554
           IVIG+D  KKDS  CGL V+              +VNL S +S  + E+ E N     + 
Sbjct: 480 IVIGRDSAKKDSFYCGLTVLDEEEEKLVEEIDKGVVNLVSDES--DYENPENN-----RH 532

Query: 555 IKRFVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSI 614
           IK+ VSFC IANGISQ E+K I R T+G WKK++E+PPP +L+EFG++VP EWI+P+ S+
Sbjct: 533 IKKVVSFCMIANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSV 592

Query: 615 VIEVKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSNK 674
           V+E+KARSL+N E + K+FK G TLYGGYCR+IR+D DWK+ ++L+ELRR +R K     
Sbjct: 593 VLEIKARSLDNTESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGT 652

Query: 675 RANNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISDVVDATGS- 733
              +    +    K++    ++        QT      S+IFDGL+FY++SD  D   + 
Sbjct: 653 SEKDTLLKSKKRRKKQLLTPLNQNLNPRDIQT-----TSKIFDGLFFYILSDYFDTNENV 707

Query: 734 RVSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVL 793
           R+S+++L   +L  GG I HN+++K   ++  RILCGKYTAEC  LI RGYDI+ PQWV+
Sbjct: 708 RISKDDLQKLLLENGGKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVI 767

Query: 794 DCIKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLI--ERNVRSL 851
           DC+++  ++K+EP +CF+VS++LM +A RRVD +GDS+E+ +S    S ++   +++   
Sbjct: 768 DCVENKKIVKIEPSHCFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPD 827

Query: 852 RNAPPSIQYDMVDTVPLFLFYGRT--ILLRIKDKALFTKLKVQIRLYGGKTTGDLASCNL 909
             +P ++  D  + VP FLF+ R   ++    DK+   +  ++I+LYGGK   +++ CN+
Sbjct: 828 LLSPANMSLDF-EKVPYFLFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNI 886

Query: 910 VVIQQNEIAVAKD----VRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVPEEDH 964
           V+  + EI V ++    +R++L K  S + + P+LP IV+ EWID+SI +  QVPEED+
Sbjct: 887 VIFPKAEITVIRESMKFIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score = 1001 bits (2587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/967 (52%), Positives = 664/967 (68%), Gaps = 51/967 (5%)

Query: 19  PHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFINLWRKTVG 78
           PHNFAPSP FRWLC+ELF K+E +    T+   K     ++ +YYE+I +F  LWRKTVG
Sbjct: 11  PHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKS----VSFRYYEIISNFTELWRKTVG 66

Query: 79  NDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRLS 138
           N+IYPALIL LPYRDRRIYN++DY LI+ +CSYLKLPKNS TE+RL  WKQR G+   LS
Sbjct: 67  NNIYPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLS 126

Query: 139 SFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVFCLE 198
           S +V EI KR++EP   TR+ IT+D +N  LD LS+E N+ G  G++ L  S  F+ CLE
Sbjct: 127 SLLVEEISKRRTEP---TRKSITVDSVNFYLDELSKEMNASGR-GFKNLVKSKPFLHCLE 182

Query: 199 NMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLK 258
           NMTFVEL+FFFDI+LK+RVIGG EHK LN WHPDAQDYLSVVSDL+ V +KL+DP + LK
Sbjct: 183 NMTFVELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLK 242

Query: 259 NDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFL 318
           NDDL+I VG  FAPQ AKK+++SYEKIC  L++DFF+EEKMDGERIQ+HY +YG  + F 
Sbjct: 243 NDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFF 302

Query: 319 SRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSAR 378
           SRRG DYTYLYG ++  GT+S+YL   ++V+ CVLDGEMVTFD  R  +LPFGLVK SA+
Sbjct: 303 SRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAK 362

Query: 379 SIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKR 438
             ++   + N  + PL MVFDL+YLNG SL  +PLYQRK YL  I  P + +VE++R  R
Sbjct: 363 EALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSR 422

Query: 439 CSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 498
           C D  S+K +LE AIS+GSEGVVLKHY+S Y VASRN++WIKVKPEYLE+FGEN+DLI+I
Sbjct: 423 CYDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIII 482

Query: 499 GKDPGKKDSLMCGLAVVXXXXXXXXXXXXXIVNLDSQDSIGEGEDKEGNEIEREKT---- 554
           G+D GKKDS M GL VV                    D  G  E    +  ER  T    
Sbjct: 483 GRDSGKKDSFMLGLLVVDEQET------------GKTDQEGPSEILNDSSTERRATNPKK 530

Query: 555 -IKRFVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDS 613
            +++ +SFCSIANGISQEEFK I R T+G WKK+  + PP  +LEFGS++PAEWI+P +S
Sbjct: 531 RVRKVLSFCSIANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSES 590

Query: 614 IVIEVKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSN 673
           IV+E+K+RSL+N E   +K+ T  TLYGGYCR+IR DKDW  CYTL EL   +R K   +
Sbjct: 591 IVLEIKSRSLDNTETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPS 650

Query: 674 KRANNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISDVVDA-TG 732
            +  N     +   K+RK   +   F++  EQ P     S +F GL+FYV+SD +++ TG
Sbjct: 651 HQVENLQLQLV--PKKRKRALVSDPFQQSREQKPI----SGVFAGLFFYVLSDYINSVTG 704

Query: 733 SRVSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWV 792
            R++R EL D I+  GG ++HNVI K H     R++  K T EC++LIDRGYDI+ P+W+
Sbjct: 705 VRITRSELNDVIVKHGGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWI 764

Query: 793 LDCIKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRL--IERNVRS 850
           +DC   + LL +EP YCF+VS +L  +A+RRVD FGDSFE  ISE   S L   + ++ S
Sbjct: 765 MDCTAYNKLLPIEPSYCFSVSGKLRAVARRRVDCFGDSFENDISESKLSSLQKSQPDLLS 824

Query: 851 LRNAPPSIQYDMVDTVPLFLFYGRTILL---RI--KDKALFTKLKVQIRLYGGKTTGDLA 905
            R A  S +   +  +PLFLF  R + +   +I  KD+ L   L+++IRL+GGK T   +
Sbjct: 825 TRQADKSFE---LQIIPLFLFSNRIVYIPRSKIGPKDEML---LEMKIRLFGGKITDQQS 878

Query: 906 SCNLVVIQQNEIA----VAKDVRSSLLKL--TSDTDKPPVLPYIVTPEWIDSSISEGCQV 959
             NL++I   +        ++V S + +    S++D  P +P IVTPEW+D SISE CQV
Sbjct: 879 LSNLIIIPYADPIWRGDCLEEVHSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQV 938

Query: 960 PEEDHPV 966
           PEED PV
Sbjct: 939 PEEDFPV 945

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score =  990 bits (2559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/962 (52%), Positives = 660/962 (68%), Gaps = 42/962 (4%)

Query: 19  PHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFINLWRKTVG 78
           P NFAPSP F+WLC+ELF K++ +Q   T    K      + +YYEV+ +F+ +WRKTVG
Sbjct: 11  PQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSR----SFKYYEVLSNFVEMWRKTVG 66

Query: 79  NDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRLS 138
           N+IYPALIL LPYRDRRIYN++DY LI+ ICSYLKLPKNS TE RL  WKQR G+   LS
Sbjct: 67  NNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNLS 126

Query: 139 SFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVFCLE 198
           S +V EI KR+SEP     + ITID +N  LD LS++R++ G  G++ L  S  F+ CLE
Sbjct: 127 SLLVEEIAKRRSEPN---GKAITIDGINSTLDELSKDRSTSGR-GFKNLVKSSPFLHCLE 182

Query: 199 NMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLK 258
           +M+FVEL++FFDI+LKSRVIGG EHKFL+ WHPDAQDYLSVVSDLK VA+KL+DP V LK
Sbjct: 183 SMSFVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLK 242

Query: 259 NDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFL 318
           NDDLTI VG  FAPQ AKK+++ YEKIC  L +DF +EEKMDGERIQ+HY +YG  + F 
Sbjct: 243 NDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFY 302

Query: 319 SRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSAR 378
           SRRG DYTYLYG S+  GT+S +L   +NV+ CVLDGEMVTFD  R  +LPFGLVK SA+
Sbjct: 303 SRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAK 362

Query: 379 SIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKR 438
             ++   + N  + PL +VFDL+YLNG SL  +PL+QRK YLE I TP +++VE++R+ R
Sbjct: 363 DALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSR 422

Query: 439 CSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 498
           C +  SIK +LE AIS+GSEGVVLK+YNS Y VASRN++WIKVKPEYLE+FGEN+DL++I
Sbjct: 423 CYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVII 482

Query: 499 GKDPGKKDSLMCGLAVVXXXXXXXXXXXXXIVNLDSQDSIG-EGEDKEGNEIEREKTIKR 557
           G+DPGKKDS M GL ++                 D + S G     K  N +  +K +K+
Sbjct: 483 GRDPGKKDSFMLGLLLLNEKEMDKR---------DQEVSSGIANNSKNENILYSQKKVKK 533

Query: 558 FVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSIVIE 617
            +SFCS+ANGISQEEFK I R T+GCWKK+ E+ PP+ + EFGS++PAEWI+P +SIV+E
Sbjct: 534 ILSFCSVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLE 593

Query: 618 VKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSEL--RRMKRFKLGSNKR 675
           +K+RSL+N E   +K+ T  TLYGGYC++IR DKDW  C+TL+EL   R  RF    N  
Sbjct: 594 IKSRSLDNTETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARF----NPS 649

Query: 676 ANNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISD-VVDATGSR 734
              + +H     K+R+       F++  EQ PT++    IF GLYFYV+SD V +A+  R
Sbjct: 650 YQAEKSHLKLVRKKRREVLTSNTFDQKTEQIPTSI----IFAGLYFYVLSDYVTNASEVR 705

Query: 735 VSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVLD 794
           ++R EL + I+  GG +++N+I K H     R++  K T EC++LI+RGYDI+ P WV+D
Sbjct: 706 ITRGELENAIVRHGGRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVID 765

Query: 795 CIKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIERNVRSLRNA 854
           C+    L+ +EP YCFNVS+++  +A++RVD  GDSFE  ISE   S L     +S  N 
Sbjct: 766 CVAYKKLIPIEPCYCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSLL----YKSQHNL 821

Query: 855 PP--SIQYDM-VDTVPLFLFYGRTILLRIKDKAL-FTK-LKVQIRLYGGKTTGDLASCNL 909
           PP   ++ D  V   PLFLF  R + +  +   + + K L+++IRL+GGK T   + CNL
Sbjct: 822 PPPEEVERDAEVQVFPLFLFSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNL 881

Query: 910 VVIQQNEIAVAKD----VRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVPEEDHP 965
           V+I   +    KD    V   + +     D  P +P IV PEW+D SI   CQVPEED P
Sbjct: 882 VIIPYGDPTWRKDCIKEVNEQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFP 941

Query: 966 VV 967
           VV
Sbjct: 942 VV 943

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score =  988 bits (2554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/960 (51%), Positives = 664/960 (69%), Gaps = 26/960 (2%)

Query: 19  PHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFINLWRKTVG 78
           P NFAPSP F+WLCDELFVK + +     ++  +   KPI V+YYEV+ +F+ LWRKTVG
Sbjct: 9   PTNFAPSPDFQWLCDELFVKFDLV----ATQDRRINLKPITVRYYEVVSNFVQLWRKTVG 64

Query: 79  NDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRLS 138
           N+ YP LIL LPYRDRR YN++D TLIKAIC YL LPK S TEK+LL+WKQRA R+ RLS
Sbjct: 65  NNFYPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLS 124

Query: 139 SFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVFCLE 198
           SF V+EI+KRKS P    R+ IT+DKLN  LD L+  ++S+G  G R L+DS  F FCLE
Sbjct: 125 SFCVAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQ-GSRTLADSSHFKFCLE 183

Query: 199 NMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLK 258
           NM+F+EL++FFDI+LK R+IGGHEHK LN WHPDA DY SVVSDL +V  KL++P+V L+
Sbjct: 184 NMSFIELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLR 243

Query: 259 NDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFL 318
           N+DLT+ +GS FAP  AK+L+ISYEKI  KL  DF IEEKMDGERIQ+HY DYGN++ FL
Sbjct: 244 NEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFL 303

Query: 319 SRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSAR 378
           SRRGTDYTYLYG     GT++ YL L+ NV+ C+LDGEMVT+D+E+  +LPFGLVKSSA+
Sbjct: 304 SRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAK 363

Query: 379 SIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKR 438
           + +++E ++N  Y PL M FDLVYLNG SLV++PLYQRK YL KI T     V+++   R
Sbjct: 364 NFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFAR 423

Query: 439 CSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 498
           C++  SI  +L  AIS+GSEG++LK  NSRY VASRND WIK+KP+YL+QFGENMDLI+I
Sbjct: 424 CNNLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLIII 483

Query: 499 GKDPGKKDSLMCGLAVVXXXXXXXXXXXXXIVNLDSQDSIGEGEDKEGNEIEREKTIKRF 558
           G+DPGKKD+ MC L V               VNLD      + ED E  E  +   I +F
Sbjct: 484 GRDPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDL-----DTEDSEP-ETPKASRIVKF 537

Query: 559 VSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSIVIEV 618
           VSFC+IANGIS  EFK I + T+G W++ D++ PPS+ L+FG++ P EWIDPK+S+V+EV
Sbjct: 538 VSFCTIANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEV 597

Query: 619 KARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSNKRANN 678
           K+RSL+N E   KK++ G+TL+GGYCR +R DKDW TCYT+SE  R +++KL     A  
Sbjct: 598 KSRSLDNTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKL-PKVNAGE 656

Query: 679 DATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISDVVDA-TGSRVSR 737
             T +    K+R    I        ++TP   + S IF  L+F V+SD +D  TG+R+ R
Sbjct: 657 SITTSNKGRKKRNTTSILGVISPRKKRTPEG-EHSDIFQNLHFCVLSDYLDPYTGNRIDR 715

Query: 738 EELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVLDCIK 797
             L   I++ GG +++NV+AK   E   RI+C  +  EC +LI RGYDI+ P WVLDCI+
Sbjct: 716 NTLTQLIIDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIE 775

Query: 798 DDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIERNVRSLRNAPPS 857
              LLKLE  +CFNVS+ELM+++  RVD + DSFE +IS     RLI+ ++ ++ +   S
Sbjct: 776 SARLLKLERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFS 835

Query: 858 ---IQYDMVDTVPLFLFYGRTILL---RIKDKALFTKLKVQIRLYGGKTTGDLASCNLVV 911
              + +++    PL LF+ R++ +   ++ D+ ++ K+  + +L+GG+ T  +  CNL++
Sbjct: 836 GENLDFELRGLPPL-LFFDRSVFIAETKLSDR-IYAKISSETKLFGGQVTHTIEDCNLII 893

Query: 912 I----QQNEIAVAKDVRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVPEEDHPVV 967
           I     +++I V + +R  L  +    +    +P IV+ EW+  SI E  QVPEE++ V+
Sbjct: 894 IPNTDDEDKIQVLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSVL 953

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score =  977 bits (2525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/958 (51%), Positives = 654/958 (68%), Gaps = 35/958 (3%)

Query: 19  PHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFINLWRKTVG 78
           P NFAPSP F+WLC+ELFVK+  +Q   T+   K      + +YYE+I +F+ +WRKTVG
Sbjct: 11  PQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSR----SFKYYEIISNFVEMWRKTVG 66

Query: 79  NDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRLS 138
           N+IYPAL+L LPYRDRRIYN++DY LI+ ICSYLKLPKNS TE+RL  WKQR G+   LS
Sbjct: 67  NNIYPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLS 126

Query: 139 SFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVFCLE 198
           S +V EI KR++EP   + + ITID +N  LDSLS +R + G  G++ L  S  F+ C+E
Sbjct: 127 SLLVEEIAKRRAEP---SSKAITIDNVNHYLDSLSGDRFASGR-GFKSLVKSKPFLHCVE 182

Query: 199 NMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLK 258
           NM+FVEL++FFDI+LK+RVIGG EHK LN WHPDAQDYLSV+SDLK V +KL+DP V LK
Sbjct: 183 NMSFVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLK 242

Query: 259 NDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFL 318
           +DDL+I VG  FAPQ AKK+++SYEKIC  L  DF +EEKMDGERIQ+HY +YG  + F 
Sbjct: 243 DDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFF 302

Query: 319 SRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSAR 378
           SRRG DYTYLYG S+  GT+S++L   ++V+ CVLDGEMVTFD +R  +LPFGLVK SA+
Sbjct: 303 SRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAK 362

Query: 379 SIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKR 438
             ++   + N  + PL MVFDL+YLNG SL  +PL+QRK YL  I +P ++IVE++RS R
Sbjct: 363 EALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSR 422

Query: 439 CSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 498
           C    SIK +LE AIS+GSEGVVLK+YNS Y VASRN++WIKVKPEYLE+FGEN+DLIVI
Sbjct: 423 CYGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVI 482

Query: 499 GKDPGKKDSLMCGLAVVXXXXXXXXXXXXXIVNLDSQDSIGEGEDKEGNEIEREKTIKRF 558
           G+D GKKDS M GL V+                 DS + +     ++  +  R + +K+ 
Sbjct: 483 GRDSGKKDSFMLGLLVLDEEEYKKHQG-------DSSEIVDHSSQEKHIQNSRRR-VKKI 534

Query: 559 VSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSIVIEV 618
           +SFCSIANGISQEEFK I R T+G WK++ E+ PP+ +LEFGS++PAEWIDP +SIV+E+
Sbjct: 535 LSFCSIANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEI 594

Query: 619 KARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSNKRANN 678
           K+RSL+N E   +K+ T  TLYGGYC++IR DK+W  CYTL++L   +  K   + +A  
Sbjct: 595 KSRSLDNTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAER 654

Query: 679 DATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISD-VVDATGSRVSR 737
                +   K+RK   I   F +  +Q P     S IF GL FYV+SD V + TG R++R
Sbjct: 655 SQLGLI--RKKRKRVLISDSFHQNRKQLPI----SNIFAGLLFYVLSDYVTEDTGIRITR 708

Query: 738 EELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVLDCIK 797
            EL   I+  GG +++NVI K H     R++  K T EC++LIDRGYDI+ P WVLDCI 
Sbjct: 709 AELEKTIVEHGGKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIA 768

Query: 798 DDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIERNVRSLRNAPPS 857
              L+ +EP YCFNVS+++  +A++RVD  GDSFE  ISE   S L     +S  + PP 
Sbjct: 769 YKRLILIEPNYCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSSL----YKSQLSLPPM 824

Query: 858 IQYDM---VDTVPLFLFYGRTILL-RIKDKALFTKLKVQIRLYGGKTTGDLASCNLVVIQ 913
            + ++   V   PLFLF  R   + R K       ++++I+L+GGK T   + CNL++I 
Sbjct: 825 GELEIDSEVRRFPLFLFSNRIAYVPRRKISTEDDIIEMKIKLFGGKITDQQSLCNLIIIP 884

Query: 914 QNEIAVAKD----VRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVPEEDHPVV 967
             +  + KD    V   + +    +D  P +  +V PEW+D SI+E CQVPEED PVV
Sbjct: 885 YTDPILRKDCMNEVHEKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVV 942

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score =  968 bits (2503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/957 (51%), Positives = 657/957 (68%), Gaps = 30/957 (3%)

Query: 19  PHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFINLWRKTVG 78
           PHNF+PSP F+WLCDELFVKL++IQ            KP  ++YY++I +FI++WR+TVG
Sbjct: 31  PHNFSPSPDFKWLCDELFVKLDQIQFRPKELNG---SKPKYIEYYDIINNFIDIWRRTVG 87

Query: 79  NDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRLS 138
           NDIYPALIL +PYRDRR+YN+++  LI+ +C YLKLPKNS TE+RL+ WK RA R+VRLS
Sbjct: 88  NDIYPALILTIPYRDRRMYNIKESKLIRIVCDYLKLPKNSETERRLMRWKHRADRNVRLS 147

Query: 139 SFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVFCLE 198
           +F V EIKKRK EP+   + +ITIDKLN+CLD+L  ER  KGS   + +S+S TF FC E
Sbjct: 148 TFCVEEIKKRKGEPR--EKIKITIDKLNECLDNLVLERGYKGSKSQK-ISESETFKFCFE 204

Query: 199 NMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLK 258
           NMT+VEL++FFDI+LK +++GG EHKFLN WHPDAQDYLSVVSDLK V++KLW+P   LK
Sbjct: 205 NMTYVELKYFFDILLKDKIVGGLEHKFLNCWHPDAQDYLSVVSDLKIVSSKLWNPEFRLK 264

Query: 259 NDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFL 318
            DDLTIN+   F P++AK+L+ SY+ I  +LK+DFFIEEKMDGERIQLHY +YG KL FL
Sbjct: 265 YDDLTINIDHAFTPETAKRLTYSYDTIARRLKNDFFIEEKMDGERIQLHYMNYGAKLKFL 324

Query: 319 SRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSAR 378
           SRRG DY+YLYG++  +G + +YL+   +V+ C+LDGEMVT+D  +N +LPFGLVKSSA 
Sbjct: 325 SRRGLDYSYLYGDNRNNGAIGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAM 384

Query: 379 SIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKR 438
             ++   +  +GY PL M FDLVYLNG SL  +PL+QRK YL+K+  P    VE+L +  
Sbjct: 385 QSLSVSDIEPDGYHPLYMAFDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALH 444

Query: 439 CSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 498
           C+D   IK++LE AI +GSEG++LK ++S+Y VA R+DDWIK+KPEYLEQFGENMDLIVI
Sbjct: 445 CNDSSLIKSSLEKAIELGSEGIILKRFDSQYLVAKRSDDWIKIKPEYLEQFGENMDLIVI 504

Query: 499 GKDPGKKDSLMCGLAVVXXXXXXXXXXXXXIVNLDSQDSIGEGEDKEGNEIEREKTIKRF 558
           G+DPGKKDSLMCGL +              I +LDS  +     D   + ++ +K  ++ 
Sbjct: 505 GRDPGKKDSLMCGLILT------GDNEPEEITSLDSNPT-----DTAESFLKPDK--RKI 551

Query: 559 VSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSIVIEV 618
           +SFC+IANGISQ+EF+ I R T G W K D+  PP DL EFG++ P EWI P+ S+V+E+
Sbjct: 552 ISFCNIANGISQKEFRDIDRYTFGHWIKFDDELPPQDLFEFGTKHPIEWIYPEHSVVLEI 611

Query: 619 KARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSNKRANN 678
           KARSL  +E A  K+ TG TL+GGYCRQIR DKDW +C+T +E    +  K   N   N 
Sbjct: 612 KARSLETNESARIKYGTGSTLFGGYCRQIRYDKDWVSCFTYNEFMESRNLK---NALVNY 668

Query: 679 DATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSR-IFDGLYFYVISDVVDAT-GSRVS 736
                L   K+R  +R+     + FE T    D+S  IF GL+FYVISD +D T GSR+S
Sbjct: 669 PDNKNLIGRKKRPKKRMFNSLTEIFENTKDAPDESNVIFRGLHFYVISDYIDETDGSRLS 728

Query: 737 REELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVLDCI 796
           + +L + +L   G +VHN I++    N+ RI+  KYT E  SLI+RGYDII PQW+LDCI
Sbjct: 729 KSDLCNLVLEHNGKLVHNPISRIDILNRLRIISMKYTRETTSLIERGYDIIHPQWILDCI 788

Query: 797 KDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIERNVRSLRNAPP 856
            +  L++L P +CFNVS  LM++ K RVD +GDS+E  ++E  F  LI R V    +A  
Sbjct: 789 SNRKLVRLLPSHCFNVSSSLMEVTKTRVDRYGDSYETSLTEKDFEILINRQVLKSESADK 848

Query: 857 SI-QYDMVDTVPLFLFYGRTILL-RIKDKALFTKLKVQIRLYGGKTTGDLASCNLVVI-- 912
            I + +    +P+ LF  R   +          +LK ++ LYGGK    ++ CN++V   
Sbjct: 849 RITEGENHLKIPILLFCNRRFFIPETLPSTPIYELKSKVELYGGKLVNKISDCNVIVFTN 908

Query: 913 --QQNEIAVAKDVRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVPEEDHPVV 967
              +N   V K +R +L+ L  ++ + PVLP IV   WID+ ISE  QVPEED+P V
Sbjct: 909 THTENRKEVMKKIRRALVCLDPNSMQVPVLPRIVDANWIDACISECVQVPEEDYPAV 965

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score =  967 bits (2500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/960 (51%), Positives = 657/960 (68%), Gaps = 37/960 (3%)

Query: 19  PHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFINLWRKTVG 78
           P NFAPSP F+WLC+ELFV+++ ++   T+   K      + +YYE+I +F+  WRK VG
Sbjct: 11  PQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKS----ASFKYYEIISNFVESWRKGVG 66

Query: 79  NDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRLS 138
           N+IYPAL+L LPYRDRRIYN++DY LI+ ICSYLKLP+NS TE+RL SWKQR  R+  LS
Sbjct: 67  NNIYPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLS 126

Query: 139 SFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVFCLE 198
           S +V EI KR+ EP     + ITID +N  LD LS+ER+  G  G++ L +S  F+ CLE
Sbjct: 127 SLLVEEIAKRRPEP---NGKSITIDGVNDYLDELSKERSISGR-GFKDLVNSKPFLSCLE 182

Query: 199 NMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLK 258
           +M+FVEL++FFDI+LK+RVIGG EH+FLN WHPDAQDYLSVVSDLK V +KL+DP V LK
Sbjct: 183 SMSFVELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLK 242

Query: 259 NDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFL 318
           NDDL+I VG  FAPQ AKK+S+ YEKIC  L +DF IEEKMDGERIQ+HY +YG  + F 
Sbjct: 243 NDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFF 302

Query: 319 SRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSAR 378
           SRRG DYTYLYG S+  GT+S+YL L N V+ CVLDGEMVTFD  R  +LPFGLVK SA+
Sbjct: 303 SRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAK 362

Query: 379 SIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKR 438
            +++   + N  +RPL MVFDL+YLN +SL  +PL+QRK YL  I TP +++VE+++S R
Sbjct: 363 GVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTR 422

Query: 439 CSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 498
           C D +S+KN+LE AIS+GSEGVVLK+YNS Y +ASRN +WIKVKPEYLE+FGEN+DLI+I
Sbjct: 423 CYDVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIII 482

Query: 499 GKDPGKKDSLMCGLAVVXXXXXXXXXXXXXIVNLDSQDSIGEGEDKEGNEIEREKTIKRF 558
           G+D GKKDS M GL V+                L S + + + +  E + I  +K +K+ 
Sbjct: 483 GRDSGKKDSFMLGLLVIDEREMEERDQ-----ELSSSEVVNDSK-IEQDVINSKKKVKKV 536

Query: 559 VSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSIVIEV 618
           +SFCS+ANGIS EEFK I R T+G WK++ +  PPS +L+FGSR+PAEWI+P DSIV+E+
Sbjct: 537 LSFCSVANGISHEEFKEINRRTRGHWKRTSDFSPPS-ILQFGSRIPAEWIEPSDSIVLEI 595

Query: 619 KARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSNKRANN 678
           K+RSL+N E + +++ T  TLYGGYCR+IR DKDW  CYTL++L   +  K   N++  N
Sbjct: 596 KSRSLDNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDEN 655

Query: 679 DATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISD-VVDATGSRVSR 737
                  + K+RK   I   F +  EQ       S IF GL+FYV+SD V   TG R++R
Sbjct: 656 FQLQL--AHKKRKRALISDPFHQIREQKLI----SSIFAGLFFYVLSDYVTKDTGVRITR 709

Query: 738 EELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVLDCIK 797
             L D I+  GG ++HNVI K H     R++  K T EC+ LIDRGYDI+ P WV+DCI 
Sbjct: 710 AGLEDAIVKHGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIA 769

Query: 798 DDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIERNVRSLRNAPPS 857
              L+ +EP YCF+VS +L ++A++RVD  GDSFE  ISE   S L +      R    S
Sbjct: 770 YKQLIFIEPSYCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKS-----RQDLSS 824

Query: 858 IQYDMVDT----VPLFLFYGRTILLRIKDKALFTK--LKVQIRLYGGKTTGDLASCNLVV 911
           I    +D+    +PLFLF  R + +      L  +  L+++IRL+GG+ TG  + CNL++
Sbjct: 825 IGEIGIDSEAQVIPLFLFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLII 884

Query: 912 IQQNEIAVAKD----VRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVPEEDHPVV 967
           I   + +  KD    V   + +    +   P +  IV+P W+D SI+E CQVPEED PVV
Sbjct: 885 IPYVDSSRRKDCIEKVNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVV 944

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score =  958 bits (2477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/955 (49%), Positives = 656/955 (68%), Gaps = 46/955 (4%)

Query: 21  NFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFINLWRKTVGND 80
           NFAPSP F WLC++LF K++ +Q     +A+    KP+  +YYEVI +F  LWR TVGN+
Sbjct: 24  NFAPSPDFLWLCEQLFAKIDHVQ---FERANNLLTKPVTARYYEVISNFTTLWRTTVGNN 80

Query: 81  IYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRLSSF 140
           IYPAL LILPYRDRR++N++DYTLIKAIC++LKLPK+S TEK+L++WKQ AGRSVRLS F
Sbjct: 81  IYPALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSKF 140

Query: 141 IVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVFCLENM 200
            V EIKKR+SEPQ+   E ITID LN  LD L+ ER  +G   ++ L++S     CL +M
Sbjct: 141 CVEEIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGR-SFKNLANSDIMNKCLTSM 199

Query: 201 TFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLKND 260
           TF+E+Q+FFDI+LK+R +GGHEHK LN WHPDAQDYLSVVSDL+TVA +LWDP+  L N 
Sbjct: 200 TFLEMQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQ 259

Query: 261 DLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFLSR 320
           DL IN+G  FAPQ A KL +SY+KI  KL  DFFIEEKMDGERIQ+HY ++G+ + F SR
Sbjct: 260 DLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSR 319

Query: 321 RGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSARSI 380
           R TDYTYLYG ++K GT++ +++L+ NV++CVLD E+VTFD     +LPFG+VKSSA+++
Sbjct: 320 RATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNM 379

Query: 381 ITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKRCS 440
           ++Q+G+  +G+ PLLMVFD++YLNG +LV++P Y+R+ YL++I TP  H +E+++S R +
Sbjct: 380 LSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRAN 439

Query: 441 DERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGK 500
           DE+ IK +LE A+S+GSEG++LK Y+SRY +ASR+DDWIK+KPEYLEQFGENMDL+++G+
Sbjct: 440 DEQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGR 499

Query: 501 DPGKKDSLMCGLAVVXXXXXXXXXXXXXIVNLDSQDSIGEGE---DKEGNEIEREKTIKR 557
           DP KKDSLM GL                   LD ++ I +     + + +E E  +  + 
Sbjct: 500 DPSKKDSLMLGL-------------------LDYEEVIQDSPIMVNSQSSE-ENSQRFRG 539

Query: 558 FVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSIVIE 617
           FVS C IANGIS EE+K I R TKG W  S++I PP + ++FGS+VP +WIDPK S+++E
Sbjct: 540 FVSLCIIANGISNEEYKEIDRKTKGLWNDSEKI-PPLEYMKFGSKVPRQWIDPKKSLILE 598

Query: 618 VKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSNKRAN 677
           +KARSL+N   + +KF  G TL+GGYCRQIREDK+WKTCYTL E  R K    G+N R  
Sbjct: 599 IKARSLDNTRSSERKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKS---GNNWRKR 655

Query: 678 NDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISDVVDATG-SRVS 736
             +      SK+R+   I     K  E       +S IFDG+YFYV+SD  D     R+ 
Sbjct: 656 GSSKPQKVISKKRRYNIIS-SVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIK 714

Query: 737 REELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVLDCI 796
           + E+   I+  GG +V NVI +++  N  RI+  + T EC SLI RGYDII P+WV DC+
Sbjct: 715 KSEIQKVIVANGGQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCL 774

Query: 797 KDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIERNVRSLRNAPP 856
               ++KLEP +CFN S++LM  A +R+D +GD +E  I++  +S L    + +     P
Sbjct: 775 LSGKIMKLEPSHCFNFSKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQP 834

Query: 857 SIQYD--MVDTVPLFLFYGRTILLRIKDKALFTKLKVQIRLYGGKTTGDLASCNLVVI-- 912
            +Q+D  ++D VP FLF+GR + L + D     K    +  YGGK T +L+S NLV++  
Sbjct: 835 DVQFDNSLMD-VPHFLFHGRIVFL-LSDNNNIQKESFMVDAYGGKVTNELSSANLVIVVG 892

Query: 913 ---QQNEIAVAKDVRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVPEEDH 964
              Q+    + K + S ++K     D PP +P +V+  W+   I +  QV E+++
Sbjct: 893 AVTQRRINDIRKQISSEVIK----QDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  934 bits (2414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/974 (49%), Positives = 650/974 (66%), Gaps = 25/974 (2%)

Query: 7   TPTLDNDTRPATPHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVI 66
            P ++ DT    P NF+PSP F+WLC+ELFVKL+ ++    S  ++    P N+QY  VI
Sbjct: 4   VPNMNIDTSEREPRNFSPSPDFKWLCNELFVKLDEVRLKPKSVDTR----PKNIQYDIVI 59

Query: 67  QHFINLWRKTVGNDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLS 126
            +FI+LWR TVGNDIYPAL LILPYRDRR Y +R++TLI+ +C YLKL KNS TE+RL  
Sbjct: 60  NNFIHLWRVTVGNDIYPALRLILPYRDRRNYYIREHTLIRIVCDYLKLQKNSVTEQRLRR 119

Query: 127 WKQRAGRSVRLSSFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNS----KGSM 182
           WKQ+A RS+ LSSF + EIKKR SEP   ++E+ITIDKLN  LDSLS ER+S     GS 
Sbjct: 120 WKQKARRSINLSSFCIQEIKKRLSEPV--SKEKITIDKLNSILDSLSMERSSSKITNGSS 177

Query: 183 GYRGLSDSPTFVFCLENMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSD 242
           G + LS   +  +C ENM+F+EL++FFDI++K+R+IGG EHKFLN WHPDA DYLSVVS+
Sbjct: 178 G-KKLSQLESIKYCFENMSFIELEYFFDILIKARLIGGLEHKFLNAWHPDANDYLSVVSE 236

Query: 243 LKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGE 302
           L  V  KLW+P   L + DLTI + + F PQ AKK+++SYE +  ++ + F IEEKMDGE
Sbjct: 237 LNIVTEKLWNPNFRLNSKDLTIALHNAFEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGE 296

Query: 303 RIQLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDK 362
           RIQ+HY DYG+++ + SRRG DYTYLYG+     T+SKYL L+ +V+ C+LDGEMV++DK
Sbjct: 297 RIQIHYMDYGHQIKYFSRRGNDYTYLYGKDKSTATISKYLQLNEDVKECILDGEMVSYDK 356

Query: 363 ERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEK 422
            RN +LPFG+VKS A + +  +G+ N+   PL +VFD+++LNG  L N+PLYQRK YL  
Sbjct: 357 SRNCILPFGMVKSGAANSLKIDGLENDLCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSN 416

Query: 423 IFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVK 482
           I TP++  +E+L+     D  SI++AL+ AIS+GSEG+VLK Y+S Y+V  RN+DWIKVK
Sbjct: 417 ILTPKKSHIEILKFSIAHDSESIRSALQAAISVGSEGIVLKKYDSLYSVGDRNNDWIKVK 476

Query: 483 PEYLEQFGENMDLIVIGKDPGKKDSLMCGLAVVXXXXXXXXXXXXXIVNLDSQDSIGEGE 542
           PEYLEQFGEN+DLIVIG+DPGKKDSLMCG+AV+             ++ L S D   +  
Sbjct: 477 PEYLEQFGENLDLIVIGRDPGKKDSLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNN 536

Query: 543 DKEGNEIEREKTIKRFVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSR 602
             E   I R K I +F+SFC IANGIS EEFK I R T GCWKK  +  PP+D LEFG+R
Sbjct: 537 IPEDKPI-RTKRITKFISFCVIANGISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTR 595

Query: 603 VPAEWIDPKDSIVIEVKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSEL 662
           +P EWI+P DS+V+EVKARSL N+E    KFKTG TLYG YCR+IR DKD+  CYT S+L
Sbjct: 596 LPVEWINPHDSVVLEVKARSLENNEALRDKFKTGYTLYGAYCRRIRTDKDFNDCYTFSDL 655

Query: 663 RRMKRFKLGSNKRANNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFY 722
                 K  S++   N   H+    KR +  +++   +    Q   T   S+IFDGL F+
Sbjct: 656 VIATNKKRSSSELYGN---HSHIKKKRSRTSKVNMLNQTLSIQDDDTGFTSKIFDGLSFF 712

Query: 723 VISDVVDATGS-RVSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLID 781
           VISD VD+  S R+  +EL + I   GG ++ N+++++  E   RI+  K T EC  LI 
Sbjct: 713 VISDYVDSNSSFRLRIDELINIIKVNGGQLIFNLVSQNLNEKYVRIMSCKKTFECNELIK 772

Query: 782 RGYDIIEPQWVLDCIKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFS 841
           RGYDII P+W+LDCI +D LL  EP +CFNVS+ L  I+K+RVD  GDS++  I+E+   
Sbjct: 773 RGYDIIHPKWILDCIANDKLLDFEPSHCFNVSQSLSTISKQRVDLLGDSYQKYITEEELE 832

Query: 842 RLIERNVRSLRNAPPSIQYD-MVDTVPLFLFYGRTILL--RIKDKALFTKLKVQIRLYGG 898
            LI       +     +Q+D  ++ +P+FLF  +      +   + L  +  + I+LYGG
Sbjct: 833 LLISSKTPKEQLYSNPLQFDQQIEKIPIFLFSNKKAYTPKQCFSEKLLKETNLYIKLYGG 892

Query: 899 KTTGDLASCNLVVIQQNEIAVAKDVRSSLLK-----LTSDTDKPPVLPYIVTPEWIDSSI 953
            +  ++  CN+++I       + +  SS+ K       S  +  P+ P IV+ +WI+ SI
Sbjct: 893 TSVNNINDCNVIIIGDEHSKSSNEKISSIRKELSIHAVSSNNVIPI-PRIVSYKWIEKSI 951

Query: 954 SEGCQVPEEDHPVV 967
           ++G QV EED P++
Sbjct: 952 AQGTQVVEEDFPII 965

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score =  924 bits (2387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/977 (47%), Positives = 647/977 (66%), Gaps = 35/977 (3%)

Query: 9   TLDNDTRPATPHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEF-QKPINVQYYEVIQ 67
           T   ++   TP NFAPSP F+WLCDELFVK+++I++   +K +     KPI+ +Y++ I 
Sbjct: 13  TTTKESPATTPKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTIT 72

Query: 68  HFINLWRKTVGNDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSW 127
           HFI LWR T+G+DI+PAL LILPYRDRR+YN++D TLI+AICSYLKLPKNS  E+RL+ W
Sbjct: 73  HFIKLWRTTIGDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRW 132

Query: 128 KQRAGRSVRLSSFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGL 187
           K +A R   L++F + EI KRK+EPQV   E I+IDKLN+ LD L   R +  +     L
Sbjct: 133 KYKADRYETLATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRSNL 192

Query: 188 SDSPTFVFCLENMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVA 247
               TF FCLENMTF+EL++FFDII+K++++G  E+ FL +WHPD+++YLSVVSDL+T++
Sbjct: 193 LQVETFKFCLENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLS 252

Query: 248 NKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLH 307
           NKLW+P++ + N DL+I VG  FAPQ AK+L +SY+ I  +L +DFFIEEKMDGERIQLH
Sbjct: 253 NKLWNPSIKINNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLH 312

Query: 308 YQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNAL 367
           Y +YG  + F SR GTDYTYLYG     GT++K+L L  NV+ CVLDGEMVTFD     +
Sbjct: 313 YMNYGETVKFFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKV 372

Query: 368 LPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPE 427
           LPFGLVKSSA S + ++ + N+ + PL MVFD++YLNG SL+++PL++RK +L  + TP 
Sbjct: 373 LPFGLVKSSASSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPY 432

Query: 428 RHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLE 487
           +  VE+L S RC+D   IK  L+ AIS+GSEG+VLK Y S+Y   +R+++WIKVKPEYLE
Sbjct: 433 KDYVEILSSIRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLE 492

Query: 488 QFGENMDLIVIGKDPGKKDSLMCGLAVVXXXXXXXXXXXXXIVNLDSQDSIGEGEDKEGN 547
           +FGENMDLIVIG+D GKKD L+CG+ V                N+  +  I    D   +
Sbjct: 493 EFGENMDLIVIGRDSGKKDCLICGILVTEEKQELSE-------NMKRESEIEIISDSGDD 545

Query: 548 EIEREKT--IKRFVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPA 605
           +++ + +  IK+ +SFC+IANG+SQ E K I RIT+G WK  +   PP D+LEFG++ P 
Sbjct: 546 DLDTKPSQGIKKVISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPV 605

Query: 606 EWIDPKDSIVIEVKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSEL--R 663
           EWI P+DS+V+E+KARSL+  ++   K+ TG TLYGGYCRQIR+DKDW +CYTL +L   
Sbjct: 606 EWIYPQDSVVLEIKARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYN 665

Query: 664 RMKRFKLGSNKRANNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQ---SRIFDGLY 720
            +KR     +++ N +    + S  R+K++ I           P   D    S +F GLY
Sbjct: 666 EIKR-----HEKKNKNKQTLIRSYSRKKSKIISPA-----GMLPNGTDLRLISDLFHGLY 715

Query: 721 FYVISDVV-DATGSRVSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSL 779
           FY+ISD + D+   R+ RE++   I+  GG +++NVIAK +  ++ RIL  K T EC  L
Sbjct: 716 FYIISDYIPDSDAQRIDREDICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDL 775

Query: 780 IDRGYDIIEPQWVLDCIKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDS 839
           + RGYD+I   W+ DC++  ++L LEP +C  VS EL+ IA  R+D FGDS+EA + +  
Sbjct: 776 VRRGYDVINLSWLFDCLQAGVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATLIDSK 835

Query: 840 FSRLIERNVRSLRNAPPSI----QYDMVDTVPLFLFYGRTILLRIKDKALFTK--LKVQI 893
             +L++ N+  +  +  ++    + + VD++P+FLF  R   L  +D  L  +  L  QI
Sbjct: 836 LLKLLDSNINKVNRSNSNLLLINKDEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQI 895

Query: 894 RLYGGKTTGDLASCNLVVIQQNEIAVAK---DVRSSLLKLTSDTDKPPVLPYIVTPEWID 950
           +LYGG     L  CN++V       V K   D+R  L+K   D + P  +P  V   WI 
Sbjct: 896 KLYGGSLVTKLEDCNIIVGVCGSQLVNKKLGDLRCKLVKQYVDANFPQPIPRAVNVSWIT 955

Query: 951 SSISEGCQVPEEDHPVV 967
            SI  G Q+  ED+P++
Sbjct: 956 ESIKAGYQLSPEDYPIL 972

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score =  909 bits (2349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/958 (47%), Positives = 634/958 (66%), Gaps = 43/958 (4%)

Query: 19  PHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFINLWRKTVG 78
           P NFAPSP FRWLCDELF KLE I     ++  ++  K + V+  EVI +FI LWR TVG
Sbjct: 36  PQNFAPSPDFRWLCDELFSKLEEI-----TEDRQKLGKAVTVKRVEVIMYFIKLWRTTVG 90

Query: 79  NDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRLS 138
           ++IYP L LILPYRD R YN++DYTL+KA+C  L LPK+S TEKRLL+WKQ A R   LS
Sbjct: 91  DNIYPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLS 150

Query: 139 SFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVFCLE 198
            F V EI KR+ EPQ   R  +TID LN+CLD LS+E ++K   G+ GLS SP+F  CL+
Sbjct: 151 KFCVEEIMKRRKEPQGSQR--LTIDALNKCLDELSKEASAK-KWGFNGLSKSPSFQNCLQ 207

Query: 199 NMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLK 258
           NM+F E ++FFDIILK+RVIGG EHKFLN WHPDAQDYL VVSDLK ++  LW+P + L 
Sbjct: 208 NMSFSEQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLG 267

Query: 259 NDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFL 318
            ++L+IN+G  FAP  AK+L +SYE++CAKLK DF IEEKMDGERIQLHY + G K+ FL
Sbjct: 268 KNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFL 327

Query: 319 SRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSAR 378
           SRRGTD+T+LYG+S++ G +S++L   N+VQ+CVLDGEMV+FDKE+N +LPFG+VKS+A 
Sbjct: 328 SRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAM 387

Query: 379 SII--TQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRS 436
             +  +   V  +GYRPL M+FDLVYLNGVSL  +PL+ RK YL  I +P  +IVE+L  
Sbjct: 388 EELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSD 447

Query: 437 KRCSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLI 496
            R S+  +IK +LE AI +GSEG++LK ++S Y + +RND WIK+KPEY E+ GE MDL+
Sbjct: 448 VRASEPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLV 507

Query: 497 VIGKDPGKKDSLMCGLAVVXXXXXXXXXXXXXIVNLDSQDSIGEGEDKEGNEIEREKTIK 556
           VIG+DPGKKDSLMCGL +               VNL SQD          + +  ++   
Sbjct: 508 VIGRDPGKKDSLMCGLILADETDGSS-------VNLASQD----------DPLRPKQRNP 550

Query: 557 RFVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSIVI 616
           + +SFC+IANG+S  EFK I R T+G W  +   PPPS LLEFG+++P EWIDP+ S+V+
Sbjct: 551 KVISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVL 610

Query: 617 EVKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSNKRA 676
           EVKARS++ DE ++KK+KTG TL G YCR +R +KDW TC T+ +  + KR     N   
Sbjct: 611 EVKARSVDTDELSSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKR---AHNYHK 667

Query: 677 NNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISDVVDATGSRVS 736
               +H +   K+RK   +   +    + +  ++ +S IF GL FY++SD +D+   R  
Sbjct: 668 GKRKSHQISPRKQRKLANVSELYPLLADDSRESIFESNIFQGLQFYILSDYIDSQKKRYE 727

Query: 737 REELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVLDCI 796
           ++++   +    G ++HN   +    ++ RI+ GK T EC+SL ++GYDII P W+ DC+
Sbjct: 728 KDQIGTLVRKNSGHVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCL 787

Query: 797 KDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIE-RNVRSLRNAP 855
               L+KLEP++CF  S +L++ +++RVD FGDSF   +S   F  L+  ++V S   + 
Sbjct: 788 NYGSLVKLEPRHCFRTSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVSPHLSA 847

Query: 856 PSIQYDMVDTVPLFLFYGRTI-LLRI-KDKALFTKLKVQIRLYGGKTTGDLASCNLVVI- 912
           P    + +D +PLFLF    I   R+  D      L+  +RL+GG+ +  L  CNLVV+ 
Sbjct: 848 P----EELDGIPLFLFQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVR 903

Query: 913 -----QQNEIAVAKDVRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVPEEDHP 965
                Q+    + + +R  +      ++    +P++V+  W+++ I+E C VPEED P
Sbjct: 904 VSFKEQKKLFKLVEGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDFP 961

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score =  875 bits (2261), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/981 (46%), Positives = 633/981 (64%), Gaps = 52/981 (5%)

Query: 1   MDGKAVTPTLDNDTRPAT---PHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKP 57
           MDG    P+ + DT   +   PHNFAPSP FRWLC+ELF +L+ I +       +E  K 
Sbjct: 1   MDGNGKCPS-ETDTSKISENEPHNFAPSPDFRWLCEELFHRLDAINEHR-----QELGKA 54

Query: 58  INVQYYEVIQHFINLWRKTVGNDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKN 117
           + V+  E+I  FI LWR TVG+D +PAL L+ PYRD R Y+++D+TLIKA+C  L L ++
Sbjct: 55  VTVKRVEIITCFIKLWRTTVGDDFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRD 114

Query: 118 SFTEKRLLSWKQRAGRSVRLSSFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERN 177
           S TE+RLL+WKQ AGR   LS F V EI KR+ EP      ++TID LN+ LD L++E +
Sbjct: 115 SLTERRLLNWKQYAGRGTSLSKFCVQEISKRRKEPL--PERQLTIDGLNEKLDELAKEAS 172

Query: 178 SKGSMGYRGLSDSPTFVFCLENMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYL 237
            K + G  GLS+S +F FCL+N++F+EL++FFDI+LK+RVIGG EHKFL  WHPDAQ YL
Sbjct: 173 GKKAWGTTGLSESHSFQFCLKNLSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYL 232

Query: 238 SVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEE 297
            VV+DLK ++ KLW+P+V L   DL+IN+G  FAP  AK+L +SYE+IC+KLKHDF +EE
Sbjct: 233 GVVTDLKILSKKLWNPSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEE 292

Query: 298 KMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEM 357
           KMDGERIQLHY + G+ L FLSRRG D+++LYG+ +  G +S+YL L ++V++CVLDGEM
Sbjct: 293 KMDGERIQLHYVNGGSVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEM 352

Query: 358 VTFDKERNALLPFGLVKSSA--RSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQ 415
           V++DK+R  +LPFG+VKS+A    I ++ G  N+GYRPL MVFDLVYLNGVSL  +PL+ 
Sbjct: 353 VSYDKKRKIILPFGIVKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHI 412

Query: 416 RKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRN 475
           RK YL++I +P   +VE+L+  R  D ++IKN ++ AI +GSEGV++K  +S Y V +RN
Sbjct: 413 RKEYLKEILSPVPDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARN 472

Query: 476 DDWIKVKPEYLEQFGENMDLIVIGKDPGKKDSLMCGLAVVXXXXXXXXXXXXXIVNLDSQ 535
           D W+K+KPEY E  GE MDL+VIG+DPGKKDSLMCGL V                 L++ 
Sbjct: 473 DHWVKIKPEYFEDLGETMDLVVIGRDPGKKDSLMCGLLVSDSEHI-----------LENF 521

Query: 536 DSIGEGEDKEGNEIEREKTIKRFVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSD 595
             I  G  KEG+       I + VSFC++ANG+S EEFK I R T+G W    E PPP  
Sbjct: 522 GPIEHG--KEGD------PIIKCVSFCNVANGVSDEEFKEINRKTRGSWVSYKEKPPPLS 573

Query: 596 LLEFGSRVPAEWIDPKDSIVIEVKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKT 655
           LLEFGS++P EWIDPK+S+VIEVKARS+ N E ++K+++ G TL+  YCR+IR DKDW T
Sbjct: 574 LLEFGSKIPVEWIDPKNSVVIEVKARSVENSEYSSKRYRAGSTLHSAYCRRIRNDKDWTT 633

Query: 656 CYTLSELRRMKRFKLGSNKRANNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQ--S 713
           C ++++ ++    K   N        H +   ++R    I   FE    +  + LD   S
Sbjct: 634 CTSVAQYQQA---KAAHNYHRYKRKVHQVSPRRKRNVHEI---FEYCAGEAKSELDTEGS 687

Query: 714 RIFDGLYFYVISDVVDATGSRVSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYT 773
            IF+GL+FY++SD V +   R  R  +  K++  GG+IV N+  +    +  RI+ GK T
Sbjct: 688 SIFEGLHFYILSDYVTSQRRRYERGMVAAKVVKHGGLIVKNIDMRPEHLSYLRIVSGKTT 747

Query: 774 AECQSLIDRGYDIIEPQWVLDCIKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEA 833
            EC++L++RGYDII+P W+ DCI     L +EPK+CF  S  L+  +++RVD +GDSF  
Sbjct: 748 IECRNLVNRGYDIIDPCWIFDCISAGFQLGIEPKHCFQTSRRLLDNSRQRVDQYGDSFSR 807

Query: 834 QISEDSFSRLIERNVRS---LRNAPPSIQYDMVDTVPLFLFYGRTILLRIKD--KALFTK 888
            +    F +L +    S     +   S+  D +D  PLFL     I +   D     F+ 
Sbjct: 808 PLDTTEFQQLFKFFCSSPSDFSSRISSMLQDDLDEAPLFLLQRFKIYVLAADLIPQQFSI 867

Query: 889 LKVQIRLYGGKTTGDLASCNLVVIQQNEIAVAK------DVRSSLLKLTSDTDKPPVLPY 942
           L+ +I LYGG  +  L   NLV++  + ++ A+      ++R  +       +    +P+
Sbjct: 868 LRRKIELYGGVVSETLEGANLVLV-PSALSTARTAYYVQELRQKIAGNAFAGNTNTRIPH 926

Query: 943 IVTPEWIDSSISEGCQVPEED 963
           IV  EW+D+  +E C VPEED
Sbjct: 927 IVRSEWLDTCTTEQCLVPEED 947

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/973 (43%), Positives = 601/973 (61%), Gaps = 40/973 (4%)

Query: 7   TPTLDND--TRPATPHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYE 64
           TPT +++   +  +P NF+PSP F WLCDELF+KLE +     +   K+  KP  V+  E
Sbjct: 37  TPTGEHEINAQDGSPINFSPSPDFCWLCDELFIKLEEV-----ALKKKDLGKPRKVRNLE 91

Query: 65  VIQHFINLWRKTVGNDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRL 124
           +  +F++LWRKTVGNDIYPAL+L LPY DRR Y V+D TL+KA+C ++KLP+NS TE+RL
Sbjct: 92  ITSNFVSLWRKTVGNDIYPALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRL 151

Query: 125 LSWKQRAGRSVRLSSFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGY 184
           L WKQ A R V+LS+F V E++KR+ EP V  R  ++ID++N  LD L  E N  G   Y
Sbjct: 152 LHWKQNAPRGVKLSTFCVEELQKRRREPVVPKR--MSIDEVNGMLDKLEHESNV-GKWSY 208

Query: 185 RGLSDSPTFVFCLENMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLK 244
             L++SP F +CLE+M++VEL+FFFDI+LK  ++ G E   L+ WHPDA+ Y  VVSDL+
Sbjct: 209 ISLAESPAFNYCLEHMSYVELRFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLR 268

Query: 245 TVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERI 304
            VA+ L+DP   L+ +DL++ +G  FAP  A+++ I YEK+  KL +DF++EEKMDG+RI
Sbjct: 269 IVAHTLYDPNERLEKNDLSVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRI 328

Query: 305 QLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKER 364
           Q+HY DYGN +++ SR G +YTYLYGE+   G++S +L     V+ C+LDGEMV++DKE 
Sbjct: 329 QVHYMDYGNSIAYFSRNGINYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEM 388

Query: 365 NALLPFGLVKSSARSIITQE--GVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEK 422
             +LPFGL KS A   +  E  G     YRPL  VFDL+YLNG  L N  + +RK YLEK
Sbjct: 389 QCILPFGLTKSGASHQVNFETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEK 448

Query: 423 IFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVK 482
           I  P +++V LL   RCSD  +I  AL  A++ GSEG+VLK   S+Y+V  R+D WIK+K
Sbjct: 449 ILIPSKNVVHLLSGPRCSDAEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIK 508

Query: 483 PEYLEQFGENMDLIVIGKDPGKKDSLMCGLAVVXXXXXXXXXXXXXIVNLDSQDSIGEGE 542
           PEYLE FGENMDL+VIG+D G+KDS +C LAV                N  S    G   
Sbjct: 509 PEYLENFGENMDLVVIGRDKGRKDSFICALAVTDDSEK----------NNPSSYESGSDS 558

Query: 543 DKEGNEIEREKTIKRFVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSR 602
           D +   I  +  I++F+SFCSIANGIS EEFK I R+T+G W   DE  PP+D +EFG++
Sbjct: 559 DSDSEPIIVQPKIEKFISFCSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTK 618

Query: 603 VPAEWIDPKDSIVIEVKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSEL 662
            P EWIDPK+S+V+EVKARS++N+E  +  +KTG TLY  YC++IR DK+W T  T++E 
Sbjct: 619 TPREWIDPKNSVVLEVKARSIDNEESKSDLYKTGSTLYNAYCKRIRHDKNWSTASTVAEY 678

Query: 663 RRMKRFKLGSNKRANNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFY 722
              +  +   N   N  A    D S  RK R     F    +   T   ++    G YFY
Sbjct: 679 DTAREARSYFNVSQN--AKFGKDRSSPRKRRT----FHLVGDIDVTKPSKADFLKGYYFY 732

Query: 723 VISDVVDATGSR-VSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLID 781
           V S   D    + +   E+ + +++ GG  +HN+  +   +  + + C K T E + LI+
Sbjct: 733 VTSGYFDLQSKKNIDASEIGEAVVSCGGTYIHNLRIRASLDKLYILGC-KDTRELKMLIE 791

Query: 782 RGYDIIEPQWVLDCIKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFS 841
           RGYDII P+W++DC+K   +L++EPKY ++ SEELMK A+ + D +G+S++  ++ED+  
Sbjct: 792 RGYDIIHPEWLMDCVKYGTMLQIEPKYVYSASEELMKQARNQEDKYGESYQLPVTEDTLK 851

Query: 842 RLIERNVRSLRNAPPSIQYDMVDTVPLFLFYGRTILLRIKDKALFTK----LKVQIRLYG 897
            L  + V         +  D V      L +   +   + D A  +     +K  I   G
Sbjct: 852 ALANKQVE--EGYASEMGTDAVSEYERLLIFKGWLFYILDDYAYHSSWSDIVKWNIESCG 909

Query: 898 GKTTGDLASCNLVVIQQNEIA--VAKDVRSSL-LKLTSDTDKPPVLPYIVTPEWIDSSIS 954
           G+ T DL    +VV  ++  +    + VR+++  ++T   D  P+ P IVT EW+++ + 
Sbjct: 910 GEVTNDLELATIVVAVKDCFSQLSLQAVRNNIGARITGSNDVQPI-PKIVTSEWVEACME 968

Query: 955 EGCQVPEEDHPVV 967
               V E+++  +
Sbjct: 969 AQYLVDEDEYAAI 981

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/956 (43%), Positives = 587/956 (61%), Gaps = 70/956 (7%)

Query: 21  NFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFINLWRKTVGND 80
           NF+PSP F+WLCDEL  K+       TS       KP+ V+Y E+I +FI LWR TVGN 
Sbjct: 6   NFSPSPEFKWLCDELLGKI-----YETSSKKHLIGKPVTVRYLEIITNFIKLWRSTVGNY 60

Query: 81  IYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRLSSF 140
           IYPAL LI+P+RDRRIYNV++ TLIKA+C YL+LPK+S TE RLL WKQRA R V+LS F
Sbjct: 61  IYPALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDF 120

Query: 141 IVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVFCLENM 200
            V EI+KR+ + +   R  ITID+LN  LD +S+E N K  MGY  L+DS  F +CL +M
Sbjct: 121 CVEEIRKRQKDYEGANR--ITIDELNGYLDEVSQEGNGK-RMGYMALTDSRAFNYCLNHM 177

Query: 201 TFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLKND 260
           TF+E++FFFDIILK+RV+ G E+ FL  WHPDA DYLSVVSDL  ++ +L++P   L+  
Sbjct: 178 TFMEMKFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQT 237

Query: 261 DLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFLSR 320
           DL+I +   F PQ AK+  +SYE++ +KL+HDF IEEKMDGER+Q+HY +YG ++ +LSR
Sbjct: 238 DLSITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSR 297

Query: 321 RGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSARSI 380
           RG D++YLYGE+   G +S  L L  NV++C+LDGEM+T+D E++ +LPFGLVKSSA + 
Sbjct: 298 RGVDFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQ 357

Query: 381 ITQE--GVA-NEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSK 437
           I  E  G+A  E Y+PL + FDLVYLNG SL N+ L +RK YL KI TP    VE+++  
Sbjct: 358 IQSELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYM 417

Query: 438 RCSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIV 497
           +  +  +IK++LE AIS+GSEG+VLKH +S+Y V SRN DWIK+KPEYLEQFGENMDL++
Sbjct: 418 KAINAEAIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLI 477

Query: 498 IGKDPGKKDSLMCGLAVVXXXXXXXXXXXXXIVNLDSQDSIGEGEDKEGNEIEREKTIKR 557
           IG++ GKKDS  CGL++                              + NE+  +    R
Sbjct: 478 IGREQGKKDSFFCGLSI-----------------------------SDPNEVAEK---PR 505

Query: 558 FVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSIVIE 617
           F+SFC+IANG+S EEFK I R T G W    E PP  +LL FG++VP EWI P+DS+V+E
Sbjct: 506 FISFCTIANGLSNEEFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLE 565

Query: 618 VKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSNKRAN 677
           VKAR+++  E   +K+++G TL+ GYC+QIR DKDWKT  + SE   MK  +   NKR  
Sbjct: 566 VKARAIDTKESEKRKYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKR-- 623

Query: 678 NDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISDVVDATG-SRVS 736
              +H +   K+R ++R   G     E T      S  F    F VISD  D+T   R+S
Sbjct: 624 --KSHQVTDGKKRASKRAKIGIVNSSEPTALVAPVSNTFSNCRFRVISDYFDSTKRRRIS 681

Query: 737 REELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVLDCI 796
           +E+L   IL  GG IV+     +  ++   I+  K T EC+ L++    II P W+  CI
Sbjct: 682 QEDLCSVILEHGGEIVYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCI 741

Query: 797 KDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIERNVRSLRNAPP 856
           ++        K  F  S+      +  +D     F    +  S + L+E   R ++N   
Sbjct: 742 EEGY------KTPFTESDIFRGELESSMD--CSQFYTDFNTASLNHLLETANRGIKNPDS 793

Query: 857 SIQYDMVDTVPLFLFYGRTILLRIKDKALFT---KLKVQIRLYGGKTTGDLASCNLVVIQ 913
            +   ++  VPLFLF    + +   +  L T   +++  I+ +GG+    + + +++++ 
Sbjct: 794 DL---LLPEVPLFLFSNLKLAVLNSENVLDTSILEVEFAIKCHGGELV-HIENASIIIV- 848

Query: 914 QNEIAVAKDVRSSLLKLTS-----DTDKPPVLPYIVTPEWIDSSISEGCQVPEEDH 964
            N+    +D+ S   K+ S      T+  P +P +V   W   SI +   + E +H
Sbjct: 849 FNDFISREDLFSLRQKIASKAVKESTESTPRIPRMVDISWALDSIKDN-YIAETEH 903

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  104 bits (259), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 78/276 (28%), Positives = 132/276 (47%), Gaps = 15/276 (5%)

Query: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHD- 292
           +D    V + + V N   +  +   N    +  G P  P  AK  S S  ++  +   + 
Sbjct: 293 RDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKP-SKSITEVLDRFHGEK 351

Query: 293 FFIEEKMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGE-SIKDGTVSKYLHLDNNVQNC 351
           F  E K DGER Q+H    G+ ++  SR G + T  Y E  I+D     YL       + 
Sbjct: 352 FTCEYKYDGERAQVHLLPDGS-MNIYSRNGENMTERYPELHIRD-----YLADPETTHSL 405

Query: 352 VLDGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNI 411
           +LD E V +D E+  +LPF ++ +  R  +  + V     R  L  FD++  NG SL+N 
Sbjct: 406 ILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVK---VRVCLFAFDMLCYNGQSLINN 462

Query: 412 PLYQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGV---VLKHYNSR 468
            L +R+ YL+++  P     +       S+   ++  LE ++    EG+   VL+   S 
Sbjct: 463 SLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESH 522

Query: 469 YTVASRNDDWIKVKPEYLEQFGENMDLIVIGKDPGK 504
           Y  + R+ +W+K+K +YL+  G+++DL V+G   G+
Sbjct: 523 YEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGR 558

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 109/447 (24%), Positives = 187/447 (41%), Gaps = 72/447 (16%)

Query: 211 IILKSRVIGGHEH-------KFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLKNDDLT 263
           ++  S+ I  HEH         ++      +D    V + + V N   +  +        
Sbjct: 286 LVALSKAILTHEHGGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCV 345

Query: 264 INVGSPFAPQSAKKLSISYEKICAKLK-HDFFIEEKMDGERIQLHYQDYGNKLSFLSRRG 322
           +  G P  P  AK  S S  ++  + +   F  E K DGER Q+H    G+ +   SR G
Sbjct: 346 LTPGIPLKPMLAKP-SKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGS-MRIYSRNG 403

Query: 323 TDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSARSIIT 382
            + T  Y E      +S ++   +     +LD E V +DK++N +LPF ++ +  R  + 
Sbjct: 404 ENMTERYPEI----NISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVV 459

Query: 383 QEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKRCSDE 442
            E V     R  L  FD++  N   L+N  L +R+ YLE+I  P    ++L         
Sbjct: 460 AEDVK---VRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSL 516

Query: 443 RSIKNALEHAISIGSEGVVLKHYN---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVIG 499
             ++  L+ ++    EG+++K  +   S Y  + R+ +W+K+K +YL+  G+++DL V+G
Sbjct: 517 DEMQLYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLG 576

Query: 500 K--DPGKKDSLMCGLAVVXXXXXXXXXXXXXIVNLDSQDSIGEGEDKEGNEIEREKTIKR 557
                GK+     G                 ++   +QD+ GE                 
Sbjct: 577 AYYGRGKRTGTYGGF----------------LLGCYNQDT-GE----------------- 602

Query: 558 FVSFCSIANGISQEEFKYIGRITKGCWKK--SDEIPPPSDLLEFG-SRVPAEWIDPKDSI 614
           F + C I  G S E       + +  ++K    EIP P     +  S  P  W++P  S+
Sbjct: 603 FETCCKIGTGFSDE-------MLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEP--SM 653

Query: 615 VIEVKARSLNNDEEATKKFKTGITLYG 641
           + EV    L  D   +  +K G + YG
Sbjct: 654 LFEV----LTADLSLSPVYKAGGSSYG 676

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 77/270 (28%), Positives = 127/270 (47%), Gaps = 13/270 (4%)

Query: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDF 293
           +D    V + + V N   D  +   ++  TI  G P  P  AK      E +       F
Sbjct: 324 RDAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPMLAKPTKAINEVLDRFQGQTF 383

Query: 294 FIEEKMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGE-SIKDGTVSKYLHLDNNVQNCV 352
             E K DGER Q+H    G  +   SR G + T  Y E  IKD     +L    +  + +
Sbjct: 384 TSEYKYDGERAQVHLLKDGT-MRIYSRNGENMTERYPEIQIKD-----FLADPASTTSLI 437

Query: 353 LDGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIP 412
           LD E V +DKE+N +LPF ++ +  R  +    V     R  L  FD++  N + L+N P
Sbjct: 438 LDCEAVAWDKEQNKILPFQVLTTRKRKDVNINEVK---VRVCLFAFDILLHNDMRLINEP 494

Query: 413 LYQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SRY 469
           L +R+  L ++  P     +       S+   ++  L+ ++    EG+++K  +   S Y
Sbjct: 495 LSKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMVKMMDGVESYY 554

Query: 470 TVASRNDDWIKVKPEYLEQFGENMDLIVIG 499
             + R+ +W+K+K +YLE  G+++DL V+G
Sbjct: 555 EPSKRSRNWLKLKKDYLEGVGDSLDLCVLG 584

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 77/254 (30%), Positives = 126/254 (49%), Gaps = 16/254 (6%)

Query: 263 TINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFLSRRG 322
           T+  G P  P  AK      E + A    +F  E K DGER Q+H  + G ++   SR G
Sbjct: 352 TLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNG 410

Query: 323 TDYTYLYGE-SIKDG-TVSKYLHLDNN-------VQNCVLDGEMVTFDKERNALLPFGLV 373
            + T  Y E  +KD   V K +  D         V++ +LD E+V +D E+  +LPF ++
Sbjct: 411 ENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVL 470

Query: 374 KSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVEL 433
            +  R  +  + V     R  L  FDL+YLN   ++N  L +R+  L K+        + 
Sbjct: 471 TTRKRKNVDLKDVK---VRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQY 527

Query: 434 LRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SRYTVASRNDDWIKVKPEYLEQFG 490
             S   SD   ++  L+ A+    EG+++K  +   S Y  + R+ +W+K+K +YL+  G
Sbjct: 528 ATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVG 587

Query: 491 ENMDLIVIGKDPGK 504
           +++DL+V+G   GK
Sbjct: 588 DSLDLVVMGAYFGK 601

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 108/428 (25%), Positives = 182/428 (42%), Gaps = 56/428 (13%)

Query: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDF 293
           +D    V + + +     +  +   +++  +  G P  P  AK      E + A    +F
Sbjct: 322 RDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEF 381

Query: 294 FIEEKMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGE-SIKDGTVSKYLHLDNNVQNCV 352
             E K DGER Q+H    G ++   SR G + T  Y E  I+D  V    + D  V + +
Sbjct: 382 TCEYKYDGERGQVHLLSNG-EMRIYSRNGENMTERYPELHIEDFLVKDESNTDKEV-SLI 439

Query: 353 LDGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIP 412
           LD E+V +D E+N +LPF ++ +  R  +  + V     R  L  FD++Y NG  L+   
Sbjct: 440 LDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVK---VRVCLFAFDILYYNGEGLITKT 496

Query: 413 LYQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SRY 469
           L +R+  L ++        +   S   ++   I+  L+ AI    EG+++K  +   SRY
Sbjct: 497 LRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRY 556

Query: 470 TVASRNDDWIKVKPEYLEQFGENMDLIVIGK--DPGKKDSLMCGLAVVXXXXXXXXXXXX 527
             + R+ +W+K+K +YL   G+++DL V+G     GK+     G                
Sbjct: 557 EPSKRSRNWLKLKKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGF--------------- 601

Query: 528 XIVNLDSQDSIGEGEDKEGNEIEREKTIKRFVSFCSIANGISQEEFKYIGRITKGCWKKS 587
            ++   +QDS GE E                 + C I  G S E    +  +      + 
Sbjct: 602 -LLGCYNQDS-GEYE-----------------TCCKIGTGFSDEMLTKLYELF-----RE 637

Query: 588 DEIPPPSDLLEFGSRV-PAEWIDPKDSIVIEVKARSLNND---EEATKKFKTGITLYGGY 643
           +EI  P     F S   P  W +PK  ++ EV    L+     +  +  +  GI+L    
Sbjct: 638 EEIEVPKSFYNFDSSAEPDIWFEPK--VLFEVLTADLSLSPIYKAGSATYDKGISLRFPR 695

Query: 644 CRQIREDK 651
             +IR+DK
Sbjct: 696 FLRIRDDK 703

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 71/270 (26%), Positives = 129/270 (47%), Gaps = 13/270 (4%)

Query: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDF 293
           +D    V + + V N      +   N+  ++  G P  P  AK  + +  +I  + + + 
Sbjct: 365 RDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPGIPLKPMLAKP-TKAINEILDRFQGET 423

Query: 294 FIEE-KMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCV 352
           F  E K DGER Q+H  + G  +   SR G + T  Y E      +  ++   N  +  +
Sbjct: 424 FTSEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERYPEI----HIGDFVKDRNETKTLI 478

Query: 353 LDGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIP 412
           LD E V +DKE+  +LPF ++ +  R  +  + V     R  L  FD++  N   L+N  
Sbjct: 479 LDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVK---VRVCLFAFDILCHNSNKLINYS 535

Query: 413 LYQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SRY 469
           L +R+  L ++ TP     +       S+   ++  L+ +++   EG+++K      S Y
Sbjct: 536 LKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHY 595

Query: 470 TVASRNDDWIKVKPEYLEQFGENMDLIVIG 499
             + R+ +W+K+K +YLE  G+++DL V+G
Sbjct: 596 EPSKRSRNWLKLKKDYLEGIGDSLDLCVLG 625

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 101/416 (24%), Positives = 172/416 (41%), Gaps = 63/416 (15%)

Query: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLK-HD 292
           +D    V + + V     +  +   +    +  G P  P  AK  S S  ++  + +   
Sbjct: 324 RDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPLKPMLAKP-SKSISEVLDRFQGQR 382

Query: 293 FFIEEKMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCV 352
           F  E K DGER Q+H    G+ +   SR G + T  Y E      +S ++         +
Sbjct: 383 FTCEYKYDGERAQVHLLPDGS-MRIYSRNGENMTERYPEI----RISDFIADPARTHTLI 437

Query: 353 LDGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIP 412
           LD E V +DKE+N +LPF ++ +  R  +  E V     R  L  FD++  N   L+  P
Sbjct: 438 LDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVK---VRVCLFAFDILCYNDEPLITRP 494

Query: 413 LYQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGV---VLKHYNSRY 469
           L +R+  LE+   P    ++L           +++ L+ A+    EG+   +L+   S Y
Sbjct: 495 LAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMVKILEGEESHY 554

Query: 470 TVASRNDDWIKVKPEYLEQFGENMDLIVIGK--DPGKKDSLMCGLAVVXXXXXXXXXXXX 527
             + R+ +W+K+K +YL+  G+++DL V+G     GK+     G                
Sbjct: 555 EPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGF--------------- 599

Query: 528 XIVNLDSQDSIGEGEDKEGNEIEREKTIKRFVSFCSIANGISQEEFKYI-GRITKGCWKK 586
            ++   +QDS GE E                 + C I  G S+E  + +  R++      
Sbjct: 600 -LLGCYNQDS-GEYE-----------------TCCKIGTGFSEEMLQTLFDRLS------ 634

Query: 587 SDEIPPPSDLLEFGSRVPAE-WIDPKDSIVIEVKARSLNNDEEATKKFKTGITLYG 641
              IP P          P + W +P  +++ EV    L  D   +  +K G + YG
Sbjct: 635 PTAIPTPKAFYVHSESAPPDVWFEP--TLLFEV----LTADLSLSPVYKAGTSSYG 684

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 111/461 (24%), Positives = 188/461 (40%), Gaps = 71/461 (15%)

Query: 211 IILKSRVIGGHEHKFLNVWHPDAQ----------DYLSVVSDLKTVANKLWDPAVHLKND 260
           +I  S+ I  HEH   N   P  +          D    V + + + N      +   N 
Sbjct: 271 LISVSKAILTHEH---NGQEPSTEMVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQ 327

Query: 261 DLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFLSR 320
            + +  G P  P  AK      E +       F  E K DGER Q+H    G+ +   SR
Sbjct: 328 HIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGS-MKIYSR 386

Query: 321 RGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSARSI 380
            G D T  Y E      V  Y+      ++ ++D E V +D+E+  +LPF ++ +  R  
Sbjct: 387 NGEDMTERYPEI----DVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKG 442

Query: 381 ITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKRCS 440
           +  + V     R  L  FD++ LN   L+N   ++R+  L   F   +   +       +
Sbjct: 443 VELKDVK---VRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTT 499

Query: 441 DERSIKNALEHAISIGSEGVVLKHYN---SRYTVASRNDDWIKVKPEYLEQFGENMDLIV 497
           +   ++  L+ ++    EG+++K      S Y  + R+ +W+K+K +YLE  G+++DL+V
Sbjct: 500 NFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVV 559

Query: 498 IGK--DPGKKDSLMCGLAVVXXXXXXXXXXXXXIVNLDSQDSIGEGEDKEGNEIEREKTI 555
           +G     GK+     G  +                NLDS++                   
Sbjct: 560 LGAYYGRGKRTGTYGGFLL-------------GCYNLDSEE------------------- 587

Query: 556 KRFVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAE-WIDPKDSI 614
             F + C I  G S E  + +   TK    K   +  PS  + + S  PA+ W +P  S+
Sbjct: 588 --FETCCKIGTGFSDEMLQDL--YTK---LKDTTVEHPSTNVIYDSSAPADVWFEP--SM 638

Query: 615 VIEVKARSLNND---EEATKKFKTGITLYGGYCRQIREDKD 652
           + EV    L+     +   + F  GI+L      +IR+DK+
Sbjct: 639 LFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKN 679

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/304 (24%), Positives = 134/304 (44%), Gaps = 18/304 (5%)

Query: 211 IILKSRVIGGHEH-------KFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLKNDDLT 263
           ++  S+ I  HEH       + ++      +D    V + + + N      +        
Sbjct: 267 LVALSKAILTHEHDGKEPSPEQVDAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQHCV 326

Query: 264 INVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFLSRRGT 323
           +  G P  P  AK      E +       F  E K DGER Q+H  + G  +   SR   
Sbjct: 327 LTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGT-IRIYSRNSE 385

Query: 324 DYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSARSIITQ 383
           + T  Y E        ++L      ++ ++D E V +D E+  +LPF ++ +  R  +  
Sbjct: 386 NMTERYPEI----QFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVEL 441

Query: 384 EGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKRCSDER 443
           + V     R  L  FDL+YLNG SL+   L  R+ +L  +       ++        +  
Sbjct: 442 KDVK---VRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELS 498

Query: 444 SIKNALEHAISIGSEGVVLKHYN---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGK 500
            ++  LE ++S   EG+++K  +   S+Y  + R+ +W+K+K +YLE  G+++DL V+G 
Sbjct: 499 ELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGA 558

Query: 501 DPGK 504
             G+
Sbjct: 559 YYGR 562

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 74/271 (27%), Positives = 129/271 (47%), Gaps = 16/271 (5%)

Query: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDF 293
           +D    V + + V N   +  +   +    +  G P  P  AK      E +  + +   
Sbjct: 333 RDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKPTKAITE-VLDRFQGQL 391

Query: 294 FIEE-KMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGE-SIKDGTVSKYLHLDNNVQNC 351
           F+ E K DGER QLH    G  +   SR G + T  Y E  I+D     +L  D + ++ 
Sbjct: 392 FVSEYKYDGERAQLHLLPDGT-MRIYSRNGENMTERYPEIDIRD-----FLS-DPSTESL 444

Query: 352 VLDGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNI 411
           +LD E V +DKE+  +LPF ++ +  R  +  + V     R  L  FDL+  NG  L+N 
Sbjct: 445 ILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDVK---VRVCLFAFDLLCHNGEPLINK 501

Query: 412 PLYQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SR 468
            L +R+  L+K+  P             ++   +++ L+ ++    EG+++K  +   S 
Sbjct: 502 SLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDGPESH 561

Query: 469 YTVASRNDDWIKVKPEYLEQFGENMDLIVIG 499
           Y  + R+ +W+K+K +YL   G+++DL V+G
Sbjct: 562 YEPSKRSRNWLKLKKDYLNGVGDSLDLCVLG 592

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 101/394 (25%), Positives = 161/394 (40%), Gaps = 64/394 (16%)

Query: 254 AVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGN 313
           A H+K     +  G P  P  AK      E +       F  E K DGER Q+H    G+
Sbjct: 345 ASHIK-----LTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQVHLLPDGS 399

Query: 314 KLSFLSRRGTDYTYLYGE-SIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGL 372
            +   SR G D T  Y E +I+D     YL         +LD E V +D E   +LPF +
Sbjct: 400 -MRIYSRNGEDMTQRYPELNIQD-----YLVDSTTTTQLILDCEAVAWDVELQKILPFQV 453

Query: 373 VKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVE 432
           + +  R  +  + +     R  L  FD++  N  SL+N  L +R+  L  I  P     +
Sbjct: 454 LSTRKRKSVDLKDIK---VRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQ 510

Query: 433 LLRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SRYTVASRNDDWIKVKPEYLEQF 489
                  S+   ++  L+ AI    EG+++K  +   S Y  + R+ +W+K+K +YL+  
Sbjct: 511 FATELTTSNLDELQTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGM 570

Query: 490 GENMDLIVIGK--DPGKKDSLMCGLAVVXXXXXXXXXXXXXIVNLDSQDSIGEGEDKEGN 547
           G+++DL V+G     GK+     G  +                N D+++           
Sbjct: 571 GDSLDLCVLGAYYGRGKRTGTYGGFLLA-------------CYNQDTEE----------- 606

Query: 548 EIEREKTIKRFVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEW 607
                     F + C I  G S E  + +    K    +S    P ++ +   S  P  W
Sbjct: 607 ----------FETCCKIGTGFSDEMLQTLYNGLKETAIES----PRANFVFDSSAEPDVW 652

Query: 608 IDPKDSIVIEVKARSLNNDEEATKKFKTGITLYG 641
            +P  ++V EV    L  D   +  +K G T+YG
Sbjct: 653 FNP--TMVFEV----LTADLSLSPIYKAGSTVYG 680

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 125/269 (46%), Gaps = 11/269 (4%)

Query: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDF 293
           +D    V + + V N   +  +   +   T+  G P  P  AK      E +       F
Sbjct: 355 RDAFCQVPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETF 414

Query: 294 FIEEKMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVL 353
             E K DGER Q+H  D G  +   SR G + T  Y E IK   ++ ++   +  +N +L
Sbjct: 415 TSEYKYDGERAQVHLLDDGT-MRIYSRNGENMTERYPE-IK---ITDFIQDLDATKNLIL 469

Query: 354 DGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPL 413
           D E V +DKE+  +LPF ++ +  R  +    V     R  L  FD++  NG  L+N  L
Sbjct: 470 DCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVK---VRVCLFAFDVLCHNGERLINKSL 526

Query: 414 YQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SRYT 470
            +R+  L K+        +        +   ++  L+ +++   EG+++K      S Y 
Sbjct: 527 RERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEGPESHYE 586

Query: 471 VASRNDDWIKVKPEYLEQFGENMDLIVIG 499
            + R+ +W+K+K +YLE  G+++DL V+G
Sbjct: 587 PSKRSRNWLKLKKDYLEGVGDSLDLCVLG 615

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/269 (26%), Positives = 128/269 (47%), Gaps = 11/269 (4%)

Query: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDF 293
           +D    V + + V N   +  +   +   T+  G P  P  AK      E +       F
Sbjct: 355 RDAFCQVPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETF 414

Query: 294 FIEEKMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVL 353
             E K DGER Q+H  + G  +   SR G + T  Y E IK   ++ ++   N+ +N +L
Sbjct: 415 TSEYKYDGERAQVHLLNDGT-MRIYSRNGENMTERYPE-IK---ITDFIQDLNSTKNLIL 469

Query: 354 DGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPL 413
           D E V +DKE+  +LPF ++ +  R  +    V     +  L  FD++  N   L+N  L
Sbjct: 470 DCEAVAWDKEQKKILPFQILSTRKRKDVELHDVK---VKVCLFAFDILCYNDERLINKSL 526

Query: 414 YQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SRYT 470
            +R+ +L K+        +       ++   ++  L+ +++   EG+++K  +   S Y 
Sbjct: 527 RERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYE 586

Query: 471 VASRNDDWIKVKPEYLEQFGENMDLIVIG 499
            + R+ +W+K+K +YLE  G+++DL V+G
Sbjct: 587 PSKRSRNWLKLKKDYLEGVGDSLDLCVLG 615

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 130/274 (47%), Gaps = 11/274 (4%)

Query: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDF 293
           +D    V + + V N   +  +   +   T+  G P  P  AK      E +       F
Sbjct: 445 RDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETF 504

Query: 294 FIEEKMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVL 353
             E K DGER Q+H  + G  +   SR G + T  Y E IK   ++ ++   +  +N +L
Sbjct: 505 TSEYKYDGERAQVHLLNDGT-MRIYSRNGENMTERYPE-IK---ITDFIQDLDITKNLIL 559

Query: 354 DGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPL 413
           D E V +DK++  +LPF ++ +  R  +    V     R  L  FD++  N   L+N+ L
Sbjct: 560 DCEAVAWDKDQAKILPFQVLSTRKRKDVELNDVK---VRVCLFAFDILCHNDERLINMSL 616

Query: 414 YQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SRYT 470
            +R+ YL K+        +       ++   ++  L+ +++   EG+++K  +   S Y 
Sbjct: 617 RERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLDESVNHSCEGLMVKMLDGSESHYE 676

Query: 471 VASRNDDWIKVKPEYLEQFGENMDLIVIGKDPGK 504
            + R+ +W+K+K +YLE  G+++DL V+G   G+
Sbjct: 677 PSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGR 710

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 68/269 (25%), Positives = 124/269 (46%), Gaps = 11/269 (4%)

Query: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDF 293
           +D    V + + V N   +  +   +   T+  G P  P  AK      E +       F
Sbjct: 355 RDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETF 414

Query: 294 FIEEKMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVL 353
             E K DGER Q+H  + G  +   SR G + T  Y E      ++ ++   +  +N +L
Sbjct: 415 TSEYKYDGERAQVHLLNDGT-MRIYSRNGENMTERYPEI----NITDFIQDLDTTKNLIL 469

Query: 354 DGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPL 413
           D E V +DK++  +LPF ++ +  R  +    V     +  L  FD++  N   L+N  L
Sbjct: 470 DCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVK---VKVCLFAFDILCYNDERLINKSL 526

Query: 414 YQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SRYT 470
            +R+ YL K+        +       ++   ++  L+ +++   EG+++K      S Y 
Sbjct: 527 KERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYE 586

Query: 471 VASRNDDWIKVKPEYLEQFGENMDLIVIG 499
            + R+ +W+K+K +YLE  G+++DL V+G
Sbjct: 587 PSKRSRNWLKLKKDYLEGVGDSLDLCVLG 615

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 125/275 (45%), Gaps = 13/275 (4%)

Query: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDF 293
           +D    V + + V N   D  +   +    +  G P  P  AK      E +       F
Sbjct: 306 RDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTF 365

Query: 294 FIEEKMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGE-SIKDGTVSKYLHLDNNVQNCV 352
             E K DGER Q+H  + G  +   SR G + T  Y E SI+D     ++    + +  +
Sbjct: 366 TSEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERYPEISIRD-----FVADLEHTKTLI 419

Query: 353 LDGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIP 412
           LD E V +DK +  +LPF ++ +  R  +  + V     R  L  FD++  NG   +N  
Sbjct: 420 LDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVK---VRVCLFAFDIICHNGERQINKS 476

Query: 413 LYQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SRY 469
           L +R+  L ++  P     +       S    ++  L+ ++    EG+++K  +   S Y
Sbjct: 477 LRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPESHY 536

Query: 470 TVASRNDDWIKVKPEYLEQFGENMDLIVIGKDPGK 504
             + R+ +W+K+K +YL+  G+++DL V+G   G+
Sbjct: 537 EPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYGR 571

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 126/279 (45%), Gaps = 32/279 (11%)

Query: 243 LKTVANKLWDPAVHLKNDDLTINV-----------------GSPFAPQSAKKLSISYEKI 285
           L+T   K+ D    + N ++ IN                  G P  P  AK  + +  +I
Sbjct: 346 LETAEQKIRDAFCQVPNYEIVINSCLKYGIMELETHCSLRPGIPLKPMLAKP-TKAINEI 404

Query: 286 CAKLKHDFFIEE-KMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGE-SIKDGTVSKYLH 343
             + + + F  E K DGER Q+H    G  +   SR G + T  Y E  I+D      + 
Sbjct: 405 LDRFQGEIFTSEYKYDGERAQVHLLSDGT-MRIYSRNGENMTERYPEIHIRDFIADPLV- 462

Query: 344 LDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYL 403
                   +LD E V +D E+N +LPF ++ +  R  +  + V     +  L  FD++  
Sbjct: 463 ----TSTLILDCEAVAWDNEQNKILPFQVLSTRKRKDVDLKDVK---VKVCLFAFDILCH 515

Query: 404 NGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLK 463
           N   L+N  L +R+  L+++        +       S+   ++  L+ ++    EG+++K
Sbjct: 516 NDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVK 575

Query: 464 HYN---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVIG 499
             +   S Y  + R+ +W+K+K +YLE  G+++DL VIG
Sbjct: 576 MLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIG 614

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 101/210 (48%), Gaps = 11/210 (5%)

Query: 293 FFIEEKMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCV 352
           F  E K DGER Q+H  + G  +   SR G + T  Y E      V+   H     ++ +
Sbjct: 386 FTCEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERYPEIHIRDFVTDLSH----TKSLI 440

Query: 353 LDGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIP 412
           LD E V +DKE+N +LPF ++ +  R  +    +     R  L  FD++  N   L+N  
Sbjct: 441 LDCEAVAWDKEQNKILPFQVLSTRKRKDV---DINEIKVRVCLFAFDILLHNDEKLINKS 497

Query: 413 LYQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SRY 469
           L +R+  L  I        +       ++   +++ L+ ++    EG+++K      S Y
Sbjct: 498 LQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEGEESHY 557

Query: 470 TVASRNDDWIKVKPEYLEQFGENMDLIVIG 499
             + R+ +W+K+K +YL   G+++DL V+G
Sbjct: 558 EPSKRSRNWLKLKKDYLAGVGDSLDLCVLG 587

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 127/276 (46%), Gaps = 15/276 (5%)

Query: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDF 293
           +D    + + + V N      +   ++  ++  G P  P  AK      E         F
Sbjct: 310 RDAFCQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHF 369

Query: 294 FIEEKMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVL 353
             E K DGER Q+H  + G+ +   SR G + T  Y E      V+ ++   N  ++ ++
Sbjct: 370 TSEYKYDGERAQVHLMNDGS-MRIYSRNGENMTERYPEI----NVTDFIKDLNLTKSLII 424

Query: 354 DGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPL 413
           D E V +D+E   +LPF ++ +  R  +    + +   R  L  FD++  N   L+N  L
Sbjct: 425 DCEAVAWDREEKKILPFQVLSTRKRKDV---DIKDIKVRICLFAFDILCHNDEKLINKSL 481

Query: 414 YQRKLYLEKIFTPERHIVELLRSKRCSDER--SIKNALEHAISIGSEGV---VLKHYNSR 468
            +R+  L  + T E H  E   +K  S      ++  L+ ++    EG+   VL   +S 
Sbjct: 482 RERREILHSV-TREVH-GEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSH 539

Query: 469 YTVASRNDDWIKVKPEYLEQFGENMDLIVIGKDPGK 504
           Y  + R+ +W+K+K +YL+  G+++DL V+G   G+
Sbjct: 540 YEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAFYGR 575

>CAGL0D06050g Chr4 (573888..575462) [1575 bp, 524 aa] {ON} similar
           to uniprot|P47114 Saccharomyces cerevisiae YJR054w
          Length = 524

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 41/83 (49%), Gaps = 4/83 (4%)

Query: 327 YLYGESIKDGTVSKYLHL---DNNVQNCVLDGEMVTFDKERNALLPFG-LVKSSARSIIT 382
           +L   SI+DG+ S+   L   +  V+N V+DG  +  D + NA   F    +++AR+   
Sbjct: 326 HLVNSSIEDGSTSEEYELMYEEPMVRNSVIDGNDLLLDSKFNAKRDFNQYYQNAARNQSN 385

Query: 383 QEGVANEGYRPLLMVFDLVYLNG 405
            + V  E Y P   V D  Y NG
Sbjct: 386 SQDVIKEEYEPNFDVMDYAYSNG 408

>ZYRO0G15180g Chr7 (1223984..1226050) [2067 bp, 688 aa] {ON} similar
           to uniprot|P47027 Saccharomyces cerevisiae YJL090C DPB11
           Essential BRCT repeat protein required on the
           prereplicative complex at replication origins for
           loading DNA polymerases to initiate DNA synthesis also
           required for S/M checkpoint control
          Length = 688

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 777 QSLIDRGYDIIEPQWVLDCIKDDMLLKLEPKYCFNVSE 814
           ++ ++ G  II P+WVLDC K + LL+ +P Y     E
Sbjct: 166 KAAMELGIPIIHPKWVLDCHKRNALLEFDPYYLLETIE 203

>KAFR0K01660 Chr11 (347950..349728) [1779 bp, 592 aa] {ON} Anc_3.447
           YGR103W
          Length = 592

 Score = 35.4 bits (80), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 41/96 (42%), Gaps = 12/96 (12%)

Query: 710 LDQSRIFDGLYFYVISDVVDATGSRVSREELYDKILNRGGVIVHNVIAKH-HGENQFRIL 768
           L Q   FD     + SD V   G  V  + +   IL+ GG ++  V   H   E + ++ 
Sbjct: 337 LAQPTEFDSPVATLFSDFVFFIGREVPTDIVEFLILSCGGTVITEVALDHVDDEKKEKMD 396

Query: 769 CGKYTAECQSLIDR--------GYDIIEPQWVLDCI 796
             K T     ++DR        G   I+PQW+ DCI
Sbjct: 397 LSKIT---HQIVDRPVLKNKVAGRTYIQPQWIFDCI 429

>Kpol_367.9 s367 complement(31451..34093) [2643 bp, 880 aa] {ON}
           complement(31451..34093) [2643 nt, 881 aa]
          Length = 880

 Score = 35.4 bits (80), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 57/272 (20%), Positives = 102/272 (37%), Gaps = 45/272 (16%)

Query: 673 NKRANNDATHALDSSKRRKARRIDYGFEKYFEQTP-------TTLDQSRIFDGLYFYVIS 725
           NK  N+D      + KR+   R DY  +K  +Q            D+ +IF+    Y+  
Sbjct: 45  NKNTNDDDLSKKQNPKRKNYTRGDYFRDKRAKQAKQDKILLNNNKDKLKIFENCTIYI-- 102

Query: 726 DVVDATGSRVSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYD 785
                  +   R +L++ I+  GG  +H + AK        I+  K   + + L    Y 
Sbjct: 103 ----NGHTNPDRLKLHELIVIHGGKFLHFLSAKGSAT---HIVASKLPLK-KKLEYANYK 154

Query: 786 IIEPQWVLDCIKDDMLLKLEPKYCF----NVSEELMKIAKRRVDGFGDSFEAQISEDSF- 840
           ++ P W+++ I    LL  + +Y      N  +  +K+    +     S     ++ SF 
Sbjct: 155 VVNPDWIMNSINAGKLLPWQ-EYSLVSDVNFGQSKLKLKNLEIKNGDTSSVINCNDPSFI 213

Query: 841 ----------------SRLIERNVRSLRNAPPSIQYDMVDTVPLF-----LFYGRTILLR 879
                           S L    V+ L ++    +    DT+ +F      F+     L 
Sbjct: 214 ENYFKNSRLHHLSTWKSELRSNFVQDLLSSNTRRKIQKEDTLKIFHVDFDCFFATVAALS 273

Query: 880 IKDKALFTKLKVQIRLYGGKTTGDLASCNLVV 911
           + D A+       +  +G K + D+ASCN V 
Sbjct: 274 VTDMAIDINKDAILVCHGSKNS-DIASCNYVA 304

>TDEL0D01440 Chr4 complement(282138..283949) [1812 bp, 603 aa] {ON}
           Anc_1.276 YJL090C
          Length = 603

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 774 AECQSLIDRGYDIIEPQWVLDCIKDDMLLKLEPKYCF-NVSEE--LMKIAKRRVDGFGD 829
           A  Q+ I++G  I+  +W+LDC + +  L+ +P Y   N+ E     KI +   + +GD
Sbjct: 174 ARVQAAIEQGIPIVHYKWILDCQRRNATLEYDPYYLVSNIPENTPFEKIGRESCECWGD 232

>Kwal_56.24113 s56 complement(855380..856789) [1410 bp, 469 aa] {ON}
           YGL130W (CEG1) - mRNA guanylyltransferase (mRNA capping
           enzyme), alpha subunit [contig 166] FULL
          Length = 469

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 46/104 (44%), Gaps = 16/104 (15%)

Query: 396 MVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKRC---------------S 440
           ++FD + +NG  +   P   R  +L K F    + +  L   +C               +
Sbjct: 145 LMFDCLAINGRCIAQSPTSSRLAHLGKEFFKPYYDLRSLYPAQCATFPFKLSMKHMSFST 204

Query: 441 DERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPE 484
           D   + N+LEH   + S+G++     + Y++ S++   +K KPE
Sbjct: 205 DLAKVANSLEHLPHV-SDGLIFTPVTTAYSIGSKDSLLLKWKPE 247

>CAGL0G07843g Chr7 (744599..746395) [1797 bp, 598 aa] {ON} highly
           similar to uniprot|P53261 Saccharomyces cerevisiae
           YGR103w
          Length = 598

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 44/113 (38%), Gaps = 14/113 (12%)

Query: 699 FEKYFEQTPTTLDQSRIFDGLYFYVISDVVDATGSRVSREELYDKILNRGG-VIVHNVIA 757
           FE + +     L Q   F      +  D V   G  V  E +   IL+ GG VI    + 
Sbjct: 325 FEDHNKNKGDILAQPSKFSSPTATLFEDFVFYVGREVPIEAIEFLILSCGGKVISEAAMD 384

Query: 758 KHHGENQFRILCGKYTAECQSLIDR--------GYDIIEPQWVLDCIKDDMLL 802
           +  G  +F +     +     ++DR        G   I+PQWV DCI    LL
Sbjct: 385 QIEGNTEFDL-----SKVTHQIVDRPVLKHKVAGRTYIQPQWVFDCINKGELL 432

>Skud_10.124 Chr10 complement(230827..233124) [2298 bp, 765 aa] {ON}
           YJL090C (REAL)
          Length = 765

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 774 AECQSLIDRGYDIIEPQWVLDCIKDDMLLKLEPKY 808
           A   + ID+   II  +W+LDC K + LL  +P Y
Sbjct: 184 ARVNAAIDQNLPIIHFKWILDCQKRNALLPYDPHY 218

>SAKL0G05236g Chr7 complement(429654..432614) [2961 bp, 986 aa] {ON}
           highly similar to uniprot|P32898 Saccharomyces
           cerevisiae YDR430C CYM1 Cytosolic metalloprotease
          Length = 986

 Score = 33.5 bits (75), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 47/111 (42%), Gaps = 22/111 (19%)

Query: 690 RKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISDVVDATGSRVSREELYDKILNRGG 749
           +K ++ D+G    +   P  ++++  FDG+ F  I             E+  +    +G 
Sbjct: 409 KKDQKSDFGLHLLYSLLPGWVNKTDPFDGMLFDEI------------LEQFREDFETKGD 456

Query: 750 VIVHNVIAKHHGENQFRIL---CGKYTAECQSLIDRGYDIIEPQWVLDCIK 797
            I HN+I K+       IL   C K+T E      +  D+ E Q + D I+
Sbjct: 457 AIFHNIINKY-------ILDKPCFKFTMEASETFSQNLDLEESQRLKDKIE 500

>CAGL0K04917g Chr11 complement(477054..479117) [2064 bp, 687 aa]
           {ON}
          Length = 687

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 67/147 (45%), Gaps = 15/147 (10%)

Query: 715 IFDGLYFYVISDVVDATGSRVSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKY-T 773
           IF+G+ FY+  D  +A  S +  E+L + IL  GG IV+ +  K   E +  I+   Y  
Sbjct: 83  IFNGMVFYLNRDS-NAHDSIIIVEQLKNLILLNGGDIVNKLPNKDSAEAKHIIVVSPYNN 141

Query: 774 AECQSLIDRGYDIIEPQWVLDCIKDDMLLKLE----PKYCFN-VSEELMKIAKRRVDGFG 828
            E +++           ++  C++ + LL ++    P   FN + ++ M    R+     
Sbjct: 142 TELKTVTS--------TFIRACVQSNKLLDMKNYLVPYDSFNALLDDAMSPPSRQEPTIS 193

Query: 829 DSFEAQISEDSFSRLIERNVRSLRNAP 855
           +S      + + S+   +N+ + R+ P
Sbjct: 194 ESSSVNEGQPTASKPPPQNIANKRDIP 220

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score = 33.1 bits (74), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 3/72 (4%)

Query: 664 RMKRFKLGSNKRANNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYV 723
           R +  K  ++   N++AT+   S +RR    I + F+K F++T +   Q+R++      +
Sbjct: 120 RARATKATASSINNSNATNKFSSQRRRHGGEIKFVFDKLFDETSS---QARVYKETTSPL 176

Query: 724 ISDVVDATGSRV 735
           +  V+D   S V
Sbjct: 177 LDSVLDGFNSTV 188

>CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa]
           {ON} similar to uniprot|P12688 Saccharomyces cerevisiae
           YKL126w or uniprot|P18961 Saccharomyces cerevisiae
           YMR104c ser/thr-specific protein kinases
          Length = 704

 Score = 32.7 bits (73), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 40/82 (48%), Gaps = 5/82 (6%)

Query: 768 LCG--KYTAECQSLIDRGYDIIEPQWVLDCIKDDMLLKLEPKYCFNVSEELMKIAKRRVD 825
            CG  +Y A  + L+ +GY  +   W L  +  +ML  L P Y  NVSE   KI K  + 
Sbjct: 535 FCGTPEYLAP-EVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLI 593

Query: 826 GFGDSFEAQISEDSFSRLIERN 847
            F D  +   ++D   RL+ R+
Sbjct: 594 -FPDGMDPD-AKDLLKRLLNRD 613

>Ecym_2188 Chr2 (371869..373254) [1386 bp, 461 aa] {ON} similar to
           Ashbya gossypii AFL107W
          Length = 461

 Score = 32.3 bits (72), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 396 MVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHA--- 452
           ++FD + +NG SLV  P   R  +L K F    + +  +    CS+    K +++H    
Sbjct: 145 LMFDCLAINGRSLVQSPTSSRLAHLGKEFFKPYYDLRSVYPDHCSN-FPFKLSMKHMNFS 203

Query: 453 ---ISIG---------SEGVVLKHYNSRYTVASRNDDWIKVKPE 484
              + I          S+G++    N+ Y V  ++ + +K KP+
Sbjct: 204 YDLVKIASTLDKLPHVSDGLIFTPVNTSYNVGGKDSNLLKWKPQ 247

>KAFR0C05190 Chr3 (1031636..1034326) [2691 bp, 896 aa] {ON} Anc_7.46
           YOR346W
          Length = 896

 Score = 32.0 bits (71), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 39/70 (55%), Gaps = 4/70 (5%)

Query: 733 SRVSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWV 792
           +R SR +L++ I+  GG  +H++ AK    +   I+    T + + +    Y +++P+W+
Sbjct: 121 TRPSRFQLHEMIVLNGGKFLHHLSAKRSVTH---IIASTLTLK-KKIEFANYKVVKPEWL 176

Query: 793 LDCIKDDMLL 802
           +D IK   LL
Sbjct: 177 VDSIKVKKLL 186

>KLTH0E11418g Chr5 complement(1020231..1022312) [2082 bp, 693 aa]
           {ON} some similarities with uniprot|P37838 Saccharomyces
           cerevisiae YPL043W NOP4 Nucleolar protein essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis contains four RNA
           recognition motifs (RRMs)
          Length = 693

 Score = 32.0 bits (71), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 20/42 (47%)

Query: 474 RNDDWIKVKPEYLEQFGENMDLIVIGKDPGKKDSLMCGLAVV 515
           RN  W   KPE L+Q       +V  K P K D  +CG A V
Sbjct: 135 RNMPWSVRKPEQLKQIFMRFGTVVEAKIPKKPDGKLCGFAFV 176

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 106,076,396
Number of extensions: 4779647
Number of successful extensions: 13458
Number of sequences better than 10.0: 68
Number of HSP's gapped: 13562
Number of HSP's successfully gapped: 69
Length of query: 967
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 848
Effective length of database: 39,836,145
Effective search space: 33781050960
Effective search space used: 33781050960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)