Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0I022506.15ON27127113680.0
NCAS0D026606.15ON2612179091e-124
KAFR0A050606.15ON2692298531e-115
KNAG0F028806.15ON2692408271e-111
Suva_15.1796.15ON2592258171e-110
Kpol_1045.746.15ON2572258011e-107
Skud_15.1656.15ON2572378001e-107
KLTH0C11352g6.15ON2682268011e-107
Smik_15.1736.15ON2512267981e-107
KLLA0D01023g6.15ON2682227961e-106
ZYRO0C07920g6.15ON2932177851e-104
YOR004W (UTP23)6.15ON2542317781e-104
SAKL0E01056g6.15ON2692187771e-103
ACR011C6.15ON2532187651e-102
Kwal_56.223996.15ON2742237661e-102
CAGL0E02673g6.15ON2632137581e-101
TDEL0G045406.15ON2452207561e-100
TPHA0J002806.15ON2712177251e-95
Ecym_30196.15ON2662196936e-91
TBLA0A072906.15ON2591775842e-74
Kwal_55.200895.392ON1891461732e-14
KLTH0E02860g5.392ON1891461706e-14
Kpol_1055.185.392ON1891461672e-13
NDAI0C045505.392ON1891461635e-13
TPHA0D023105.392ON1891461627e-13
NCAS0F030905.392ON1891461611e-12
AEL102W5.392ON1891461611e-12
SAKL0G07766g5.392ON1891461611e-12
CAGL0M01056g5.392ON1891461601e-12
ZYRO0A06754g5.392ON1891451602e-12
KLLA0A07018g5.392ON1891461592e-12
Ecym_74695.392ON1891461583e-12
Skud_4.6065.392ON1891461565e-12
Smik_4.5995.392ON1891461566e-12
YDR339C (FCF1)5.392ON1891461566e-12
Suva_2.5095.392ON1891461566e-12
KAFR0D042805.392ON1891461557e-12
KNAG0C052705.392ON1891461557e-12
TDEL0E023305.392ON1891451557e-12
TBLA0H017505.392ON1891461541e-11
ADL145C5.94ON875186860.031
TDEL0C047103.329ON62669711.7
KAFR0I008705.553ON20262673.3
NDAI0A025907.234ON115845668.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0I02250
         (271 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   531   0.0  
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   354   e-124
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   333   e-115
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   323   e-111
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   319   e-110
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   313   e-107
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   312   e-107
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   313   e-107
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   311   e-107
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   311   e-106
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   306   e-104
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   304   e-104
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   303   e-103
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   299   e-102
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   299   e-102
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   296   e-101
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   295   e-100
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   283   1e-95
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   271   6e-91
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   229   2e-74
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    71   2e-14
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    70   6e-14
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    69   2e-13
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    67   5e-13
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    67   7e-13
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    67   1e-12
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    67   1e-12
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    67   1e-12
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    66   1e-12
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    66   2e-12
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    66   2e-12
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    65   3e-12
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    65   5e-12
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    65   6e-12
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    65   6e-12
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    65   6e-12
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    64   7e-12
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    64   7e-12
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    64   7e-12
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    64   1e-11
ADL145C Chr4 complement(435983..438610) [2628 bp, 875 aa] {ON} S...    38   0.031
TDEL0C04710 Chr3 (853105..854985) [1881 bp, 626 aa] {ON} Anc_3.3...    32   1.7  
KAFR0I00870 Chr9 (168359..168967) [609 bp, 202 aa] {ON} Anc_5.55...    30   3.3  
NDAI0A02590 Chr1 (576657..580133) [3477 bp, 1158 aa] {ON} Anc_7....    30   8.2  

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/271 (95%), Positives = 259/271 (95%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60
           MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60

Query: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120
           ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA
Sbjct: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120

Query: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180
           SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK
Sbjct: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180

Query: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKTASNSMNENIKNREGHNDANIDD 240
           SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKTASNSMNENIKNREGHNDANIDD
Sbjct: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKTASNSMNENIKNREGHNDANIDD 240

Query: 241 XXXXXXXXXXXXTGTEIENKDKDAAEGANSE 271
                       TGTEIENKDKDAAEGANSE
Sbjct: 241 SKKKRRRKHKSKTGTEIENKDKDAAEGANSE 271

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  354 bits (909), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 189/217 (87%), Gaps = 4/217 (1%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60
           MRQKRAKSYRKQLLVYNHTF+FR PYQ+LVDNQIV DCS SNYDL KGL  TLQ+EVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60

Query: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120
           ITQCCMQALYE N+Q+AIELARRFERRRCNHNPK+PKT IECIESVVNINGQNKHRYVVA
Sbjct: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120

Query: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180
           +QD+A RRKLRQVPGVPL+HISRAVMIMEPLSD SA+VS+RKENEKLYKGLNDPK+TGVK
Sbjct: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180

Query: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKK 217
           +A +   + +K    + K       K PNPLSMKKKK
Sbjct: 181 TAAEDVKIDDKPKPKKSKYGP----KSPNPLSMKKKK 213

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  333 bits (853), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 158/229 (68%), Positives = 189/229 (82%), Gaps = 2/229 (0%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60
           MRQKRAKSYRKQLLVY+HTFKFR PYQVLVDN+IV   SNSN+DL KGLK TLQ+EVK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120
           ITQCCMQALYE  +Q+AI++A+ FERRRCNH PKEPKT IEC+ SVVN+NG+NKHRYVVA
Sbjct: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120

Query: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180
           SQD+  RR+LR+VPGVPL+HISR+VMIMEPLSD SA++S R E EKLYKGLNDPK+ G+K
Sbjct: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180

Query: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKTASNSMNENIKN 229
             +D+E   E + + ++  K+K GPKGPNPLS++KK    N   +  KN
Sbjct: 181 --LDEEEATETQGSGEKTAKKKRGPKGPNPLSVRKKVKTLNEPKQTDKN 227

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  323 bits (827), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 151/240 (62%), Positives = 194/240 (80%), Gaps = 1/240 (0%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60
           MRQKRAKSYRKQLLVYNHTF+FR PYQV++D++IVL  + S +DL K L+ T+Q+EVK+M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAEVKLM 60

Query: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120
           ITQCCMQALY  NN+ AI++A+R+ERRRCNH PK+PK+  ECIESVV+I G+NKHRY+VA
Sbjct: 61  ITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIVA 120

Query: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180
            Q++  RRKLR+VPGVPLIH+SRAVMIMEPLSD SA++S+R E +KL+ GLND K  G+K
Sbjct: 121 CQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKAAGIK 180

Query: 181 SA-VDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKTASNSMNENIKNREGHNDANID 239
           +A  +K   K KE+ + + KKRK+GPK PNPLSMKKKK   NS  +N+  ++ + D + D
Sbjct: 181 AAETEKVEDKGKEAPEAKPKKRKLGPKQPNPLSMKKKKKDGNSEQKNVGTKKDNEDDSTD 240

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  319 bits (817), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 157/225 (69%), Positives = 182/225 (80%), Gaps = 6/225 (2%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60
           MRQKRAKSYRKQLLVY+HTFKFR PYQVLVDNQ+V +CS SN+DL  GLK TLQ++VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120
           ITQCC+QALYE  N+ AI+LA++FERRRCNH+ K+PK+  ECIESVVN+NG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120

Query: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180
           SQD+  RRKLR VPGVPLIH++R+VMIMEPLS  SA+ SR  E +KLYKGLNDP     +
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 180

Query: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKTASNSMNE 225
            A+ K +  EKEST    KKRK GPK PNPLSMKKKK    S +E
Sbjct: 181 -AISKGS--EKEST---PKKRKAGPKAPNPLSMKKKKKTGPSDDE 219

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  313 bits (801), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 146/225 (64%), Positives = 183/225 (81%), Gaps = 7/225 (3%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60
           MRQ+RAKSYRKQ+LVYNHTFKFR PYQ +VD+Q+VLDC  S +D+ KGLK TLQ+EVKVM
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60

Query: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120
           ITQCCMQALY+ +NQ+AI +A+ FERRRCNH PK+PK+ +ECIES+V+I G NKHRYVVA
Sbjct: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120

Query: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180
           SQD+  RRKLR++PGVP++H+SRAVMI+EPLSD S ++S R E +KLYKGLND K T   
Sbjct: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTA-- 178

Query: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKT--ASNSM 223
             +D+   ++ E T + KK +  GPK PNPLSMKK+K+  ASN +
Sbjct: 179 -GLDEPKSEKSEKTSESKKNK--GPKQPNPLSMKKRKSKPASNEV 220

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  312 bits (800), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 155/237 (65%), Positives = 188/237 (79%), Gaps = 13/237 (5%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60
           MRQKRAKSYRKQLLVY+HTFKFR PYQVLVDNQ+V +CS SN++L  GLK TLQ++VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120
           ITQCC+QALYE  N+ AI+LA++FERRRCNH+ K+PK+  ECIESVV++NG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120

Query: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180
           SQD+  RRKLR VPGVPLIH++R+VMIMEPLS  SA+ S++ E +KL+KGLNDP      
Sbjct: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPN----- 175

Query: 181 SAVDK-ETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKTASNSMNENIKNREGHNDA 236
             V+K E V  +   +   KKRKIGPK PNPLS+KKKKT+  S NE     +G +DA
Sbjct: 176 --VEKTEKVSSESGKESAPKKRKIGPKAPNPLSVKKKKTSQPS-NET----KGEDDA 225

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  313 bits (801), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 183/226 (80%), Gaps = 3/226 (1%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60
           MRQKRAKSYRKQ+LVYNH FKFR PYQVLVD+QIV D   +++DL KGL+ TLQ+EVK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60

Query: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120
           ITQCC+QA+YE  NQDAIELA+ FERRRCNH PKE K  IEC++SVV++NG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120

Query: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180
           SQD + R+KLRQVPGVPLI+++R+VM+MEPLS  S   SR +E EKL+KGLNDPK+ G+ 
Sbjct: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180

Query: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKTASNSMNEN 226
           +  ++E  K    T+  K KRK GPKGPNPLS+KKKKT  +S +E+
Sbjct: 181 A--EEEGGKTDNGTEVSKNKRK-GPKGPNPLSIKKKKTVPDSKDES 223

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  311 bits (798), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 149/226 (65%), Positives = 181/226 (80%), Gaps = 8/226 (3%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60
           MRQKRAKSYRKQLLVY+HTFKFR PYQVLVDNQ+VL+C+ SN++L  GLK TLQ++VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120
           ITQCC+QALYE  N+ AI+LA++FERRRCNH+ K+PK+  +CIESVV+ING NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120

Query: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180
           SQD+  RRKLR VPGVPLIH++R+VM+MEPLS  SA+ S+  E  KLYKGLNDP      
Sbjct: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPN----- 175

Query: 181 SAVDK-ETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKTASNSMNE 225
             VDK + + E    +   KKRK GPK PNPLS+KKKK A ++ +E
Sbjct: 176 --VDKVQEISEGSGKESVTKKRKFGPKAPNPLSVKKKKKAYSTSDE 219

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  311 bits (796), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 144/222 (64%), Positives = 185/222 (83%), Gaps = 3/222 (1%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60
           MRQKRAKSYRKQ+LVYNHTFKFR PYQVLVD+Q+VL+  NS++D  KGL+ TLQ+EVK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60

Query: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120
           ITQCCMQ+LY+ NNQ AI+  ++FERRRCNH+PKEPK+ +EC+ SVV++NG+NKHRYVVA
Sbjct: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120

Query: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180
           +QD+  RR+LR++PGVPL++++R+VM+MEPLS+ S +VSR  E +KLYKGLNDPKF G+ 
Sbjct: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGI- 179

Query: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKTASNS 222
            A D+      E+ + + KKRK GPK PNPLSMKKKKT  ++
Sbjct: 180 -ARDENDEAGAENQENKPKKRK-GPKEPNPLSMKKKKTTEST 219

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  306 bits (785), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 145/217 (66%), Positives = 173/217 (79%), Gaps = 2/217 (0%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60
           MRQKRAKSY+KQ+LVYN+ F+FR PYQVL+D+Q+V DC  S+YDL  GLK TLQ+EVK M
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120
           ITQCCMQALY   NQDAIEL + FERRRCNH PKE K   ECI+SVVN+NG NKHRYVVA
Sbjct: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120

Query: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180
           SQD+  RRKLR+VPGVPLIH+SR+VM+MEPLS+ S++V+   E EKL KGLNDPK  G+K
Sbjct: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180

Query: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKK 217
           +    E   E ES  Q   K++ GPKGPNPLS++KK+
Sbjct: 181 TTPSVEN--ELESESQPPAKKRKGPKGPNPLSVRKKQ 215

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  304 bits (778), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 152/231 (65%), Positives = 184/231 (79%), Gaps = 7/231 (3%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60
           MRQKRAKSYRKQLLVY+HTFKFR PYQVLVDNQ+VL+C+NSN++L  GLK TLQ++VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120
           ITQCC+QALYE  N  AI LA++FERRRCNH+ K+PK+  ECIESVVNI+G NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120

Query: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180
           SQD+  RRKLR VPGVPLIH++R+VM+MEPLS  SA+ S+  E +KLYKGLNDP    ++
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180

Query: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKTASNSMNENIKNRE 231
            + D      KES     KKRK+GPK PNPLS  KKK   NS ++ +K++E
Sbjct: 181 ESGDGSG---KESI---TKKRKLGPKAPNPLS-VKKKKKVNSPSDEVKDKE 224

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  303 bits (777), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 145/218 (66%), Positives = 179/218 (82%), Gaps = 4/218 (1%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60
           MRQKRAKSYRKQ+LVYNHTFKFR PYQVLVD+QIV+    S++DLAKGLK TLQ+EVK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120
           ITQCCMQALY   +Q AIE+A+ +ERRRCNH PKE KT++ECIESVVN NG+NKHRYVVA
Sbjct: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120

Query: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180
           +QD+  RRKLR+VPGVPLI+++R+VM+MEPLS+ S ++S+ +E EKL+KGLNDPK  G+ 
Sbjct: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGL- 179

Query: 181 SAVDKETVKEKESTDQ-QKKKRKIGPKGPNPLSMKKKK 217
                E+V   +S  Q Q  K+K GPK PNPLS+K+K+
Sbjct: 180 --AHDESVDLVDSVKQKQPSKKKGGPKEPNPLSVKRKR 215

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  299 bits (765), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 141/218 (64%), Positives = 171/218 (78%), Gaps = 4/218 (1%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60
           MRQKRAK+Y+KQ+LVYNHTFKFR PYQVLVD+QIVL+ + S++DL KGLK TLQ+EVK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120
           ITQCCMQ LY+  NQDAI   + +ERRRCNH  KEPK  IEC++SVV +NGQN+HRY+VA
Sbjct: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNHV-KEPKEPIECLQSVVAVNGQNRHRYIVA 119

Query: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180
           SQD+A RR LR+VPGVPL++I+RAVM+MEPLS  S QVSR  E +KL+KGLNDPK+TG+ 
Sbjct: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179

Query: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKT 218
                   +  E     K+K   GPK PNPLSMKK+K 
Sbjct: 180 ENSAPAGAQPAEGAPTLKRK---GPKAPNPLSMKKRKV 214

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  299 bits (766), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 145/223 (65%), Positives = 174/223 (78%), Gaps = 5/223 (2%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60
           MRQKRAKSYRKQ+LVYNH FKFR PYQVLVD+QIV D   + +DL KGLK TLQ+EVK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120
           ITQCC+QA+YE N+Q+AIELA+ FERRRCNH PKE K  +EC++SVVN+NG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120

Query: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGV- 179
           +Q+   R  LR+VPGVPL+ ++R+VM+MEPLS  S  VSR +E EKL+KGLNDPKF G+ 
Sbjct: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180

Query: 180 ---KSAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKTA 219
              + A       +KE      KKRK GPKGPNPLS+KKKKT+
Sbjct: 181 LTEQPATATAATVDKEGAGAPAKKRK-GPKGPNPLSIKKKKTS 222

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  296 bits (758), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 144/213 (67%), Positives = 169/213 (79%), Gaps = 3/213 (1%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60
           MRQKRAKSYRKQLLVYNHTFKFR PYQVL+D+QIV+D + S YDL K LK TLQ+EVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60

Query: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120
           ITQCCMQALYE  N+ AI+L + FERRRC H P E  +  ECI +VV++ G+NKHRYVVA
Sbjct: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120

Query: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180
            QD+  RR LR+VPGVPL+HISR+VMIMEPLSD SA+VSR +E  KL++GLNDPK+ G+K
Sbjct: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180

Query: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSM 213
               +E  + KE T    KKRKIGPK PNPLSM
Sbjct: 181 -GEHEEEEQSKEQT--VAKKRKIGPKQPNPLSM 210

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  295 bits (756), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 148/220 (67%), Positives = 174/220 (79%), Gaps = 13/220 (5%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60
           MRQKRAK+YRKQ+LVYNHTFKFR PYQVLVDNQIVLDC  SN+DL KGL+ TLQ+EVKVM
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60

Query: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120
           ITQCCMQALYE N Q AIELA+ FERRRCNH PKEPK  IEC+ES+V +NG NKHRYVVA
Sbjct: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120

Query: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180
           SQD+ TRR LR+ PGVPL+H  R+VM+MEPLSD SA+VS   E EKL+KGLNDP+  G+K
Sbjct: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPRNAGIK 180

Query: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKTAS 220
           +   + ++K++              K PNPLS+KK+KT S
Sbjct: 181 TENPQTSIKKRT-------------KQPNPLSVKKRKTES 207

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  283 bits (725), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 172/217 (79%), Gaps = 3/217 (1%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSE-VKV 59
           MRQKRAKSY+KQ++VYNHTFKFR PYQ+LVD QIV D   SNY+L + L+ TLQ+E +KV
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 60  MITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVV 119
           MITQCCMQ LY  +NQ+ I+ A+RFERRRCNH+ K+PK  +ECIES+VNI+GQNKHRYVV
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 120 ASQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGV 179
           A+Q++  RRKLR+VPGVP++H+SR+VMIMEP+SD S +++R+ E  KLYKGLNDPK++  
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYS-- 178

Query: 180 KSAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKK 216
            +   KE   + E T     K++ G K PNPLS KKK
Sbjct: 179 MAPTPKEGTPDTEGTQPAATKKRKGVKEPNPLSKKKK 215

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  271 bits (693), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 173/219 (78%), Gaps = 3/219 (1%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60
           MRQKRAK+Y+KQ+LVYNHTFKFR PYQVLVD+Q+VL+ + S++DL KGLK TLQ+EVK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120
           ITQCC+Q LYE  NQ AI  A+ +ERRRCNH  KEPK   ECI SVV+ING+N HRYVVA
Sbjct: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNHY-KEPKEPSECIRSVVDINGRNLHRYVVA 119

Query: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180
           +QD+  RR LR+VPGVPLI+++R+VM+MEPLS  S QVS++ ENEKL KGLNDPK+ G  
Sbjct: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAGTP 179

Query: 181 SAVDKETVKEKESTDQQKKKRKI-GPKGPNPLSMKKKKT 218
           +  +  +V  K S D  + KRKI GPK PNPLS+KK + 
Sbjct: 180 NNTEDASVDPK-SPDANQLKRKIKGPKEPNPLSIKKPRV 217

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  229 bits (584), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 137/177 (77%), Gaps = 2/177 (1%)

Query: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSE--VK 58
           MRQKRAKSY+KQL+VYNHTFKFR PYQV++D+ +V +   + Y+L KGL N L S   +K
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 59  VMITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYV 118
            MITQCC+ ALY+  +Q++I + + FERRRCNH+ KEP +  EC+ S+V++NG+NKHRY+
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 119 VASQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPK 175
           VA+QDL  RRKLR++PGVPLIH  R+VM+MEPLSD S + +   E++KL  GLN  K
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTK 177

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 71.2 bits (173), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 78/146 (53%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVMITQCCMQAL--YE 71
           L + +    + PYQVL+D   +        DL +G+ +TL ++   +IT C M  L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIPLITDCVMAELEKLG 110

Query: 72  ENNQDAIELAR--RFERRRCNHNPKEPKTAIECIESVVNINGQNKHR-YVVASQDLATRR 128
              + A++LAR  R +R  C+H   +   A +C+     +N   +H+ Y+VA+ D A ++
Sbjct: 111 PKYRIALKLARDPRIQRLSCSH---KGTYADDCL-----VNRVLQHKCYIVATNDAALKQ 162

Query: 129 KLRQVPGVPLIHISRAVMIMEPLSDV 154
           ++R+VPG+PL+ +     ++E L DV
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKLPDV 188

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 70.1 bits (170), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 77/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVMITQCCMQAL--YE 71
           L + +    + PYQVL+D   +        D+ +G+ +TL ++   MIT C M  L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMAELEKLG 110

Query: 72  ENNQDAIELAR--RFERRRCNHNPKEPKTAIECIESVVNINGQNKHR-YVVASQDLATRR 128
              + A++LAR  R +R  C+H   +   A +C+     +N   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIQRLTCSH---KGTYADDCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIHISRAVMIMEPLSDV 154
           ++R+VPG+PL+ +     ++E L DV
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKLPDV 188

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 68.9 bits (167), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVMITQCCMQAL--YE 71
           L + +    + PYQVL+D   +        D+ KG+ + L ++   +IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  ENNQDAIELAR--RFERRRCNHNPKEPKTAIECIESVVNINGQNKHR-YVVASQDLATRR 128
              + A+ LAR  R +R  C+H   +   A +CI     +N   +H+ Y+VA+ D+  ++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSH---KGTYADDCI-----VNRVLQHKCYIVATNDVGLKQ 162

Query: 129 KLRQVPGVPLIHISRAVMIMEPLSDV 154
           ++R+VPG+PL+ +     ++E L DV
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 67.4 bits (163), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVMITQCCMQAL--YE 71
           L + +    + PYQVL+D   +        DL +G+ + L ++   +IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  ENNQDAIELAR--RFERRRCNHNPKEPKTAIECIESVVNINGQNKHR-YVVASQDLATRR 128
              + A++LAR  R +R  C+H   +   A +CI     +N   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIHISRAVMIMEPLSDV 154
           ++R++PG+PL+ +     ++E L DV
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 67.0 bits (162), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 74/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVMITQCCMQAL--YE 71
           L +      R PYQVL+D   +        D+ KG+ + L ++   +IT C M  L    
Sbjct: 51  LFFQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  ENNQDAIELAR--RFERRRCNHNPKEPKTAIECIESVVNINGQNKHR-YVVASQDLATRR 128
              + A+ LAR  R +R  C+H   +   A +CI     +N   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSH---KGTYADDCI-----VNRVLQHKCYIVATNDQGLKQ 162

Query: 129 KLRQVPGVPLIHISRAVMIMEPLSDV 154
           ++R++PG+PL+ +     ++E L DV
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVMITQCCMQAL--YE 71
           L + +    + PYQVL+D   +        DL KG+ + L ++   +IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  ENNQDAIELAR--RFERRRCNHNPKEPKTAIECIESVVNINGQNKHR-YVVASQDLATRR 128
              + A+ LAR  R +R  C+H   +   A +CI     +N   +H+ ++VA+ D   ++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSH---KGTYADDCI-----VNRVLQHKCFIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIHISRAVMIMEPLSDV 154
           ++R++PG+PL+ +     ++E L DV
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVMITQCCMQAL--YE 71
           L + +    + PYQVL+D   +        DL +G+ + L ++   +IT C M  L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 72  ENNQDAIELAR--RFERRRCNHNPKEPKTAIECIESVVNINGQNKHR-YVVASQDLATRR 128
              + A++LAR  R +R  C+H   +   A +C+     +N   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLNCSH---KGTYADDCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIHISRAVMIMEPLSDV 154
           ++R+VPG+PL+ +     ++E L DV
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVMITQCCMQAL--YE 71
           L + +    + PYQVL+D   +        D+ +G+ + L ++   +IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 72  ENNQDAIELAR--RFERRRCNHNPKEPKTAIECIESVVNINGQNKHR-YVVASQDLATRR 128
              + A+ LAR  R +R  C+H   +   A +C+     +N   +H+ Y+VA+ D A ++
Sbjct: 111 PKYRIALRLARDPRIKRLNCSH---KGTYADDCL-----VNRVLQHKCYIVATNDAALKQ 162

Query: 129 KLRQVPGVPLIHISRAVMIMEPLSDV 154
           ++R+VPG+PL+ +     ++E L DV
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 66.2 bits (160), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVMITQCCMQAL--YE 71
           L + +    + PYQVL+D   +        D+ KG+ + L ++   +IT C +  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 72  ENNQDAIELAR--RFERRRCNHNPKEPKTAIECIESVVNINGQNKHR-YVVASQDLATRR 128
              + A++LAR  R +R  C H   +   A +CI     +N   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLTCTH---KGTYADDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIHISRAVMIMEPLSDV 154
           ++R++PG+PL+ +     ++E L DV
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 66.2 bits (160), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 74/145 (51%), Gaps = 13/145 (8%)

Query: 14  LVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVMITQCCMQAL--YE 71
           L + +    R PYQVL+D   +        D+ KG+ + L ++   +IT C M  L    
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  ENNQDAIELAR--RFERRRCNHNPKEPKTAIECIESVVNINGQNKHR-YVVASQDLATRR 128
              + A++LAR  R +R  C H   +   A +C+     +N   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLSCTH---KGTYADDCL-----VNRVMQHKCYIVATNDAPLKQ 162

Query: 129 KLRQVPGVPLIHISRAVMIMEPLSD 153
           ++R++PG+PL+ +     ++E L D
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPD 187

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 65.9 bits (159), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVMITQCCMQAL--YE 71
           L + +    + PYQVL+D   +        D+ KG+ + L ++  ++IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCVMAELEKLG 110

Query: 72  ENNQDAIELAR--RFERRRCNHNPKEPKTAIECIESVVNINGQNKHR-YVVASQDLATRR 128
              + A++LAR  R +R  C+H   +   A +CI     ++   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCI-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIHISRAVMIMEPLSDV 154
           ++R+VPG+PL+ +     ++E L  V
Sbjct: 163 RVRKVPGIPLMSVGGHSYVIEKLPGV 188

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 65.5 bits (158), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVMITQCCMQAL--YE 71
           L + +    + PYQVL+D   +        D+ +G+ + L ++   +IT C M  L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 72  ENNQDAIELAR--RFERRRCNHNPKEPKTAIECIESVVNINGQNKHR-YVVASQDLATRR 128
              + A++LAR  R +R  C+H       A +C+     +N   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLTCSH---RGTYADDCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIHISRAVMIMEPLSDV 154
           ++R+VPG+PL+ +     ++E L DV
Sbjct: 163 RIRKVPGIPLLSVGGHSYVIEKLPDV 188

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 64.7 bits (156), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVMITQCCMQAL--YE 71
           L + +    + PYQVL+D   +        D+ +G+ + L ++   +IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  ENNQDAIELAR--RFERRRCNHNPKEPKTAIECIESVVNINGQNKHR-YVVASQDLATRR 128
              + A++LAR  R +R  C+H   +   A +C+     ++   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIHISRAVMIMEPLSDV 154
           ++R++PG+PL+ +     ++E L DV
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 64.7 bits (156), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVMITQCCMQAL--YE 71
           L + +    + PYQVL+D   +        D+ +G+ + L ++   +IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  ENNQDAIELAR--RFERRRCNHNPKEPKTAIECIESVVNINGQNKHR-YVVASQDLATRR 128
              + A++LAR  R +R  C+H   +   A +C+     ++   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIHISRAVMIMEPLSDV 154
           ++R++PG+PL+ +     ++E L DV
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 64.7 bits (156), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVMITQCCMQAL--YE 71
           L + +    + PYQVL+D   +        D+ +G+ + L ++   +IT C M  L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  ENNQDAIELAR--RFERRRCNHNPKEPKTAIECIESVVNINGQNKHR-YVVASQDLATRR 128
              + A++LAR  R +R  C+H   +   A +C+     ++   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIHISRAVMIMEPLSDV 154
           ++R++PG+PL+ +     ++E L DV
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 64.7 bits (156), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVMITQCCMQAL--YE 71
           L + +    + PYQVL+D   +        D+ +G+ + L ++   +IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  ENNQDAIELAR--RFERRRCNHNPKEPKTAIECIESVVNINGQNKHR-YVVASQDLATRR 128
              + A++LAR  R +R  C+H   +   A +C+     ++   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIHISRAVMIMEPLSDV 154
           ++R++PG+PL+ +     ++E L DV
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 64.3 bits (155), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVMITQCCMQAL--YE 71
           L + +    + PYQVL+D   +        D+ +G+ + L ++   +IT C +  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 72  ENNQDAIELAR--RFERRRCNHNPKEPKTAIECIESVVNINGQNKHR-YVVASQDLATRR 128
              + A++LAR  R +R  C+H   +   A +CI     +N   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIHISRAVMIMEPLSDV 154
           ++R++PG+PL+ +     ++E L DV
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 64.3 bits (155), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVMITQCCMQAL--YE 71
           L + +    + PYQVL+D   +        D+ +G+ + L ++   +IT C +  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 72  ENNQDAIELAR--RFERRRCNHNPKEPKTAIECIESVVNINGQNKHR-YVVASQDLATRR 128
              + A++LAR  R +R  C+H   +   A +C+     +N   +H+ Y+VA+ D   ++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIHISRAVMIMEPLSDV 154
           ++R++PG+PL+ +     ++E L DV
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 64.3 bits (155), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 73/145 (50%), Gaps = 13/145 (8%)

Query: 14  LVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVMITQCCMQAL--YE 71
           L + +    + PYQVL+D   +        DL +G+ + L ++   +IT C M  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  ENNQDAIELAR--RFERRRCNHNPKEPKTAIECIESVVNINGQNKHR-YVVASQDLATRR 128
              + A++LAR  R +R  C H   +   A +CI     +N   +H+ Y+VA+ D   ++
Sbjct: 111 PKFRIALKLARDPRIKRLSCTH---KGTYADDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIHISRAVMIMEPLSD 153
           ++R++PG+PL+ +      +E L D
Sbjct: 163 RVRKIPGIPLMSVGGHAYAIEKLPD 187

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVMITQCCMQAL--YE 71
           L + +    + PYQVL+D   +        D+ +G+ + L ++   +IT C +  L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVVAELEKLG 110

Query: 72  ENNQDAIELAR--RFERRRCNHNPKEPKTAIECIESVVNINGQNKHR-YVVASQDLATRR 128
              + A++LAR  R +R  C+H       A +CI     +N   +H+ Y+VA+ D   ++
Sbjct: 111 PKFRIALKLARDPRIKRLSCSH---RGTYADDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIHISRAVMIMEPLSDV 154
           ++R++PG+PL+ +     ++E L DV
Sbjct: 163 RVRKIPGIPLMSVGGHSYVVEKLPDV 188

>ADL145C Chr4 complement(435983..438610) [2628 bp, 875 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR154W
           (ESC4)
          Length = 875

 Score = 37.7 bits (86), Expect = 0.031,   Method: Composition-based stats.
 Identities = 37/186 (19%), Positives = 71/186 (38%), Gaps = 20/186 (10%)

Query: 92  NPKEPKTAIECIESVVNINGQNKHRYVVASQDLATRRKLRQVPGVPLIHISRAVMIMEPL 151
           N   P+ A+     +V  N Q     VV++ D+  +          ++H    VM  + L
Sbjct: 448 NMVSPRKAVS--PDIVMHNSQTDVALVVSTTDIDLKDNNESTNDTSVVHEPGKVMNSDDL 505

Query: 152 SDVSAQVSRRKENEKLYKGLNDPKFTGVKSAVDKETV-----------------KEKEST 194
           + V +  +R+++  +++  L++    G KS + K+ +                   K+S+
Sbjct: 506 TAVHSTKTRQEDANEMFSALDEAVSKGKKSCLPKKHIAASVAASTSNEISASAKSNKDSS 565

Query: 195 DQQKKKRKIGPKGPNPLSMKKKKTASNSMNENIKNREGHNDANIDDXXXXXXXXXXXXTG 254
           D Q  K+       NP   K K T S + N+   +++     N DD              
Sbjct: 566 DVQATKQLPATPTSNPRQTKPKST-SGTQNDTASSQKNTRRKNADDSPSSESSKTKKRKT 624

Query: 255 TEIENK 260
           T ++ K
Sbjct: 625 TVVDAK 630

>TDEL0C04710 Chr3 (853105..854985) [1881 bp, 626 aa] {ON} Anc_3.329
           YPR048W
          Length = 626

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 6/69 (8%)

Query: 102 CIESVVNINGQNKHRYVVASQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRR 161
           C   ++N++  +K RY V + +L   ++L++    P+I IS  V I   +S + + VS+ 
Sbjct: 449 CTNFIINLSPGDKFRYKVQNNNLFLNKELKE---KPMILISPGVGIAPMMSLIRSDVSK- 504

Query: 162 KENEKLYKG 170
             N KL+ G
Sbjct: 505 --NLKLFFG 511

>KAFR0I00870 Chr9 (168359..168967) [609 bp, 202 aa] {ON} Anc_5.553
           YDR439W
          Length = 202

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 8/62 (12%)

Query: 130 LRQVPGVPLIHISRAVMIMEPLSDVSAQV-------SRRKENEKLYKGLNDPKFTGVKSA 182
           L      P I ++  +++ + LSD+++QV          KE+ KLYK LN+ K +  K  
Sbjct: 32  LSTTSSAPKI-VNETLLLQKQLSDLTSQVQNLKRENDNLKESIKLYKALNESKISNYKKI 90

Query: 183 VD 184
           +D
Sbjct: 91  ID 92

>NDAI0A02590 Chr1 (576657..580133) [3477 bp, 1158 aa] {ON} Anc_7.234
          Length = 1158

 Score = 30.0 bits (66), Expect = 8.2,   Method: Composition-based stats.
 Identities = 13/45 (28%), Positives = 23/45 (51%)

Query: 136 VPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180
           VPL  +    M+ E + D+  +   ++ N +LY+ L+ PK    K
Sbjct: 230 VPLAFVLTVNMMKEAMDDIQRRRRDKESNNELYEALSQPKLVASK 274

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,866,777
Number of extensions: 1204649
Number of successful extensions: 6722
Number of sequences better than 10.0: 153
Number of HSP's gapped: 6755
Number of HSP's successfully gapped: 158
Length of query: 271
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 163
Effective length of database: 41,097,471
Effective search space: 6698887773
Effective search space used: 6698887773
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 65 (29.6 bits)