Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0I022406.21ON35035018460.0
NCAS0D026706.21ON3513615472e-66
Kpol_1037.266.21ON3423334112e-46
Skud_15.1686.21ON3483413991e-44
CAGL0E02739g6.21ON3433523954e-44
KAFR0L004106.21ON3313713919e-44
TPHA0J003406.21ON3383233902e-43
Smik_15.1766.21ON3453723893e-43
YOR007C (SGT2)6.21ON3463683883e-43
KNAG0M011706.21ON3393663841e-42
NCAS0H008306.21ON3383303823e-42
Suva_15.1826.21ON3462243781e-41
SAKL0E01210g6.21ON3232163761e-41
ZYRO0C07788g6.21ON3343293771e-41
TDEL0G044806.21ON3433423753e-41
Kwal_56.224336.21ON3223703672e-40
NDAI0D008106.21ON3493573675e-40
ACR005W6.21ON3272113612e-39
Ecym_30256.21ON3183623585e-39
TBLA0G010506.21ON3503313598e-39
Kpol_1032.86.21ON3433343589e-39
KLTH0C11220g6.21ON3273303455e-37
KLLA0D01155g6.21ON3353643185e-33
TBLA0A072706.21ON3733683152e-32
TPHA0M002706.21ON3773972329e-21
Smik_15.2055.617ON5891032057e-17
CAGL0H08195g5.617ON5831032022e-16
Suva_8.805.617ON5861031976e-16
YOR027W (STI1)5.617ON5891031942e-15
KLTH0E02178g5.617ON5931031862e-14
Skud_15.1925.617ON5891031852e-14
NCAS0G008105.617ON5841031843e-14
Ecym_55825.617ON5841031834e-14
ZYRO0A05676g5.617ON5721031834e-14
TPHA0D028805.617ON5851031818e-14
TBLA0E033005.617ON5821031809e-14
NDAI0F009105.617ON5831031791e-13
Kwal_55.199355.617ON5931031791e-13
Kpol_1018.695.617ON5901031772e-13
SAKL0G07084g5.617ON5851031711e-12
KNAG0B032005.617ON5791031701e-12
AEL224W5.617ON5801031702e-12
TDEL0A048405.617ON5761031692e-12
KAFR0C058905.617ON5751041665e-12
KLLA0A07062g5.617ON5811031631e-11
NDAI0F028102.152ON6091061514e-10
Ecym_82042.152ON597711489e-10
Kwal_33.147672.152ON5941101471e-09
ABR131W2.152ON5941061471e-09
KLTH0B05170g2.152ON5931281452e-09
KLLA0F24046g2.152ON604731425e-09
NCAS0F034903.481ON512781391e-08
Skud_7.4323.481ON513751391e-08
YGR123C (PPT1)3.481ON513781382e-08
Kpol_505.413.481ON513961363e-08
TBLA0C039503.481ON512771363e-08
NDAI0B057903.481ON5231071354e-08
NCAS0A00490singletonON6201331354e-08
Smik_6.2153.481ON513761345e-08
NCAS0G024802.152ON596881346e-08
TDEL0D055003.481ON512771328e-08
Suva_7.4083.481ON513781311e-07
AAR083C3.481ON538761311e-07
SAKL0E10956g2.152ON600731311e-07
KNAG0A079003.481ON512801292e-07
TDEL0B051402.152ON5991011292e-07
KLLA0B09262g3.367ON9411201283e-07
Kpol_1048.212.152ON597711274e-07
TDEL0C050903.367ON7591201266e-07
TPHA0M016303.367ON10431201259e-07
SAKL0B07986g3.367ON8801201241e-06
CAGL0L12936g2.152ON600881231e-06
NDAI0A051003.367ON10071201231e-06
NCAS0A112003.367ON9071211231e-06
Ecym_44133.481ON510791221e-06
KNAG0H006103.367ON9731201231e-06
KNAG0H035302.152ON614731222e-06
ZYRO0C16522g3.367ON9741201222e-06
Ecym_34593.367ON11151201222e-06
Kwal_23.36703.367ON8021201212e-06
ADL344W3.367ON9101201212e-06
CAGL0D05060g3.481ON510971203e-06
KLTH0F10428g3.367ON7951201203e-06
KAFR0H008703.367ON8871201195e-06
CAGL0D01364g3.367ON1148961195e-06
KAFR0B066103.481ON511801185e-06
YNL121C (TOM70)2.152ON617881186e-06
Skud_2.2403.367ON984961187e-06
Smik_2.2543.367ON1020961177e-06
TPHA0D032203.481ON513731167e-06
Suva_4.3613.367ON963961178e-06
YBR112C (CYC8)3.367ON966961179e-06
TBLA0C055302.152ON610711169e-06
TBLA0F012303.367ON1189961151e-05
ZYRO0G06512g2.152ON6041011142e-05
Skud_14.2112.152ON617881132e-05
KAFR0F007202.152ON608911132e-05
Kpol_172.23.367ON4181051122e-05
SAKL0F03102g3.481ON513781123e-05
NCAS0B070102.152ON625701113e-05
Smik_14.2072.152ON617881114e-05
Suva_14.2192.152ON617881114e-05
KLLA0B10912g3.481ON512841105e-05
TBLA0H015203.367ON689731097e-05
Ecym_20906.328ON172661047e-05
Kwal_27.118908.506ON3341111061e-04
TPHA0I015102.152ON603731061e-04
KLTH0F14542g3.481ON513861034e-04
CAGL0L04048g2.152ON587731034e-04
Kwal_55.211753.481ON511781024e-04
Skud_8.1782.152ON638911008e-04
TPHA0D038606.328ON120102930.001
CAGL0H07425g8.506ON380140990.001
YHR117W (TOM71)2.152ON63989980.001
Smik_2.2958.506ON38598970.002
NCAS0B024008.506ON38085950.003
YBR155W (CNS1)8.506ON38598930.005
KAFR0E029808.506ON38093930.005
Suva_15.3142.152ON644105930.005
AFR663W1.88ON1038105930.007
Suva_4.4058.506ON38598910.008
KLTH0E11748g8.506ON378147900.012
Kpol_513.28.506ON374111900.012
NDAI0B043402.152ON66473900.013
NDAI0C052908.506ON379112890.013
ZYRO0B04224g3.481ON51381900.014
SAKL0H10934g8.506ON380111880.019
Smik_8.1952.152ON63589880.020
AAR054C6.328ON13361830.021
TDEL0B023305.689ON70286880.023
Ecym_25598.506ON370109870.027
AGL268C8.506ON37998870.029
NDAI0F004005.689ON76488870.035
SAKL0C02816g1.88ON1118105870.036
TDEL0B013108.506ON380144860.039
TBLA0I023106.328ON11654800.053
TPHA0L014208.506ON374111840.059
KAFR0J025706.328ON12152790.070
YCR060W (TAH1)6.328ON11155780.074
KLTH0F02508g1.88ON1055120840.088
TBLA0D004607.412ON83566820.12
KNAG0A039508.506ON386111800.21
Skud_3.1356.328ON11851740.30
Skud_2.2828.506ON38598780.33
NCAS0B080101.88ON1065106790.33
TBLA0H033808.506ON375111770.37
CAGL0C01903g7.412ON76969780.37
NDAI0B053201.88ON1038118780.42
Suva_3.956.328ON11170720.43
TDEL0C061301.88ON1025105770.47
Kwal_33.134281.88ON1052124760.62
Smik_3.1596.328ON11575710.66
KLLA0C08910g6.328ON11553710.77
SAKL0H05456g8.721ON446111741.1
Ecym_13968.470ON573151741.3
NCAS0B025608.470ON578114731.4
AEL062C1.456ON38362721.6
TPHA0G002407.546ON143073731.8
Kpol_1018.1067.412ON75396722.0
Kwal_27.107407.412ON62846722.1
SAKL0E14542g5.689ON69088722.2
AGL294W7.412ON65664722.3
TPHA0E007407.412ON74622712.4
Ecym_71427.412ON67564712.5
KLLA0E20857g7.412ON71081712.5
CAGL0K09240g6.328ON14246682.6
KLTH0C06204g7.412ON62746712.6
SAKL0A01672g6.328ON12858672.7
KAFR0L018707.412ON71252712.8
NCAS0A084201.456ON394119702.9
Kpol_1043.605.689ON70671712.9
TPHA0G006808.721ON457118703.0
TPHA0A005503.61ON1629126713.3
Kpol_1006.43.367ON73286704.1
ZYRO0F16544g1.88ON102899704.2
SAKL0D11110g1.456ON432115694.6
NCAS0D029406.73ON611219694.7
KLTH0G07304g5.261ON167234694.8
Kpol_1028.516.328ON11777655.2
KLTH0H14872g5.352ON623103685.3
YNL313C (EMW1)3.32ON90463686.8
Ecym_81615.372ON49526677.8
TBLA0H019705.352ON84076678.1
TDEL0A066508.721ON451117678.1
KLLA0C02453g1.88ON1028100678.2
TPHA0B044301.88ON107086678.4
Kwal_55.218395.689ON69051679.3
NCAS0E024907.412ON80955669.6
YBL084C (CDC27)7.412ON75889669.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0I02240
         (350 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   715   0.0  
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   215   2e-66
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   162   2e-46
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   158   1e-44
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   156   4e-44
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   155   9e-44
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   154   2e-43
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   154   3e-43
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   154   3e-43
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   152   1e-42
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   151   3e-42
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   150   1e-41
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   149   1e-41
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   149   1e-41
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   149   3e-41
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   145   2e-40
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   145   5e-40
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   143   2e-39
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   142   5e-39
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   142   8e-39
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   142   9e-39
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   137   5e-37
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   127   5e-33
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   125   2e-32
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...    94   9e-21
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    84   7e-17
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    82   2e-16
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    80   6e-16
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    79   2e-15
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    76   2e-14
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    76   2e-14
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    75   3e-14
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    75   4e-14
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    75   4e-14
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    74   8e-14
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    74   9e-14
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     74   1e-13
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    74   1e-13
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    73   2e-13
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    70   1e-12
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    70   1e-12
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    70   2e-12
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    70   2e-12
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    69   5e-12
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    67   1e-11
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    63   4e-10
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    62   9e-10
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    61   1e-09
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    61   1e-09
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    60   2e-09
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    59   5e-09
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    58   1e-08
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    58   1e-08
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    58   2e-08
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    57   3e-08
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    57   3e-08
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    57   4e-08
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       57   4e-08
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    56   5e-08
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    56   6e-08
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    55   8e-08
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    55   1e-07
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    55   1e-07
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    55   1e-07
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    54   2e-07
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    54   2e-07
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    54   3e-07
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    54   4e-07
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    53   6e-07
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    53   9e-07
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    52   1e-06
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    52   1e-06
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    52   1e-06
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    52   1e-06
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    52   1e-06
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    52   1e-06
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    52   2e-06
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    52   2e-06
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    52   2e-06
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    51   2e-06
ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic ho...    51   2e-06
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    51   3e-06
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    51   3e-06
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    50   5e-06
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    50   5e-06
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    50   5e-06
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    50   6e-06
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    50   7e-06
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    50   7e-06
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    49   7e-06
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    50   8e-06
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    50   9e-06
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    49   9e-06
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    49   1e-05
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    49   2e-05
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    48   2e-05
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    48   2e-05
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    48   2e-05
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    48   3e-05
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    47   3e-05
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    47   4e-05
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    47   4e-05
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    47   5e-05
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    47   7e-05
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    45   7e-05
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    45   1e-04
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    45   1e-04
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    44   4e-04
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    44   4e-04
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    44   4e-04
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    43   8e-04
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    40   0.001
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    43   0.001
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    42   0.001
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    42   0.002
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    41   0.003
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    40   0.005
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    40   0.005
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    40   0.005
AFR663W Chr6 (1648116..1651232) [3117 bp, 1038 aa] {ON} Syntenic...    40   0.007
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    40   0.008
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    39   0.012
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    39   0.012
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    39   0.013
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    39   0.013
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    39   0.014
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    39   0.019
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    39   0.020
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    37   0.021
TDEL0B02330 Chr2 complement(423968..426076) [2109 bp, 702 aa] {O...    39   0.023
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    38   0.027
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    38   0.029
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    38   0.035
SAKL0C02816g Chr3 complement(264072..267428) [3357 bp, 1118 aa] ...    38   0.036
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    38   0.039
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    35   0.053
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    37   0.059
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    35   0.070
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    35   0.074
KLTH0F02508g Chr6 complement(214785..217952) [3168 bp, 1055 aa] ...    37   0.088
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    36   0.12 
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    35   0.21 
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    33   0.30 
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    35   0.33 
NCAS0B08010 Chr2 complement(1517575..1520772) [3198 bp, 1065 aa]...    35   0.33 
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    34   0.37 
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    35   0.37 
NDAI0B05320 Chr2 (1299911..1303027) [3117 bp, 1038 aa] {ON} Anc_...    35   0.42 
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    32   0.43 
TDEL0C06130 Chr3 (1108534..1111611) [3078 bp, 1025 aa] {ON} Anc_...    34   0.47 
Kwal_33.13428 s33 complement(219925..223083) [3159 bp, 1052 aa] ...    34   0.62 
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    32   0.66 
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    32   0.77 
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    33   1.1  
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    33   1.3  
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    33   1.4  
AEL062C Chr5 complement(519416..520567) [1152 bp, 383 aa] {ON} S...    32   1.6  
TPHA0G00240 Chr7 complement(37417..41709) [4293 bp, 1430 aa] {ON...    33   1.8  
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    32   2.0  
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    32   2.1  
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    32   2.2  
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    32   2.3  
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    32   2.4  
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    32   2.5  
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    32   2.5  
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    31   2.6  
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    32   2.6  
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    30   2.7  
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    32   2.8  
NCAS0A08420 Chr1 complement(1667102..1668286) [1185 bp, 394 aa] ...    32   2.9  
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    32   2.9  
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    32   3.0  
TPHA0A00550 Chr1 complement(91847..96736) [4890 bp, 1629 aa] {ON...    32   3.3  
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    32   4.1  
ZYRO0F16544g Chr6 (1360946..1364032) [3087 bp, 1028 aa] {ON} sim...    32   4.2  
SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} simila...    31   4.6  
NCAS0D02940 Chr4 complement(558088..559923) [1836 bp, 611 aa] {O...    31   4.7  
KLTH0G07304g Chr7 (585983..591001) [5019 bp, 1672 aa] {ON} simil...    31   4.8  
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    30   5.2  
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...    31   5.3  
YNL313C Chr14 complement(45308..48022) [2715 bp, 904 aa] {ON}  E...    31   6.8  
Ecym_8161 Chr8 (333872..335359) [1488 bp, 495 aa] {ON} similar t...    30   7.8  
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    30   8.1  
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    30   8.1  
KLLA0C02453g Chr3 complement(216740..219826) [3087 bp, 1028 aa] ...    30   8.2  
TPHA0B04430 Chr2 (1036315..1039527) [3213 bp, 1070 aa] {ON} Anc_...    30   8.4  
Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR08...    30   9.3  
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    30   9.6  
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    30   9.8  

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/350 (100%), Positives = 350/350 (100%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKERTL 60
           MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKERTL
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKERTL 60

Query: 61  KTILQENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSN 120
           KTILQENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSN
Sbjct: 61  KTILQENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSN 120

Query: 121 RSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEG 180
           RSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEG
Sbjct: 121 RSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEG 180

Query: 181 TNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTSEECPEKNNNQDEGFTAVNHYAQ 240
           TNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTSEECPEKNNNQDEGFTAVNHYAQ
Sbjct: 181 TNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTSEECPEKNNNQDEGFTAVNHYAQ 240

Query: 241 NNDNKSKEETKEENRSQAADLSNIARLLGSGVGGLMNNPQLKQMVFQAINDNPDASRQVK 300
           NNDNKSKEETKEENRSQAADLSNIARLLGSGVGGLMNNPQLKQMVFQAINDNPDASRQVK
Sbjct: 241 NNDNKSKEETKEENRSQAADLSNIARLLGSGVGGLMNNPQLKQMVFQAINDNPDASRQVK 300

Query: 301 DVLNNPLLRTTLSELMNTKMGGKTPQEMLQSGTVNNLIQSFLAGTQQGKK 350
           DVLNNPLLRTTLSELMNTKMGGKTPQEMLQSGTVNNLIQSFLAGTQQGKK
Sbjct: 301 DVLNNPLLRTTLSELMNTKMGGKTPQEMLQSGTVNNLIQSFLAGTQQGKK 350

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  215 bits (547), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 139/361 (38%), Positives = 204/361 (56%), Gaps = 29/361 (8%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKERTL 60
           MSL+ ++ AS I+SYLS L     + ED  ES+ VAI CI +SF L  ++   S     L
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADS----DL 56

Query: 61  KTILQENLNTLEATQKIH-------NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK 113
            T+L  NLN LE   K+        NE+A  LK EGN+A+    Y++AI KYT AI   K
Sbjct: 57  ATVLLANLN-LEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLK 115

Query: 114 ------NVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLED 167
                 +  Y SN+SLA +K GRYE+A +DA   I IDP+FSK YSRL  AK  Q+K ED
Sbjct: 116 KNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYED 175

Query: 168 GMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQL--KKNDDSEERKSIKEVTSEECPEKN 225
            M AYK+ +DLEG  A+ T+  D+E  + K+E L    + DS     I E  ++  P   
Sbjct: 176 AMNAYKQVLDLEGNKATDTMKRDFEITKQKFETLNFSTHIDSGSATPISEAANKYPP--- 232

Query: 226 NNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLS--NIARLLGSGVGGLMNNPQLKQ 283
             +DE     +   + +    +  T EE+ +   +    NIA+L+G+G+G ++NNPQ++ 
Sbjct: 233 --KDEEIRTRSSLVKVDVPAEQTNTNEEHSTPNTNTPRFNIAQLIGNGIGTILNNPQVQL 290

Query: 284 MVFQAINDNPDASRQVKDVLNNPLLRTTLSELMNTKMGGKTPQEMLQSGTVNNLIQSFLA 343
            +      NPDA+R+V+++ NNP+ +  LS+LM+     ++P+E  +S    NL+ SF+ 
Sbjct: 291 ALSHFAQRNPDAARKVQEISNNPMFKMALSQLMDA--ANQSPEEFFKSEKFKNLVNSFIP 348

Query: 344 G 344
           G
Sbjct: 349 G 349

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  162 bits (411), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 114/333 (34%), Positives = 176/333 (52%), Gaps = 33/333 (9%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGD----ILPTSLK 56
           MS++ +  A+LII +LS + + N + ED  +SL VA+ CI E+F  + D    ++ +S +
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60

Query: 57  ERTLKTIL------QENLNTLEATQKIH--------NEEAEALKKEGNEAMIEGQYEEAI 102
             +L + L           T + T K++        +E AEALK EGN+AM    YE AI
Sbjct: 61  GNSLSSYLNGSTSASAATTTADETVKVNVTEDDTEASEAAEALKLEGNKAMAGKDYELAI 120

Query: 103 KKYTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCC 161
           KKYTEAI     N  Y++NR+ AYS L +Y++AV DA  AI I+P++SK YSRLG+AK  
Sbjct: 121 KKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFA 180

Query: 162 QDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQ---LKKNDDSEERKSIKEVTS 218
           Q K ED + AYK+ +D+EG  A++ +  DYE A+ K EQ   L+K+  S    +  +  S
Sbjct: 181 QGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAESDSAS 240

Query: 219 EECPEKNNNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLSNIARLLGSGVGGLMNN 278
              P         F+++       +  +  +  +  +    D   + +     V  +M N
Sbjct: 241 AADPFAGMGGMPDFSSMLGGGGLGNLLNNPQLMQAAQQMMQDPEAMKQ-----VESMMQN 295

Query: 279 PQLKQMV--FQAINDNPDASRQVKDVLNNPLLR 309
           P +KQM   F + N  PD S     ++N+P +R
Sbjct: 296 PSVKQMADQFSSGNGTPDFSA----LMNDPSIR 324

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  158 bits (399), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 114/341 (33%), Positives = 173/341 (50%), Gaps = 36/341 (10%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSL----- 55
           MS +K + ASLI++Y S +     + ED  +SL VA+ CI E+F  + + +P+ L     
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60

Query: 56  KERTLKTILQENLNTLEATQK---------IHNEEAEA------LKKEGNEAMIEGQYEE 100
           K + L  +L       E+T+K         I  E+AE       LK +GN+AM    YE 
Sbjct: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMANKDYEL 120

Query: 101 AIKKYTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAK 159
           AI KYTEAI+    N  YY+NR+ A+S L  Y++AV DA  AI+IDP++ + YSRLG+AK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180

Query: 160 CCQDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTSE 219
             Q K E+ + AYK+ +D+EG NA++ +  DYE A+ K EQ          K++ E + +
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQ-----SLNLEKTVPEQSRD 235

Query: 220 ECPEKNNNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAAD--LSNIARLLGSGVGGLMN 277
                + +Q  G + +                     QAA   +SN   +    +  +M 
Sbjct: 236 ADANADASQGAGTSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAM--QNIQKMMQ 293

Query: 278 NPQLKQMV--FQAINDNPDASRQVKDVLNNPLLRTTLSELM 316
           +P +KQM   F +    P+ S    D++NNP LR+    L 
Sbjct: 294 DPNIKQMAEGFTSGGGAPNLS----DLMNNPALRSMAGNLF 330

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  156 bits (395), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 110/352 (31%), Positives = 176/352 (50%), Gaps = 52/352 (14%)

Query: 7   QTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKERTLKTILQE 66
           + A++II YL  +     + ED  +S+ VAI CI ESF ++   + + LK+  +   L+E
Sbjct: 4   EVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGLEE 63

Query: 67  NLNTLEATQKIHNEE---------------AEALKKEGNEAMIEGQYEEAIKKYTEAIQ- 110
            L  ++    + +E+               AEALK EGN+AM    +E AI KY+EAI+ 
Sbjct: 64  CLECMKGG-AVKSEDVKVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKYSEAIEV 122

Query: 111 FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMT 170
              N  YY+NR+ A+S L +Y++AV DA  AI IDP++SK YSRLG+AK  Q+K E+ + 
Sbjct: 123 LPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALE 182

Query: 171 AYKRAIDLEGTNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTSEECPEKNNNQDE 230
           AYK+ +DLEG  A+  +  DYE A+ K EQ               +  E+ P+       
Sbjct: 183 AYKKVMDLEGDKATDIMKRDYETAKKKVEQ--------------SLNLEKTPDARGAD-- 226

Query: 231 GFTAVNHYAQNNDNKSKEETKEENRSQAADLSNIARLLGSGVGGLMNNPQLKQMVFQAIN 290
                                    +   D S+   +L  G+ GLMNNPQ+ Q   Q ++
Sbjct: 227 --------------SGAGAGAGAGGAGGFDFSS---MLSGGLSGLMNNPQIMQAAQQMMS 269

Query: 291 DNPDASRQVKDVLNNPLLRTTLSELMNTKMGGKTPQEMLQSGTVNNLIQSFL 342
            NP A +Q++ ++ +P +R  ++E   +  G     +++ +  + N+  S  
Sbjct: 270 -NPQALQQMQSMMQDPSIR-QMAEQFTSGNGTPNMDDLMSNPALRNMASSMF 319

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  155 bits (391), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 121/371 (32%), Positives = 191/371 (51%), Gaps = 66/371 (17%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDI---------- 50
           M L+ ++ ++LI+ YL  +T  N + ED K+SL VAI CI +SF  + D           
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60

Query: 51  ---LPTSLKERTLKTILQENLNTLEATQKIHNEE-----AEALKKEGNEAMIEGQYEEAI 102
              LP  L E  ++   +EN+       ++ N+E     AE LK EGN+AM    ++ AI
Sbjct: 61  NLSLP-ELLEVAMENSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLAI 119

Query: 103 KKYTEAIQFSKNVA-YYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCC 161
            KY+EAI  S N A YY+NR+ AYS L  +E A  DA  AI +DP++SK YSRLG+AK  
Sbjct: 120 AKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYA 179

Query: 162 QDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQ---LKKNDDSEERKSIKEVTS 218
            +K E+ + AYK+ +DLEG  A++ +  DYE A+ + EQ   L+K + + + +S+ E   
Sbjct: 180 LNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTE--- 236

Query: 219 EECPEKNNNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLSNIARLLGSGVGGLMNN 278
                         +A N                   + A    +++ +LG G+ GL+NN
Sbjct: 237 --------------SAAN-------------------AAAGGFPDMSSMLGGGLNGLLNN 263

Query: 279 PQLKQMVFQAINDNPDASRQVKDVLNNPLLRTTLSELMNTKMGGKTP--QEMLQSGTVNN 336
           PQL Q   Q ++D P+A  +++ ++ NP +R       N    G TP   +++    + +
Sbjct: 264 PQLMQAAQQMMSD-PNAMSKIQSMMQNPSIRQMAENFQN----GNTPDFSQLMNDPNIKD 318

Query: 337 LIQSFLAGTQQ 347
           + ++F  G  Q
Sbjct: 319 MAKNFFGGNNQ 329

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  154 bits (390), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 111/323 (34%), Positives = 173/323 (53%), Gaps = 41/323 (12%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKE--- 57
           M+ + ++ A+LI+ YL+ + +   +  D  +SL VA+ CI E+F  + D +  ++K    
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60

Query: 58  -RTLKTIL--------QENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEA 108
              L + L        Q N+   +A  +     AE LK EGN+AM    YE AIKKY+EA
Sbjct: 61  GNGLTSFLSGSATNDIQVNIAD-DAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEA 119

Query: 109 IQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLED 167
           I+    N  YY+NR+ AYS L +Y+DAVNDA  AI ++P++SK YSRLG+AK  Q K+ED
Sbjct: 120 IEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVED 179

Query: 168 GMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTSEECPEKNNN 227
            + AYK+ +D+EG  A+  +  DYE A+ K EQ           ++++VT +E       
Sbjct: 180 ALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQ---------SLNLEKVTPKEAE----- 225

Query: 228 QDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLSNI-ARLLGSGVGGLMNNPQLKQMVF 286
                       ++N +               DLS++    LG G+G L+ NPQ+ Q   
Sbjct: 226 -----------TESNADAGTGAAGMGGMGGFPDLSSMLGGGLGGGLGDLLKNPQIMQAAQ 274

Query: 287 QAINDNPDASRQVKDVLNNPLLR 309
           Q +  NP+A +Q++ ++ NP +R
Sbjct: 275 QMMQ-NPNAMQQMESMMQNPAVR 296

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  154 bits (389), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 125/372 (33%), Positives = 188/372 (50%), Gaps = 68/372 (18%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGD----ILPTS-L 55
           M  +KE+ A+LI++Y S +     + ED  +SL VA+ CI E+F  + D    IL  S  
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 56  KERTLKTILQENLNTLEATQK---------IHNEEAEA------LKKEGNEAMIEGQYEE 100
           K ++L  +L       E+ +K         I  E+AE       LK +GN+AM    YE 
Sbjct: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 101 AIKKYTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAK 159
           AI KYTEAIQ    N  YY+NR+ A+S L  Y++AV DA  +I+IDPS+ + YSRLG+AK
Sbjct: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180

Query: 160 CCQDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQ---LKKNDDSEERKSIKEV 216
             Q K E+ + AYK+ +D+EG NA++ +  DYE A+ K EQ   L+K             
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEK------------- 227

Query: 217 TSEECPEKNNNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLS---NIARLLGSGVG 273
                PE++ + D                        N SQ A  S   ++  LLG G+G
Sbjct: 228 ---AVPEQSRDAD-----------------------ANASQGAGSSGLPDLGSLLGGGLG 261

Query: 274 GLMNNPQLKQMVFQAINDNPDASRQVKDVLNNPLLRTTLSELMNTKMGGKTPQEMLQSGT 333
           GLMNNPQL Q   Q +  NP A + ++ ++ +P +R  ++E   +  G     +++ +  
Sbjct: 262 GLMNNPQLMQAA-QKMMSNPGAMQNIQKMMQDPSIR-QMAEGFTSGGGAPNLSDLMNNPA 319

Query: 334 VNNLIQSFLAGT 345
           + N+  +   G 
Sbjct: 320 LRNMAGNLFGGA 331

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  154 bits (388), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 111/368 (30%), Positives = 175/368 (47%), Gaps = 60/368 (16%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLD-----GDILPTSL 55
           MS +KE+ A+LI++Y S +     + ED  +SL VA+ CI E+F  +     G +  +  
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 56  KERTLKTILQENLNTLEATQKIHNE---------------EAEALKKEGNEAMIEGQYEE 100
           K + L  IL       E+ +K   E               +AE LK +GN+AM    YE 
Sbjct: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 101 AIKKYTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAK 159
           AI KYTEAI+    N  YY+NR+ A+S L  Y+ AV DA  AI+IDPS+ + YSRLG+AK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180

Query: 160 CCQDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTSE 219
             Q K E+ + AYK+ +D+EG NA++ +  DYE A+ K EQ           ++++   E
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQ---------SLNLEKTVPE 231

Query: 220 ECPEKNNNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLSNIARLLGSGVGGLMNNP 279
           +  + + +  +G +A       +                                 MNNP
Sbjct: 232 QSRDADVDASQGASAGGLPDLGSLLGGGLGGL------------------------MNNP 267

Query: 280 QLKQMVFQAINDNPDASRQVKDVLNNPLLRTTLSELMNTKMGGKTP--QEMLQSGTVNNL 337
           QL Q   Q +  NP A + ++ ++ +P +R       +   GG TP   +++ +  + N+
Sbjct: 268 QLMQAA-QKMMSNPGAMQNIQKMMQDPSIRQMAEGFAS---GGGTPNLSDLMNNPALRNM 323

Query: 338 IQSFLAGT 345
             +   G 
Sbjct: 324 AGNLFGGA 331

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  152 bits (384), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 111/366 (30%), Positives = 181/366 (49%), Gaps = 63/366 (17%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKER-- 58
           M+ + ++ +SLII YL+ + +   +  D  +SL VAI C+ E F ++ D L  +++ +  
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60

Query: 59  --TLKTIL----QENLNTLEA---TQKIH--------NEEAEALKKEGNEAMIEGQYEEA 101
             +L  +L    Q   NT E    T KI+          +AEALK EGN+A+    Y+ A
Sbjct: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQEDAETKAKAEALKLEGNKAVASKDYDLA 120

Query: 102 IKKYTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKC 160
           ++KYTEAI+    N  Y++NR+ AY+    Y++AV DA  AI +DP++SK YSRL YAK 
Sbjct: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180

Query: 161 CQDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTSEE 220
            Q+  E+ + AYK+ +++EG +A++     YE A+ + E        E     K V +E 
Sbjct: 181 VQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVE--------ESLNLEKSVPTES 232

Query: 221 CPEKNNNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLSNIARLLGSGVGGLMNNPQ 280
                                          + N +      + + L+  G+ GLMNNPQ
Sbjct: 233 A----------------------------GGQTNPAAGGGFPDFSSLMSGGLEGLMNNPQ 264

Query: 281 LKQMVFQAINDNPDASRQVKDVLNNPLLRTTLSELMNTKMGGKTP--QEMLQSGTVNNLI 338
           + Q   Q++  NP A  +++ ++ NP ++    +      GG TP   EM+ +  V N+ 
Sbjct: 265 MMQAA-QSMMSNPGAMEKIQSMMQNPAIQQMAEQF----KGGNTPDFSEMMNNPAVRNMA 319

Query: 339 QSFLAG 344
            S  +G
Sbjct: 320 SSLFSG 325

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  151 bits (382), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 108/330 (32%), Positives = 174/330 (52%), Gaps = 50/330 (15%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKER-- 58
           MSL+ ++  SLI+ +LS +  N  + ED  +SL VAI CI ESF  + D +  +L+++  
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60

Query: 59  --TLKTILQ---------ENLNTLEATQKIHNEE----AEALKKEGNEAMIEGQYEEAIK 103
             TLK IL          E   +++    + + E    AE+ K EGN+AM    Y  AI+
Sbjct: 61  GKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIE 120

Query: 104 KYTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQ 162
           KY+EAI+    NV YY+NR+ AYS +  Y++A+ DA  AI IDP++SK YSRL +AK   
Sbjct: 121 KYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYAL 180

Query: 163 DKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQLKKNDDSEERKSIK-EVTSEEC 221
           +K E+ +  YK+ +D+EG  A+  +  D+E A+ + E            S+  E +S   
Sbjct: 181 NKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVES-----------SMNLEKSSTTT 229

Query: 222 PEKNNNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLSNI--ARLLGSGVGGLMNNP 279
           PE   ++  G    N +A                S   D+S++        G+   +NNP
Sbjct: 230 PEP--SRSAGQQPANPFAG---------------SGMPDMSSLFGNGGGMGGLSSFLNNP 272

Query: 280 QLKQMVFQAINDNPDASRQVKDVLNNPLLR 309
           Q+ Q   Q ++D P++ +++++++ NP LR
Sbjct: 273 QVMQAAQQMMSD-PNSMQKMQEMMQNPNLR 301

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  150 bits (378), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 87/224 (38%), Positives = 127/224 (56%), Gaps = 27/224 (12%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKERTL 60
           MS +KE+ ASLI++Y S +     + ED  +SL VA+ CI E+F  + D + + L + T 
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 61  KTI-----------------------LQENLNTLEATQKIHNEEAEALKKEGNEAMIEGQ 97
           K                         ++ N+   +A  K   EE   LK +GN+AM   +
Sbjct: 61  KGQSLNNLLSSSSKLPESGKKDDAQNVEVNIPEEDAETKAKAEE---LKIQGNKAMANKE 117

Query: 98  YEEAIKKYTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLG 156
           YE AIKKYTEAI     N  YY+NR+ A+S L  Y++A+ DA  AI++DPS+ + YSRLG
Sbjct: 118 YELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLG 177

Query: 157 YAKCCQDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQ 200
           +AK  Q K E+ + AYK+ +D+EG NA+  +  DYE A+ + EQ
Sbjct: 178 FAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQ 221

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  149 bits (376), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 88/216 (40%), Positives = 124/216 (57%), Gaps = 16/216 (7%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGD----ILPTSLK 56
           M+ + ++ A+LI+ +LS     N + ED  +SL VAI CI E+F  + D    I+  S  
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60

Query: 57  ERTLKTILQENLNTLEATQK-----IHNEEA------EALKKEGNEAMIEGQYEEAIKKY 105
            R L  +L+     L    +     I  E+A      E LK +GN+AM    +E AIKKY
Sbjct: 61  NRKLDELLKSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKY 120

Query: 106 TEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDK 164
           TEAI+    N  YY+NR+ AYS L +YE++V DA  AI ++PS+SK YSRLG+AK    K
Sbjct: 121 TEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGK 180

Query: 165 LEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQ 200
            E+ + AYK  +D+EG  A+  +  DYE A+ K EQ
Sbjct: 181 PEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQ 216

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  149 bits (377), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 108/329 (32%), Positives = 164/329 (49%), Gaps = 37/329 (11%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKERTL 60
           M+ + +  +SLI+ YL+ + +   + ED  +SL VAI CI E+F ++      +   + L
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAAFGGKNL 60

Query: 61  KTILQ----------ENLNT-LEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAI 109
             +L           EN+   + A       +AE+LK EGN+AM    YE AIKKY+EAI
Sbjct: 61  AELLSAGAGAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAI 120

Query: 110 QF-SKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDG 168
                N  YY+NR+ A+S L  Y++A+ DA  A+ +D S+SK YSRLGYAK  Q K E+ 
Sbjct: 121 SVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEA 180

Query: 169 MTAYKRAIDLEGTNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTSEECPEKNNNQ 228
           + AYK+ +D+EG +A+  +  DYE A+ K EQ  + + ++E ++    T E       N 
Sbjct: 181 LEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEPA---GANP 237

Query: 229 DEGF------TAVNHYAQNNDNKSKEETKEENRSQAADLSNIARLLGSGVGGLMNNPQLK 282
             GF              NN    +   +     QA           S +  +M NP ++
Sbjct: 238 GGGFDLSSMLGGGLGGLLNNPQVMQAAQQMMQNPQAM----------SQMETMMQNPNVR 287

Query: 283 QMV--FQAINDNPDASRQVKDVLNNPLLR 309
           QM   F   N  P+    + D++NNP LR
Sbjct: 288 QMAEKFAGGNGTPN----LNDIMNNPALR 312

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  149 bits (375), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 110/342 (32%), Positives = 159/342 (46%), Gaps = 35/342 (10%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKERTL 60
           MS + ++ ASLI+ YLS L     + E+  +SL VAI CIGESF +           + L
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAVFGGKGL 60

Query: 61  KTILQENLNTLEATQKIHNE---------------EAEALKKEGNEAMIEGQYEEAIKKY 105
             +LQ    +   T     E               +AE LK EGN+AM    ++ AIKKY
Sbjct: 61  VELLQNESGSSSETATTQAESIKVNIPAEDAETKAKAETLKLEGNKAMACKDFDLAIKKY 120

Query: 106 TEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDK 164
           ++AI+    N  YY+NR+ A+S +  YE+A+ DA  AI  DP++SK YSRLGYAK    +
Sbjct: 121 SDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQ 180

Query: 165 LEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQ---LKKNDDSEERKSIKEVTSEEC 221
            ED + AYK+ +D+EG  AS  +  DYE A+ K EQ   L+K  +++ R +         
Sbjct: 181 AEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARGADAGAGGAGG 240

Query: 222 PEKNNNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLSNIARLLGSGVGGLMNNPQL 281
                +             NN    +   +     QA           S +  +M NP +
Sbjct: 241 SGGFGDFASMLGGGLGGLLNNPQLMQAAQQMMQNPQAM----------SQMESMMQNPGV 290

Query: 282 KQMV--FQAINDNPDASRQVKDVLNNPLLRTTLSELMNTKMG 321
           +QM   F   N  P+    + D++NNP LR     L     G
Sbjct: 291 RQMAENFAQGNGMPN----MGDLMNNPALRDMAGSLFGGANG 328

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  145 bits (367), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 115/370 (31%), Positives = 193/370 (52%), Gaps = 71/370 (19%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKE--- 57
           MS + +  A+LI+ +LS+   N  + ED  +SL VAI CI E+F  D + + T+L++   
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60

Query: 58  -RTLKTILQE--------------NLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAI 102
            R+LK +++               N+   +A  K    +AE+LK EGN+AM    +E+A+
Sbjct: 61  GRSLKQVVEAASVGSSSPQESVKVNIPVEDAETKA---KAESLKLEGNKAMAAKDFEQAV 117

Query: 103 KKYTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCC 161
            KY+EAIQ    N  YY+NR+ A+S L +YE+AV DA  AI ++PS+SK YSRLG+A+  
Sbjct: 118 LKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYA 177

Query: 162 QDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTSEEC 221
             K E+ + AYK+ +D+EG  A+  +  DY+ A  K  Q                     
Sbjct: 178 LGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQ--------------------- 216

Query: 222 PEKNNNQDEGFTAVNHYAQNNDNKSKEETKE--ENRSQAADLSNIARLLGSGVGGLMNNP 279
                            + N +  +   T++   + + +  L +I+ +LG G+GGL+NNP
Sbjct: 217 -----------------SLNVEKSAPAATRDGAGSATGSGGLPDISSMLGGGLGGLLNNP 259

Query: 280 QLKQMVFQAINDNPDASRQVKDVLNNPLLRTTLSELMNTKMGGKTPQ--EMLQSGTVNNL 337
           QL Q   Q +  NP+A   +++V+NNP ++    +  +   GG TP   +++ +  + ++
Sbjct: 260 QLMQAA-QQMMQNPNA---MQEVMNNPAVKQMAEKFQS---GGGTPSMADLMNNPALMDM 312

Query: 338 IQSFLAGTQQ 347
            ++   G +Q
Sbjct: 313 AKNMFGGGKQ 322

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  145 bits (367), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 113/357 (31%), Positives = 170/357 (47%), Gaps = 61/357 (17%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKER-- 58
           MSL  +   +LI+ +LS +   N + ED  +SL VA+ CI E+   D +++P ++K +  
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60

Query: 59  --TLKTILQ-----------ENLNTLEATQKIHNEE----AEALKKEGNEAMIEGQYEEA 101
             TL  IL            E   ++E    + + E    AEA K EGN+AM    +  A
Sbjct: 61  GKTLVDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120

Query: 102 IKKYTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKC 160
           ++KYTEAI+    N  YY+NR+ A+S L  +E+A+ DA  AI IDPS+SK YSRL +AK 
Sbjct: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180

Query: 161 CQDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTSEE 220
              K E+ + +YK+ +D+EG NA+  +  DYE A+ + E+               V   +
Sbjct: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMN------------VEKSK 228

Query: 221 CPEKNNNQDEGFTAVNHYAQNN----------DNKSKEETKEENRSQAADLSN-----IA 265
            PE    Q +G    N  AQ N          D  S            + LSN      A
Sbjct: 229 TPE----QGQGQQQTNESAQGNAPNPFAGGMPDMSSLFGGAGMGGGLGSLLSNPDFMSTA 284

Query: 266 RLLGSG------VGGLMNNPQLKQMVFQAINDNPDASRQVKDVLNNPLLRTTLSELM 316
           + L S       V  +M++P ++ +     N N D    + D++NNP +R   S L 
Sbjct: 285 QKLMSDPNAMQQVQSMMSDPSMRDLANNFKNGNTD----MNDIMNNPAIRNMASNLF 337

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  143 bits (361), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 90/211 (42%), Positives = 129/211 (61%), Gaps = 13/211 (6%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKE--- 57
           MS + +  A+LI+ +L+  T+   + ED ++SL+VAI CI E+F L      T + E   
Sbjct: 1   MSPSNKDIAALIVDFLT--TSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58

Query: 58  -RTLKTILQENL-NTLEATQ-KIHNEE----AEALKKEGNEAMIEGQYEEAIKKYTEAIQ 110
            R+L  +L   + +T +A + K+  EE    AEALK EGN AM    YE AI+KYT AI+
Sbjct: 59  GRSLSQLLTTGMAHTSDAGEPKVAAEELKKEAEALKLEGNRAMAAKDYETAIQKYTAAIE 118

Query: 111 -FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGM 169
               +  YY+NR+ AYS L +YE AV DA  A  +D S+SK +SRLGYAK    + E+ +
Sbjct: 119 VLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEAL 178

Query: 170 TAYKRAIDLEGTNASKTLYDDYEDARFKYEQ 200
            AYKR +D+EG NA++ +  DYE A+ K E+
Sbjct: 179 EAYKRVLDIEGDNATEAMRRDYESAKRKVEE 209

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  142 bits (358), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 113/362 (31%), Positives = 182/362 (50%), Gaps = 65/362 (17%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLD----GDILPTSLK 56
           M  + ++ A+LI+ +LS  T +  + E+  +SL VAI CI E+F ++     +I+  +  
Sbjct: 1   MPGSNKEIAALIVQFLSTSTKD--VQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58

Query: 57  ERTLKTILQENLN--TLEATQKIHN----------EEAEALKKEGNEAMIEGQYEEAIKK 104
            R L  +++   +  TL +++   N          E AE LK EGN+A     +E A+KK
Sbjct: 59  GRGLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKK 118

Query: 105 YTEAIQF-SKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQD 163
           YTEAI+    N  +Y NR+ AYS   ++E+AV DA  A+ I+PS+S+ YSRLG AK    
Sbjct: 119 YTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALG 178

Query: 164 KLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTSEECPE 223
           K E+ M AYK+ +D+EG NA++ +  DYE A+ K E+               +  E  P+
Sbjct: 179 KPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEE--------------SLNLEALPK 224

Query: 224 KNNNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLSNIARLLGSGVGGLMNNPQLKQ 283
                                   EE +    S A    +++ +LG G+GGL+NNPQ+ Q
Sbjct: 225 -----------------------GEEQQTSEGSSAGGFPDLSSMLGGGLGGLLNNPQVMQ 261

Query: 284 MVFQAINDNPDASRQVKDVLNNPLLRTTLSELMNTKMGGKTPQ--EMLQSGTVNNLIQSF 341
              Q +  NP A   +++++NNP ++       N   GG TP   +M++   + ++   F
Sbjct: 262 AA-QKMMQNPSA---MQEMMNNPAIKQMAQ---NFASGGGTPNLGDMMKDPNIKDMAGKF 314

Query: 342 LA 343
             
Sbjct: 315 FG 316

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  142 bits (359), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 98/331 (29%), Positives = 162/331 (48%), Gaps = 61/331 (18%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKER-- 58
           MS + +  A+L++ +LS       +  D  +SL VAI CI E+F  + D + ++L  +  
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60

Query: 59  --TLKTILQENLNT---------LEATQKIHNEE--------AEALKKEGNEAMIEGQYE 99
             +L  +L    N          ++ +    +EE        AEALK EGN+AM    Y 
Sbjct: 61  GKSLTELLDAATNAKGRSSSPEDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAKDYN 120

Query: 100 EAIKKYTEAIQFSKNVA-YYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYA 158
            A++KY  AI+     A YY+NR+ AYS   +Y++A+ DA  AI ++P++SK YSRLG+A
Sbjct: 121 LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA 180

Query: 159 KCCQDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTS 218
           K  Q K ++ + AYK+A++++G  A+  +  DYE A+ K EQ                  
Sbjct: 181 KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQ------------------ 222

Query: 219 EECPEKNNNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLSNIARLLGSGVGGLMNN 278
                               + N +  +         + A  + ++A +LG G+G  +NN
Sbjct: 223 --------------------SLNVEKSATPSASASASASAGGMPDMASMLGGGLGSFLNN 262

Query: 279 PQLKQMVFQAINDNPDASRQVKDVLNNPLLR 309
           PQ+ Q   Q ++ NP A  Q++ ++ NP +R
Sbjct: 263 PQIMQAAQQMMS-NPRAMEQMESMMQNPSIR 292

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  142 bits (358), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 109/334 (32%), Positives = 164/334 (49%), Gaps = 70/334 (20%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTS------ 54
           MSL  +   +LI++YL  + +   + ED  ESL VAI CI + F LD    PTS      
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELD----PTSEEKIIN 56

Query: 55  -------LKERTLKTILQENLNTL-------EATQKIHNEEAEALKKEGNEAMIEGQYEE 100
                  LK  TLK +  +N++ +       E   +   +EAEALK EGN+ M    Y+ 
Sbjct: 57  DVFNKSDLKTITLKGLGLQNVSDVVELEVKNEEISEDKKKEAEALKLEGNKQMSLKNYKS 116

Query: 101 AIKKYTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAK 159
           AI KY++AI+ +  N  YYSNR+ AY  +  + +AV DA  AI +DP++SKAYSRLG AK
Sbjct: 117 AIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAK 176

Query: 160 CCQDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARF---KYEQLKKNDDSEERKSIKEV 216
             +   ED + A+K+ ++LEG  +++ + +DYE+A+     +  L KN           V
Sbjct: 177 LAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKN-----------V 225

Query: 217 TSEECPEKNNNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLSNIARLLGSGVGGLM 276
                P   N  D                               L++IA +LGS  G LM
Sbjct: 226 PDPSGPPPLNTTDV------------------------------LTDIATVLGSSFGSLM 255

Query: 277 NNP-QLKQMVFQAINDNPDASRQVKDVLNNPLLR 309
           NN   +++        NP+  +QV+ ++ NP++R
Sbjct: 256 NNTQMMQRAQQMMQTQNPEMMQQVEGLMQNPVVR 289

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  137 bits (345), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 109/330 (33%), Positives = 168/330 (50%), Gaps = 38/330 (11%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLD----GDILPTSLK 56
           M+ TK++ ASLII YL        + ED  +SL VAI C+ E+F ++      ++  S  
Sbjct: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60

Query: 57  ERTLKTILQENLNTLEATQK--------IHNEE----AEALKKEGNEAMIEGQYEEAIKK 104
            ++L+ I+  +     ATQ+        + + E    AEALK EGN+AM    +E AI K
Sbjct: 61  GQSLEQIVGASSKGPTATQQEPVKVNIPVEDAEIKAKAEALKLEGNKAMATKDFEHAISK 120

Query: 105 YTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQD 163
           Y+EAI+    N  Y++NR+ AYS L +Y +AV DA  AI ++PS+SK YSRLG+A+    
Sbjct: 121 YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALG 180

Query: 164 KLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTSEECPE 223
           + E+ + AYK+ +D+EG+NA+  +  DY+ A  K EQ          +S    ++ E P+
Sbjct: 181 RPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQ-----SLNVERSAPAASNAESPD 235

Query: 224 KNNNQDEGFTAV-NHYAQNNDNKSKEETKEENRSQAAD--LSNIARLLGSGVGGLMNNPQ 280
                  GF  + +              K     QAA   + N      + +  +M+NP 
Sbjct: 236 AAGGS--GFPDIASMLGGGLGGGLGGLLKNPQVMQAAQQMMQN-----PNAMQEMMSNPA 288

Query: 281 LKQMV--FQAINDNPDASRQVKDVLNNPLL 308
           +KQM   FQ+    P     + D++NNP L
Sbjct: 289 IKQMADKFQSGGGTPS----MADLMNNPAL 314

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  127 bits (318), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 112/364 (30%), Positives = 188/364 (51%), Gaps = 55/364 (15%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGD----ILPTSLK 56
           MSL+ ++ A+LI+ +LS  ++++ ++ED  +SL VAI CI E+F  + D    ++     
Sbjct: 1   MSLSNKEIAALIVDFLS--SSSSSVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58

Query: 57  ERTLKTILQENLNTLEATQ---KIH--------NEEAEALKKEGNEAMIEGQYEEAIKKY 105
            + L  +L    ++   +    K+H          +AE LK +GN+AM   +++EAI+KY
Sbjct: 59  GKKLPELLASAPSSGGVSGEPVKVHIPVEDAAAKAKAEELKLQGNKAMAAKKFDEAIEKY 118

Query: 106 TEAIQFSK-NVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDK 164
           T AI+ S  N  YYSNR+ AYS L +YE AV DA  AI +DP++SK +SRLG+AK   +K
Sbjct: 119 TAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNK 178

Query: 165 LEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTSEECPEK 224
            E+ + AYK+ +D+EG  A+  +  DYE A+ K E     + S    S ++V+       
Sbjct: 179 PEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEKSSTSASSEDVS------- 231

Query: 225 NNNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLSNIARLLGSGVGG--LMNNPQLK 282
                              +KS  E          DLS++    G G G   L+NNPQ+ 
Sbjct: 232 -------------------DKSATEGPGAGAGGLPDLSSLLGGGGLGGGLGALLNNPQVM 272

Query: 283 QMVFQAINDNPDASRQVKDVLNNPLLRTTLSELMNTKMGGKTP--QEMLQSGTVNNLIQS 340
           Q   + +  NP     ++D+++NP ++   ++  +   GG  P   +M+   ++ ++ ++
Sbjct: 273 QAA-EKMMQNPGL---MQDMMSNPAMKQMANQFSS---GGGMPDLSQMMNDPSIRDMAKN 325

Query: 341 FLAG 344
              G
Sbjct: 326 MFGG 329

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  125 bits (315), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 101/368 (27%), Positives = 164/368 (44%), Gaps = 87/368 (23%)

Query: 3   LTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKERTLKT 62
           +  +  A LI+++L  + +   + +D  +SL VAI CI + ++L+   + +SL  +  K+
Sbjct: 6   INDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLILKFSKS 65

Query: 63  ILQENLN-------------------TLEATQ----------KIHNEE------------ 81
            L   LN                   TLE +            I N+             
Sbjct: 66  DLTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTS 125

Query: 82  -----------AEALKKEGNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSLAYSKLG 129
                      A+  K EGN  M    Y++AI+ YT AI ++  +  YYSNRS+AY K+ 
Sbjct: 126 KNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVN 185

Query: 130 RYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNASKTLYD 189
            YE A+NDA   I+ID +FSKAY RL   K  Q +  D +  YK+ I+L   +  + +  
Sbjct: 186 DYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITR 245

Query: 190 DYEDARFKYEQLKKNDDSEERKSIKEVTSEECPEKNNNQDEGFTAVNHYAQNNDNKSKEE 249
           ++ED + K +            S++E++++                 H   N +  S   
Sbjct: 246 EFEDLKLKVQT---------DISLREISND-----------------HSNNNYNENSYNS 279

Query: 250 TKEENRSQAADLSNIARLLGSGVGGLMNNPQLKQMVFQAINDNPDASRQVKDVLNNPLLR 309
           TK           +I  +LG G   L++NP L+QM+F+ I +NPDA++ +  VL NP ++
Sbjct: 280 TKNS--------PDIGSILGDGFAALLSNPMLQQMIFKIIQNNPDAAKNIGYVLANPAMK 331

Query: 310 TTLSELMN 317
             L    N
Sbjct: 332 NLLQNFKN 339

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score = 94.0 bits (232), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 106/397 (26%), Positives = 172/397 (43%), Gaps = 110/397 (27%)

Query: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGD----ILPTSLK 56
           M+ T ++ AS+I+ Y +    +  L++D  +SL VAI CI + F +D D    IL T+ +
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60

Query: 57  ERTLKTIL------------------------------------QENLNT-------LEA 73
              L T L                                    ++++N        +E 
Sbjct: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120

Query: 74  TQ--KIHNEE---AEALKKEGNEAMIEGQYEEAIKKYTEAIQ-FSKNVAYYSNRSLAYSK 127
           T+  K+ N++   AE LK++GNE M   QY +AI  Y++AI+ +  N  YY+NR+LAY K
Sbjct: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180

Query: 128 LGRYEDAVNDATLAINID----PSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDL----- 178
              ++ A+ DA  +I ID    P+  KAY RLG AK      E  + A+KR I++     
Sbjct: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240

Query: 179 EGTNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTSEECPEKNNNQDEGFTAVNHY 238
           +G   +K +  DYE A+ K ++L             ++T     E + N           
Sbjct: 241 KGDEITKQMDADYEKAKEKVQEL----------FFMQITKSTGKEGSGNSV--------- 281

Query: 239 AQNNDNKSKEETKEENRSQAADLSNIA-----------RLLGSG------VGGLMNNPQL 281
              ND   ++ T  +  + A +  NI            +LL S          +MN+P++
Sbjct: 282 ---NDGPKRKVTLNDILNMAGNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRV 338

Query: 282 KQMVFQAINDNPDASRQVKDVLNNPLLRTTLSELMNT 318
           +QM     N N D+   +      P+L+     L+NT
Sbjct: 339 RQM---KENVNSDSMSNI------PILKDLFYSLLNT 366

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 83.6 bits (205), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 67/103 (65%), Gaps = 2/103 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK--NVAYYSNRSLAYSKLGRYEDAVNDAT 139
           A+  K++GN A     Y++AI+ +T+AI+ SK  N   YSNRS  Y+ L ++ DA+NDA 
Sbjct: 5   ADEYKQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAK 64

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
             INI+PS+SK Y+RLG A      L++    YK+A++L+ +N
Sbjct: 65  ECININPSWSKGYNRLGAAHLGLGDLDEAENNYKKALELDASN 107

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 66/135 (48%), Gaps = 13/135 (9%)

Query: 40  IGESFSLDGDILPT------SLKERTLKTIL------QENLNTLEATQKIHNEEAEALKK 87
           IG ++   GD+  T      SL E     IL      ++ L   EA   I+ E+AE  + 
Sbjct: 342 IGNAYHKLGDLKKTIEYYQKSLTEHRTADILTKLRNAEKELKKAEAEAYINPEKAEEARL 401

Query: 88  EGNEAMIEGQYEEAIKKYTEAIQFSKNVAY-YSNRSLAYSKLGRYEDAVNDATLAINIDP 146
           EG +   +  +  A+K YTE I+ +   A  YSNR+ A +KL  + +A+ D   AI  DP
Sbjct: 402 EGKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDP 461

Query: 147 SFSKAYSRLGYAKCC 161
           +F +AY R   A+  
Sbjct: 462 NFVRAYIRKATAQIA 476

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 61/119 (51%), Gaps = 14/119 (11%)

Query: 52  PTSLKERTLKTILQEN---LNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEA 108
           PT+ KE +  T  +E     + +E  +     EA+  K EGN+     Q++EAI+ Y +A
Sbjct: 229 PTTEKEDSSNTPQREENKESDPMEVDEDDSKAEADKEKAEGNKFYKARQFDEAIEHYNKA 288

Query: 109 IQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPS---------FSKAYSRLGYA 158
            +  +++ Y +NR+ A  + G Y+ A+  ATL   ++            S++++R+G A
Sbjct: 289 WELHRDITYLNNRAAAEYEKGEYKTAI--ATLNDAVEQGREMRADYKVISRSFARIGNA 345

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 69/103 (66%), Gaps = 2/103 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK--NVAYYSNRSLAYSKLGRYEDAVNDAT 139
           A+  K++GN A +   YE+AI  +++AI+ S+  N  +YSNRS  Y+ L ++ +A+NDA 
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAE 63

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
             + I+P++SK Y+RLG A      L++   +YK+A++L+G+N
Sbjct: 64  ECVKINPTWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDGSN 106

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 75/160 (46%), Gaps = 22/160 (13%)

Query: 24  VLDE--DKKESLRVAITCIGESFSLDGDI-------------LPTSLKERTLKTIL---- 64
            LDE  +K   +R     I +SF+  G++                SL E     IL    
Sbjct: 311 TLDEAVEKGREMRTDYKLIAKSFARMGNVHHKTNNLKKAIEFYQKSLTEHRTPEILTKLR 370

Query: 65  --QENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAY-YSNR 121
             ++ L   EA + I+ E+AE  + EG +   +G +  A+K YTE I+ +   A  YSNR
Sbjct: 371 NTEKELKKQEAEEYINPEKAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNR 430

Query: 122 SLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCC 161
           + A SKL  + +A+ D   AI  DP+F +AY R   A+  
Sbjct: 431 AAALSKLMSFPEAIEDCNKAIEKDPNFIRAYIRKATAQIA 470

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 45/95 (47%), Gaps = 7/95 (7%)

Query: 89  GNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPS- 147
           GN+A    Q++EAI  Y  A    +++ Y +NRS A  + G  E A+     A+      
Sbjct: 263 GNKAYKARQFDEAIAHYDAAWNLHQDITYLNNRSAAEFEKGDAETALKTLDEAVEKGREM 322

Query: 148 ------FSKAYSRLGYAKCCQDKLEDGMTAYKRAI 176
                  +K+++R+G      + L+  +  Y++++
Sbjct: 323 RTDYKLIAKSFARMGNVHHKTNNLKKAIEFYQKSL 357

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 80.5 bits (197), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 65/103 (63%), Gaps = 2/103 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK--NVAYYSNRSLAYSKLGRYEDAVNDAT 139
           A+  K++GN A     Y +AI  +T+AI+ S+  N   YSNRS  Y+ L ++ DA+NDAT
Sbjct: 5   ADEYKQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDAT 64

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
             + I+PS+SK Y+RLG A      L+D  + YK+A++L+  N
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDDAESNYKKALELDAAN 107

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 55/109 (50%), Gaps = 14/109 (12%)

Query: 81  EAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATL 140
           EA+  K EGN+     Q+EEAI+ Y +A +  +++ Y +NR+ A  + G YE A+   T 
Sbjct: 258 EADKEKAEGNKFYKARQFEEAIEHYNKAWELHRDITYLNNRAAAEYEKGDYETAIATLTD 317

Query: 141 AIN-----------IDPSFSK---AYSRLGYAKCCQDKLEDGMTAYKRA 175
           A+            I  SF++   AY +LG  K   D  +  +T ++ A
Sbjct: 318 AVEQGREMRADYKVISKSFARIGNAYHKLGDLKKTIDNYQKSLTEHRTA 366

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 67/103 (65%), Gaps = 2/103 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK--NVAYYSNRSLAYSKLGRYEDAVNDAT 139
           A+  K++GN A     Y++AI+ +T+AI+ S+  N   YSNRS  Y+ L ++ DA+NDA 
Sbjct: 5   ADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDAN 64

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
             + I+PS+SK Y+RLG A      L++  + YK+A++L+ +N
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDASN 107

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 66/135 (48%), Gaps = 13/135 (9%)

Query: 40  IGESFSLDGDILPT------SLKERTLKTIL------QENLNTLEATQKIHNEEAEALKK 87
           IG ++   GD+  T      SL E     IL      ++ L   EA   ++ E+AE  + 
Sbjct: 342 IGNAYHKLGDLKKTIEYYQKSLTEHRTADILTKLRNAEKELKKAEAEAYVNPEKAEEARL 401

Query: 88  EGNEAMIEGQYEEAIKKYTEAIQFSKNVAY-YSNRSLAYSKLGRYEDAVNDATLAINIDP 146
           EG E   +  +  A+K YTE I+ +   A  YSNR+ A +KL  + +A+ D   AI  DP
Sbjct: 402 EGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDP 461

Query: 147 SFSKAYSRLGYAKCC 161
           +F +AY R   A+  
Sbjct: 462 NFVRAYIRKATAQIA 476

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 55/109 (50%), Gaps = 14/109 (12%)

Query: 81  EAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATL 140
           EA+  K EGN+     Q++EAI+ Y +A +  K++ Y +NR+ A  + G YE A++    
Sbjct: 261 EADKEKAEGNKFYKARQFDEAIEHYNKAWELHKDITYLNNRAAAEYEKGEYETAISTLND 320

Query: 141 AIN-----------IDPSFSK---AYSRLGYAKCCQDKLEDGMTAYKRA 175
           A+            I  SF++   AY +LG  K   +  +  +T ++ A
Sbjct: 321 AVEQGREMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSLTEHRTA 369

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 67/103 (65%), Gaps = 2/103 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK--NVAYYSNRSLAYSKLGRYEDAVNDAT 139
           AE  KK+GN A +   YE+A + +T+AI+ S+  N   YSNRS  ++ L ++ +A+NDA 
Sbjct: 3   AEEFKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDAN 62

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
             + I+P++SK Y+R+G A     KL++    YK+A++++ +N
Sbjct: 63  ECVKINPAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEIDTSN 105

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 1/91 (1%)

Query: 72  EATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAY-YSNRSLAYSKLGR 130
           EA   I  E+AE  + +G E   +G +  A+K YTE  + +   A  YSNR+ A +KL  
Sbjct: 391 EAQAYIDPEKAEEARLQGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMS 450

Query: 131 YEDAVNDATLAINIDPSFSKAYSRLGYAKCC 161
           + +A+ D  +AI+ DP+F +AY R   A+  
Sbjct: 451 FPEAIKDCDMAISKDPNFIRAYIRKATAQIA 481

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 55/104 (52%), Gaps = 14/104 (13%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           A+A K EGN+     +++EAI+ Y +A    K+V Y +NRS A  + G YE A+   T A
Sbjct: 267 ADAEKAEGNKFYKARKFDEAIEHYNKAWDLHKDVTYLNNRSAAEYEKGDYEQAIKTLTEA 326

Query: 142 INIDPS-------FSKAYSRLGYAKCCQDKLEDGMTAYKRAIDL 178
           +             SK+++R+G A     KLED    +K+AI+ 
Sbjct: 327 VEQGREMRADYKLISKSFARIGNAYL---KLED----FKKAIEF 363

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 66/103 (64%), Gaps = 2/103 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAY--YSNRSLAYSKLGRYEDAVNDAT 139
           A+  K++GN A     Y+ AI+ +T+AI+ S+  ++  +SNRS  Y+ L ++ DA+NDA 
Sbjct: 5   ADEYKQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDAN 64

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
             + I+PS+SK Y+RLG A      L++  + YK+A++L+  N
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDEAESDYKKALELDANN 107

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 15/136 (11%)

Query: 40  IGESFSLDGDILPT------SLKERTLKTILQENLNTLEATQK-------IHNEEAEALK 86
           IG ++   GD+  T      SL E     IL + L  +E  QK       I+ ++AE  +
Sbjct: 342 IGNAYHKLGDLKKTIEYYQKSLTEHRTADILAK-LRNVEKEQKKAEAEAYINPDKAEEAR 400

Query: 87  KEGNEAMIEGQYEEAIKKYTEAIQFSKNVAY-YSNRSLAYSKLGRYEDAVNDATLAINID 145
            EG E   +  +  A+K YTE I+ +   A  YSNR+ A +KL  + +A+ D   AI  D
Sbjct: 401 LEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKD 460

Query: 146 PSFSKAYSRLGYAKCC 161
           P+F +AY R+  A+  
Sbjct: 461 PNFVRAYIRMAAAQIA 476

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 46/87 (52%), Gaps = 11/87 (12%)

Query: 81  EAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATL 140
           EA+  K EGN+     Q++EAI+ Y  A +  K++ Y +NR+ A  + G YE  +  ATL
Sbjct: 261 EADNEKAEGNKFYKAHQFDEAIEHYNRAWELHKDITYLNNRAAAEYEKGDYETVI--ATL 318

Query: 141 AINIDPS---------FSKAYSRLGYA 158
              ++            SK+++R+G A
Sbjct: 319 NDAVEKGRDMRADYKVISKSFARIGNA 345

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 63/103 (61%), Gaps = 2/103 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFS--KNVAYYSNRSLAYSKLGRYEDAVNDAT 139
           A+ LK++GN A     +  AI+ +TEAI  S   N   YSNRS  Y+ L ++++A+NDA 
Sbjct: 4   ADELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQ 63

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
             + I+P +SK Y+R+G A      L+D  + YK+A++L+  N
Sbjct: 64  QCVKINPDWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSNN 106

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 56/103 (54%), Gaps = 2/103 (1%)

Query: 60  LKTILQENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAY-Y 118
           L+T  +E L   E  + I+ E+AE  + EG E   +  +  A+K YTE I+ +   A  Y
Sbjct: 369 LRTCEKE-LKKQEIEEYINPEKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGY 427

Query: 119 SNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCC 161
           SNR+ A +KL  + +A+ D   AI  DP+F +AY R   A+  
Sbjct: 428 SNRAAALAKLMSFPEAIKDCEKAIEKDPNFVRAYLRKATAQIA 470

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 50/96 (52%), Gaps = 7/96 (7%)

Query: 88  EGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPS 147
           EGN+     +++EAI +Y +A    K++ Y +NRS A  + G +E A+N    A+     
Sbjct: 262 EGNKLYKSHKFDEAIAEYNKAWDLHKDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGRE 321

Query: 148 F-------SKAYSRLGYAKCCQDKLEDGMTAYKRAI 176
                   +K+++R+G A   Q  L+  +  Y++++
Sbjct: 322 LRADYKLIAKSFARMGNAYSKQKNLKKAIEYYQKSL 357

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 66/103 (64%), Gaps = 2/103 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK--NVAYYSNRSLAYSKLGRYEDAVNDAT 139
           AE  KKEGN A +   ++ A++ +T AIQ S+  N   YSNRS AY+ L ++++A++DAT
Sbjct: 4   AEEYKKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDAT 63

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
             + I   +SK ++RLG A      L++   +YK+A++L+ TN
Sbjct: 64  ECVKIKADWSKGHNRLGAAHFGLGNLDEAEESYKKALELDATN 106

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 54/99 (54%), Gaps = 1/99 (1%)

Query: 64  LQENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAY-YSNRS 122
           L+  +   EA   I  E+AE  + +G E   +G +  A+K Y+E I  + + A  YSNR+
Sbjct: 374 LEREIKKREAEAYIDPEKAEKARLDGKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRA 433

Query: 123 LAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCC 161
            A SKL  + DA+ D   AI IDPSF +AY R   A+  
Sbjct: 434 AALSKLMSFPDAIKDCDKAIEIDPSFVRAYIRKATAQIA 472

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 55/107 (51%), Gaps = 7/107 (6%)

Query: 77  IHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVN 136
           +  E AE  K EGN+   + +++EAI KY EA    K++ Y +NR+ A  + G Y  A+ 
Sbjct: 253 LDRENAEKAKAEGNQLYKQRKFDEAIAKYEEAWNLQKDITYLNNRAAAEYEKGDYNSAIK 312

Query: 137 DATLAINIDPSF-------SKAYSRLGYAKCCQDKLEDGMTAYKRAI 176
               A+             +K+++RLG A    D+++  +  Y++++
Sbjct: 313 TLNEAVEQGRELRADYKVIAKSFARLGNAYYKLDEVKKAVEYYEKSL 359

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 66/103 (64%), Gaps = 2/103 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK--NVAYYSNRSLAYSKLGRYEDAVNDAT 139
           A+  K++GN A +   Y +AI  +T+AI+ S+  N   YSNRS  Y+   ++E+A+ DA 
Sbjct: 3   ADEFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAE 62

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
             + I PS+SK Y+R+G A+    +L++   +YKRA++L+ +N
Sbjct: 63  ECVKISPSWSKGYNRVGAAQFGLSQLDEAEKSYKRALELDSSN 105

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 59/107 (55%), Gaps = 11/107 (10%)

Query: 66  ENLNTLEATQK----------IHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNV 115
           E LN L +T+K          ++ E+AE  + +G E   +G +  A+K YTE ++ +   
Sbjct: 354 EVLNKLRSTEKELKKAESEAYVNPEKAEEARLQGKEFFTKGDWPNAVKAYTEMVKRAPQD 413

Query: 116 AY-YSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCC 161
           A  +SNR+ A +KL  + +A+ D   A++IDP+F +AY R   A+  
Sbjct: 414 ARGFSNRAAALAKLMSFPEAIEDCNKAVSIDPNFVRAYIRKATAQIA 460

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 55/102 (53%), Gaps = 7/102 (6%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAV---NDA 138
           AEA K EGN+     Q+EEAI+ Y +A +  K++ Y +NRS A  + G Y+ A+   NDA
Sbjct: 246 AEAEKAEGNKLYKARQFEEAIEHYNKAWELHKDITYLNNRSAAEFEKGDYDTAIKTLNDA 305

Query: 139 T---LAINID-PSFSKAYSRLGYAKCCQDKLEDGMTAYKRAI 176
                 +  D  + +K+++R+G A      L   +  Y R++
Sbjct: 306 VEQGRELRADYKTIAKSFARIGNAYYKLKDLRKAIEHYNRSL 347

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 74.3 bits (181), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 65/103 (63%), Gaps = 2/103 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK--NVAYYSNRSLAYSKLGRYEDAVNDAT 139
           A+  K++GN A    +YE+A+  +++AI+ S   N   YSNRS  Y+ L ++ DA+NDA 
Sbjct: 5   ADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDAN 64

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
               I+P++SK Y+R+G A      L++   +YK+A++L+ +N
Sbjct: 65  ECTKINPTWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDASN 107

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 58/99 (58%), Gaps = 1/99 (1%)

Query: 64  LQENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAY-YSNRS 122
           L++ +   EA   I+ E+AE  + +G +   +GQ+ +A+K YTE I  + + A  YSNR+
Sbjct: 374 LEKKIKVQEAEAYINPEKAEEARIQGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRA 433

Query: 123 LAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCC 161
            A SKL  + +A++D   A+  DP+F KAY R   A+  
Sbjct: 434 AALSKLMSFPEAISDCEKALEKDPNFVKAYIRKATAQIA 472

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 11/86 (12%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           A+A K EGN+     +++EAI+ Y +A +   ++ Y +N++ A  + G YE  +   TL 
Sbjct: 258 ADAEKDEGNKLYKAHKFDEAIEHYDKAWELHNDITYLNNKAAAQYEKGDYETTIK--TLE 315

Query: 142 INIDPS---------FSKAYSRLGYA 158
             I+            +KA++R+G A
Sbjct: 316 DAIEKGRELRADYKIIAKAFTRMGNA 341

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 73.9 bits (180), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 64/103 (62%), Gaps = 2/103 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK--NVAYYSNRSLAYSKLGRYEDAVNDAT 139
           A+  K +GN A +   Y+EAI+K+T+AI+ S+  N   YSNRS  Y+   ++   + DA 
Sbjct: 5   AQEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDAN 64

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
             + I+P++SK Y+R+G A      L++   AYK+A++L+ +N
Sbjct: 65  ECVKINPTWSKGYNRVGAAHFGMGDLDEAEKAYKKALELDSSN 107

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 48/86 (55%), Gaps = 1/86 (1%)

Query: 77  IHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAY-YSNRSLAYSKLGRYEDAV 135
           I+ E+AE  + EG E   +G +  A+K YTE I    + A  YSNR+ A SKL  + +A+
Sbjct: 384 INPEKAEEARLEGKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAI 443

Query: 136 NDATLAINIDPSFSKAYSRLGYAKCC 161
            D   AI  DP+F +AY R   A+  
Sbjct: 444 TDCNTAIEKDPNFIRAYIRKATAQIA 469

 Score = 37.0 bits (84), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAV 135
           A+A K EGN+     +++EAI+ Y +A +   ++ Y +NRS A  + G Y+ A+
Sbjct: 255 ADAEKAEGNKLYKAHKFDEAIEHYNKAWELHNDITYLNNRSAAEFEKGDYQTAI 308

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 64/103 (62%), Gaps = 2/103 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK--NVAYYSNRSLAYSKLGRYEDAVNDAT 139
           A+  K++GN A     + +AI+ +T+AI+ S   N   YSNRS AY+   ++++A+NDAT
Sbjct: 5   ADEYKQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDAT 64

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
             + I+P++SK Y+RLG A+     LE+    YK A+ L+  N
Sbjct: 65  ECVKINPTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNNN 107

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 70/154 (45%), Gaps = 20/154 (12%)

Query: 28  DKKESLRVAITCIGESFSLDG-------------DILPTSLKERTLKTIL------QENL 68
           D+   LR     I +SF+  G             D    SL E     IL      ++ L
Sbjct: 316 DQGRELRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQKSLTEHRTADILTKLRNCEKEL 375

Query: 69  NTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAY-YSNRSLAYSK 127
              EA Q I  E+AE  + EG E   +G +  A+K Y+E I+ +   A  YSNR+ A SK
Sbjct: 376 KKQEAEQYIDPEKAEEARLEGKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSK 435

Query: 128 LGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCC 161
           L  + +A+ D   AI  DP+F +AY R   A+  
Sbjct: 436 LMSFPEAIKDCDNAIKKDPNFVRAYIRKATAQIA 469

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 58/105 (55%), Gaps = 11/105 (10%)

Query: 81  EAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATL 140
           EA+  K EGN+     +++EAI++Y +A   +K++ Y +NRS A  + G +E A+  ATL
Sbjct: 254 EADEAKVEGNKLYKAHKFDEAIEQYNKAWALNKDITYLNNRSAAEFEKGDFETAI--ATL 311

Query: 141 AINIDPS---------FSKAYSRLGYAKCCQDKLEDGMTAYKRAI 176
              +D            +K+++R+G A   +  L+  +  Y++++
Sbjct: 312 NEAVDQGRELRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQKSL 356

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 67/103 (65%), Gaps = 2/103 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK--NVAYYSNRSLAYSKLGRYEDAVNDAT 139
           AE  KK+GN A +   +E+A + +++AI+ S+  N   YSNRS  Y+ L ++++A+ DA 
Sbjct: 3   AEEFKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAE 62

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
             + I+P++SK Y+R+G A+     L+D    YK+A++++ +N
Sbjct: 63  ECVKINPTWSKGYNRVGAAQYGLGNLDDAEKEYKKALEIDSSN 105

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 102/234 (43%), Gaps = 26/234 (11%)

Query: 54  SLKERTLKTIL------QENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTE 107
           SL E     IL      ++ L   EA   I  E+AE  + +G E   +G +  A+  YTE
Sbjct: 367 SLTEHRTPEILTKLRNTEKELKLREAKSYIDPEKAEEARLQGKEFFTKGDWPSAVSAYTE 426

Query: 108 AIQFSKNVAY-YSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLE 166
            I+ +   A  YSNR+   +KL  + DA+ D  +AI+ DP+F +AY R   A+    +  
Sbjct: 427 MIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDPNFVRAYIRKASAQIAVREFA 486

Query: 167 DGMTAY--KRAIDLE---GTNASKT--LYDDYEDARFKYEQLKKNDDSEERKSIKEVTSE 219
             M      RA DLE   G NA +   LY      RFK E   +  +    +++K+    
Sbjct: 487 PAMETLDAARAKDLEINKGANAREIEQLYVKASQQRFKPEDPNETPEQAYARALKD---- 542

Query: 220 ECPEKNN-NQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLSNIARLLGSGV 272
             PE     QD    ++   AQ N    +E  K       A  S I  L+ +G+
Sbjct: 543 --PEVAAIMQDPVMQSILSQAQQNPAALQEHMK-----NPAVFSKIQTLIAAGI 589

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (53%), Gaps = 7/102 (6%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           A+A K EGN+     +++EAI+ Y +A    ++V Y +NRS A  + G YE A+   T A
Sbjct: 267 ADAEKAEGNKYYKARKFDEAIEHYNKAWDLHRDVTYLNNRSAAEYEKGDYEQAIKTLTEA 326

Query: 142 INIDPS-------FSKAYSRLGYAKCCQDKLEDGMTAYKRAI 176
           ++            SK+++R+G A    D L+  +  Y+R++
Sbjct: 327 VDQGREMRADYKLISKSFARIGNAYLKMDDLKKAIEFYQRSL 368

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 64/103 (62%), Gaps = 2/103 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK--NVAYYSNRSLAYSKLGRYEDAVNDAT 139
           A+  K++GN A +   Y++AI  +++AI  S+  N   YSNRS  Y+ L ++ +A+ DA 
Sbjct: 5   ADEYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAE 64

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
             + I+PS+SK Y+R+G A      L++    YK+A++L+ +N
Sbjct: 65  ECVKINPSWSKGYNRVGAAHFGMGDLDEAEAGYKKALELDASN 107

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 47/97 (48%), Gaps = 14/97 (14%)

Query: 89  GNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINID--- 145
           GN+     Q++EA+ KY EA +   ++ Y +NRS A  + G YE ++     A+      
Sbjct: 270 GNKLYKARQFDEAVAKYNEAWEAHNDITYLNNRSAAEFEKGDYETSIKTLEEAVEKGREM 329

Query: 146 ----PSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDL 178
                  +K+++R+G    C  KL D     K+AID 
Sbjct: 330 RADYKVIAKSFARMG---NCYTKLND----LKKAIDF 359

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 63/103 (61%), Gaps = 2/103 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK--NVAYYSNRSLAYSKLGRYEDAVNDAT 139
           A+  K++GN A     +E+AI+ +T+AI+ S+  N   YSNRS  Y+   ++  A+ DA 
Sbjct: 3   ADEYKQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAK 62

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
             +NI+P++SK Y+R+G A      L++    YK+A++L+  N
Sbjct: 63  QCVNINPAWSKGYNRVGAAHFGLGDLDEAEQGYKKALELDSAN 105

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 1/86 (1%)

Query: 77  IHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAY-YSNRSLAYSKLGRYEDAV 135
           I  E+AE  + +G E   +G +  A+K YTE I+ +   A  YSNR+ A SKL  + +A+
Sbjct: 388 IDPEKAEEARLQGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAI 447

Query: 136 NDATLAINIDPSFSKAYSRLGYAKCC 161
            D  +AI+ DP+F +AY R   A+  
Sbjct: 448 KDCNVAISKDPNFIRAYIRKATAQIA 473

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 57/102 (55%), Gaps = 7/102 (6%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           A+A K EGN+     +++EAI+ Y++A +  K++ Y +NR+ A  + G YE A+   T A
Sbjct: 259 ADAEKAEGNKFYKARKFDEAIEHYSKAWELHKDITYLNNRAAAEYEKGEYETAIKTLTEA 318

Query: 142 INIDPSF-------SKAYSRLGYAKCCQDKLEDGMTAYKRAI 176
           +             SK+++R+G +    ++L+  +  Y++++
Sbjct: 319 VEQGRELRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSL 360

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 63/103 (61%), Gaps = 2/103 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK--NVAYYSNRSLAYSKLGRYEDAVNDAT 139
           A+  K++GN A    +Y+EA+  +T+AI+ S+  N   YSNRS +Y+   ++ +A+ DA 
Sbjct: 5   ADEYKQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDAL 64

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
               I+PS++K Y+R G A      L+D   +YK+A++L+  N
Sbjct: 65  ECTKINPSWAKGYTREGAAHFGMGNLDDAEASYKKALELDANN 107

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 50/86 (58%), Gaps = 1/86 (1%)

Query: 77  IHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAY-YSNRSLAYSKLGRYEDAV 135
           I+ E+AE  + EG E   +G +  A+K YTE I+ +   A  YSNR+ A SKL  + DA+
Sbjct: 380 INPEKAEEARLEGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAI 439

Query: 136 NDATLAINIDPSFSKAYSRLGYAKCC 161
           +D   AI  DP+F +AY R   A+  
Sbjct: 440 SDCNKAIEKDPNFVRAYIRKATAQIA 465

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 52/102 (50%), Gaps = 7/102 (6%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           AE  K EGN+A     ++EAI  Y +A +   N+ Y +NRS A  + G Y+ A+N    A
Sbjct: 251 AEEAKVEGNKAYKARNFDEAIACYNKAWELDNNITYLNNRSAAEFEKGEYDTAINTLNEA 310

Query: 142 INIDPS-------FSKAYSRLGYAKCCQDKLEDGMTAYKRAI 176
           I             +K+++R+G A      L++ +  Y++++
Sbjct: 311 IEKGREMRADYKIIAKSFARIGNAYVKMGNLKEAINHYQKSL 352

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 63/103 (61%), Gaps = 2/103 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK--NVAYYSNRSLAYSKLGRYEDAVNDAT 139
           AE  KKEGN A     +E+AI+ + +AI+ S+  N   YSNRS  Y+ + ++ +A+ DA 
Sbjct: 4   AEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQ 63

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
             + I P +SK ++RLG A      L++   +YK+A++L+ +N
Sbjct: 64  ECVRIKPDWSKGHNRLGAAHYGLGDLDEAEESYKKALELDSSN 106

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 59/116 (50%), Gaps = 9/116 (7%)

Query: 54  SLKERTLKTILQENLNTLEATQK-------IHNEEAEALKKEGNEAMIEGQYEEAIKKYT 106
           SL E     +L + L +LE  QK       I  E+AE  + +G E      +  A+K YT
Sbjct: 354 SLTEHRTPEVLNK-LRSLEKEQKKREAEAYIDPEKAEEARLQGKEYFTNADWPNAVKAYT 412

Query: 107 EAIQFSKNVAY-YSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCC 161
           E I+ +   A  YSNR+ A +KL  + DA+ D  +AI  DP+F +AY R   A+  
Sbjct: 413 EMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDPNFVRAYIRKATAQIA 468

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 51/102 (50%), Gaps = 7/102 (6%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           AE  K +GNE   + Q++EAI  Y +A    K++ Y +NR+ A  + G YE A+     A
Sbjct: 254 AEEAKAKGNELYKKRQFDEAIANYEKAWDLHKDITYLNNRAAAEYEKGDYESAIKTLEKA 313

Query: 142 INIDPSF-------SKAYSRLGYAKCCQDKLEDGMTAYKRAI 176
           +             +K+++RLG A      L+  +  Y++++
Sbjct: 314 VEEGRELRADYKVIAKSFARLGNAHYKLADLKKAIEYYEKSL 355

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 63/103 (61%), Gaps = 2/103 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK--NVAYYSNRSLAYSKLGRYEDAVNDAT 139
           A+  K++GN A +   YE+A + + +AI  S+  N   YSNRS  Y+ L ++ + + DA 
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAE 63

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
             + I+P +SK Y+R+G A+   + LED   +Y++A++L+  N
Sbjct: 64  ECVKINPGWSKGYNRVGAAQFGLNNLEDAEKSYQKALELDSAN 106

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 100/223 (44%), Gaps = 29/223 (13%)

Query: 20  TNNNVLDEDKKESLRVAITCIGESFSLDGD-------------ILPTSLKERTLKTIL-- 64
           T  N +DE ++  +R     I +SF+  G+                 SL E     +L  
Sbjct: 303 TLTNAVDEGRE--MRADYKVIAKSFARIGNAYHKLGDLKKSINFYQKSLTEHRSADVLNK 360

Query: 65  ----QENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAY-YS 119
               ++ L   EA + +  E+AE  + EG E   +  +  A+K YTE I+ S   A  YS
Sbjct: 361 LRNAEKELKKQEAEEYVDPEKAEEARLEGKEYFSKADWPNAVKAYTEMIKRSPQDARGYS 420

Query: 120 NRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYK--RAID 177
           NR+ A +KL  + +A+ D   AI  DP+F +AY R   A+    +    +      R  D
Sbjct: 421 NRAAALAKLMSFPEAIADCDRAIEKDPNFIRAYIRKASAQIAVKEFAAAVETLDTVRTKD 480

Query: 178 LE---GTNASKT--LYDDYEDARFKYEQLKKNDDSEERKSIKE 215
            E   G NA +   LY    + RF+ E + +N +   ++++K+
Sbjct: 481 SELNNGANAREIDQLYIKANNQRFQPEDVNENPEQTYQRAMKD 523

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 59/115 (51%), Gaps = 11/115 (9%)

Query: 71  LEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGR 130
           +E  +K     AE  K EGN+     +++EAI+ Y +A +  K++ Y +NR+ A  + G 
Sbjct: 237 MEVDEKGPQVAAEEEKAEGNKFYKARKFDEAIEHYNKAWELHKDITYLNNRAAAEYEKGD 296

Query: 131 YEDAVNDATLAINIDPS---------FSKAYSRLGYAKCCQDKLEDGMTAYKRAI 176
           YE A+  ATL   +D            +K+++R+G A      L+  +  Y++++
Sbjct: 297 YETAI--ATLTNAVDEGREMRADYKVIAKSFARIGNAYHKLGDLKKSINFYQKSL 349

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (58%), Gaps = 2/104 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK--NVAYYSNRSLAYSKLGRYEDAVNDAT 139
           A+  K+EGN A +   Y++AI  +T+AI+ S+  N   YSNRS AY+   +YE A++DA 
Sbjct: 5   ADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDAD 64

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNA 183
             I I+PS++K Y+R G A     K E+    Y   + ++  NA
Sbjct: 65  ECIKINPSWAKGYTRKGAALQGLHKYEEAEQCYNETLKIDPNNA 108

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (53%), Gaps = 7/108 (6%)

Query: 54  SLKERTLKTIL------QENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTE 107
           SL E     IL      +++L   EA   +  E+AE  + EG E   +  +  A+K YTE
Sbjct: 351 SLTEHRTPDILSKLRKAEKDLKQQEAEAYLSPEKAEEARLEGKEYFTKADWPNAVKSYTE 410

Query: 108 AIQFSKNVAY-YSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSR 154
            I+ + + A  YSNR+ A +KL  + DA++D   AI  DPSF +AY R
Sbjct: 411 MIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDPSFIRAYLR 458

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 54/103 (52%), Gaps = 7/103 (6%)

Query: 81  EAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATL 140
           EA+  K EGN+A    Q++EAI  Y +A +  K++ Y +NRS A  + G YE  +   T 
Sbjct: 250 EADKAKAEGNKAYKARQFDEAISHYNQAWETFKDITYLNNRSAAEYEKGDYETCIKTLTE 309

Query: 141 AINIDPSF-------SKAYSRLGYAKCCQDKLEDGMTAYKRAI 176
           A+             +K+++R+G A    D L+  +  Y++++
Sbjct: 310 AVENARELRTDYKIVAKSFARMGNAYAKLDDLKKAIEYYQKSL 352

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 63/103 (61%), Gaps = 2/103 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK--NVAYYSNRSLAYSKLGRYEDAVNDAT 139
           A+  K+EGN+A     Y +AI+ +T+AI+ S+  N   +SNRS  Y+    +  A++DA 
Sbjct: 3   ADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDAN 62

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
             + I+PS++K Y+RLG A      L++   +YK+A++L+  N
Sbjct: 63  ECVKINPSWAKGYNRLGAAHYGLGDLDEAEQSYKKALELDSAN 105

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 66/142 (46%), Gaps = 20/142 (14%)

Query: 33  LRVAITCIGESFSLDG-------------DILPTSLKERTLKTIL------QENLNTLEA 73
           LR     I +SF+  G             D    SL E     IL      ++ L   EA
Sbjct: 321 LRADYKVISKSFARMGNSYHKLGDLKKAIDYYEKSLTEHRTPDILTKLRNTEKELKQKEA 380

Query: 74  TQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAY-YSNRSLAYSKLGRYE 132
              +  E+AE  + +G E   +  + +A++ YTE I+ + N A  YSNR+ A SKL  + 
Sbjct: 381 ESYMDPEKAEEARLQGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFA 440

Query: 133 DAVNDATLAINIDPSFSKAYSR 154
           DA+ D   AI  DP+F +AY R
Sbjct: 441 DAIRDCDKAIEKDPNFVRAYIR 462

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 55/106 (51%), Gaps = 14/106 (13%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           AEA K EGN+   + +++EAI+KY EA +   ++ Y +NR+ A  + G YE A+   T A
Sbjct: 255 AEAAKAEGNKLYKQRKFDEAIEKYNEAWETHNDITYLNNRAAAEYEKGDYEAAIETLTKA 314

Query: 142 IN-----------IDPSFSK---AYSRLGYAKCCQDKLEDGMTAYK 173
           +            I  SF++   +Y +LG  K   D  E  +T ++
Sbjct: 315 VEQGRELRADYKVISKSFARMGNSYHKLGDLKKAIDYYEKSLTEHR 360

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 58/106 (54%), Gaps = 1/106 (0%)

Query: 65  QENLNTLEA-TQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSL 123
           + NL+ +++ T++  NE A ALK +GNE     ++E+AIK Y  A++   +  YYSN S 
Sbjct: 92  EPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPIYYSNISA 151

Query: 124 AYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGM 169
            Y+ L +YE  +  AT A+ + P+FSK   R   A        D M
Sbjct: 152 CYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAM 197

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 43/71 (60%)

Query: 84  ALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAIN 143
           A+K +GNE   E +YEEAIK Y+ A++  K+  +YSNRS  +  L + E  V D T A+ 
Sbjct: 100 AMKDKGNECFKEKKYEEAIKYYSCALRLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALE 159

Query: 144 IDPSFSKAYSR 154
           + P +SK   R
Sbjct: 160 LKPDYSKCLLR 170

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 54/110 (49%), Gaps = 10/110 (9%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           A  LK +GNE     Q+E+A+K Y+ AI+  ++  +YSNRS  Y  LG+ E  V D T A
Sbjct: 96  AMGLKDKGNEFFKNKQFEDALKYYSLAIEVKEDPVFYSNRSACYVSLGQQEKVVEDTTAA 155

Query: 142 INIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNASKTLYDDY 191
           + + P +SK   R   A     K  D M       DL       +LY D+
Sbjct: 156 LKLKPDYSKCLLRRASANESLGKFADAM------FDLSAV----SLYGDF 195

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 1/106 (0%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           A ALK +GNE   + +YEEAIK Y  A++  ++  +YSNRS  Y  L + E  V D T A
Sbjct: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAA 154

Query: 142 INIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNASKTL 187
           + + P +SK   R   A        D M     A+ L G  +S+T+
Sbjct: 155 LKLKPDYSKCLLRRATANESLGNYADAMLDLS-AVSLYGGYSSQTI 199

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 61/128 (47%), Gaps = 12/128 (9%)

Query: 67  NLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYS 126
           NL  L   QK  ++ A  LK +GNE     +Y+EAI+ Y+ AI+  ++  +YSNRS  Y 
Sbjct: 82  NLAELSDEQK--DKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEVKEDPVFYSNRSACYV 139

Query: 127 KLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNASKT 186
            LG+ E  V D T A+ + P +SK   R   A        D M       DL       +
Sbjct: 140 SLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAM------FDLSAV----S 189

Query: 187 LYDDYEDA 194
           LY D+  A
Sbjct: 190 LYGDFSGA 197

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (58%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           A ALK +GNE      +E+AI+ YT AI   ++  +YSNRS AY  +  +E  V D T A
Sbjct: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTTAA 163

Query: 142 INIDPSFSKAYSR 154
           + + P +SK + R
Sbjct: 164 LKLKPDYSKCWLR 176

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 80  EEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVA-YYSNRSLAYSKLGRYEDAVNDA 138
           E+A A K EGN  + E  Y +AI+ Y++AI+     + ++SNR+LA  KL  ++  +ND 
Sbjct: 10  EQAVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMNDC 69

Query: 139 TLAINIDPSFSKAYSRLG 156
            +A+ +DP   KAY R G
Sbjct: 70  DVALRLDPKNIKAYHRRG 87

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 81  EAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYEDAVNDAT 139
           +A   K EGN  + E  + +AI+KYTEAI   S    Y+SNR+L++ K+  ++ A+ND  
Sbjct: 11  KAHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCD 70

Query: 140 LAINIDPSFSKAYSR 154
            AI +DP   KAY R
Sbjct: 71  EAIKLDPKNIKAYHR 85

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 48/78 (61%), Gaps = 3/78 (3%)

Query: 80  EEAEAL--KKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYEDAVN 136
           + A+AL  K EGN  + E  + +AI+KYTEAI   S    Y+SNR+ A+ K+  ++ A+N
Sbjct: 8   DRAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALN 67

Query: 137 DATLAINIDPSFSKAYSR 154
           D   AI +DP   KAY R
Sbjct: 68  DCDEAIKLDPKNIKAYHR 85

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 52/96 (54%), Gaps = 8/96 (8%)

Query: 81  EAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVA-YYSNRSLAYSKLGRYEDAVNDAT 139
           +A   K EGN  + E  Y +AI+ YT+AI+   N + +YSNR+LA  KL  ++ A ND  
Sbjct: 11  KAVEFKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCN 70

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRA 175
            A+ +D    KAY R G A         G+  +KRA
Sbjct: 71  EALTLDSKNVKAYHRRGLANV-------GLLEFKRA 99

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 81  EAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVA-YYSNRSLAYSKLGRYEDAVNDAT 139
           +A   K  GN+A+    Y  AI+ YTEAI+    V+ Y+SNR++ + K+  ++  +ND  
Sbjct: 11  KALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCD 70

Query: 140 LAINIDPSFSKAYSRLG 156
            A+ IDP   KAY R G
Sbjct: 71  KALEIDPKNIKAYHRRG 87

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 60/107 (56%), Gaps = 13/107 (12%)

Query: 70  TLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKL 128
           T EA Q     +A  LK EGN+ + E +Y +A++ YT+AI+  S    ++SNR+LA  KL
Sbjct: 6   TTEAAQ-----QAIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKL 60

Query: 129 GRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRA 175
             ++  ++D   A+ +DP   KAY R G ++        G+  +K+A
Sbjct: 61  DNFQSCLDDCNSALELDPKNIKAYHRRGLSQL-------GLLHFKKA 100

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 72/133 (54%), Gaps = 6/133 (4%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAI-QFSKN-VAYYSNRSLAYSKLGRYEDAVNDAT 139
           ++ LK+ GN+   E  YE+A+  +T A+ Q S N    YSNR+ A+  L  Y +A+ D  
Sbjct: 8   SQELKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGK 67

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYE 199
             + + P++ K YSR+G A     KL++    +K+A+ L   N    ++   E A  KY 
Sbjct: 68  NCVELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKALQLNEQN----VHAKKELAYVKYL 123

Query: 200 QLKKNDDSEERKS 212
           Q+++   +++ K+
Sbjct: 124 QIQRKKAAQKPKT 136

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 50/91 (54%), Gaps = 1/91 (1%)

Query: 83  EALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAY-YSNRSLAYSKLGRYEDAVNDATLA 141
           E  + EG +  +  +Y +A+K YTE I+ +      + NR+  + KL      ++D   A
Sbjct: 430 EEARIEGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKA 489

Query: 142 INIDPSFSKAYSRLGYAKCCQDKLEDGMTAY 172
           I++DPS+ KAY R G+A+  +  L++ +  +
Sbjct: 490 ISVDPSYIKAYVRKGFAQITERDLDEALETW 520

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 59/127 (46%), Gaps = 10/127 (7%)

Query: 86  KKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAI--- 142
           K+ GN+   +  ++EAI  YT+A    +++ Y +N   A  + G Y + +     A+   
Sbjct: 299 KRIGNDLYKKRNFKEAIIHYTKAWNTFQDITYLNNIGAAQFERGDYGNVLKSLGQAVFFA 358

Query: 143 ---NIDPS-FSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKY 198
              N +P   +K+Y R+G A       E  +TAY+  + L G    K         R ++
Sbjct: 359 EHTNPEPQVLAKSYIRMGNAYHRIWDHEHAITAYEYGLMLNGNEEHKK---KLASLRVEF 415

Query: 199 EQLKKND 205
           E++KK +
Sbjct: 416 EKVKKGE 422

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (61%), Gaps = 3/76 (3%)

Query: 82  AEAL--KKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYEDAVNDA 138
           A+AL  K EGN  + E  + +AI+KYTEAI   +    Y+SNR+ A+ K+  ++ A+ND 
Sbjct: 10  AKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDC 69

Query: 139 TLAINIDPSFSKAYSR 154
             AI +DP   KAY R
Sbjct: 70  DEAIKLDPKNIKAYHR 85

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 47/88 (53%), Gaps = 7/88 (7%)

Query: 76  KIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAV 135
           K   E A ALK++GN    +  +E AIK YT A+   ++  YYSN S  YS L  YE  +
Sbjct: 89  KTKEEWAGALKEKGNALFKKKDFENAIKYYTFALSLKEDPVYYSNISACYSSLLNYEKVI 148

Query: 136 NDATLAINIDPSFSK-------AYSRLG 156
             AT A+ + P +SK       AY +LG
Sbjct: 149 EMATKALALRPDYSKVLVRRANAYEKLG 176

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 47/77 (61%), Gaps = 1/77 (1%)

Query: 81  EAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYEDAVNDAT 139
           EA  LK EGN  + +  + +AI  YT+AI   S    Y+SNR+LA+ KL  ++ ++ND  
Sbjct: 11  EALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCD 70

Query: 140 LAINIDPSFSKAYSRLG 156
            A+ +DP  +KAY R G
Sbjct: 71  EALKLDPKNAKAYHRRG 87

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 47/78 (60%), Gaps = 3/78 (3%)

Query: 80  EEAEAL--KKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYEDAVN 136
           + A AL  K EGN  + E  + +AI+KYT+AI   S    Y+SNR+ A+ K+  ++ A+N
Sbjct: 8   DRANALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALN 67

Query: 137 DATLAINIDPSFSKAYSR 154
           D   A+ +DP   KAY R
Sbjct: 68  DCDEALKLDPKNIKAYHR 85

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 86  KKEGNEAMIEGQYEEAIKKYTEAIQFSKNVA-YYSNRSLAYSKLGRYEDAVNDATLAINI 144
           K EGNE +    Y  A++ YT AI+     + ++SNR+LA  KL R++ A+ D+  AI +
Sbjct: 42  KNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDSARAIEL 101

Query: 145 DPSFSKAYSRLGYAKC 160
           D    KAY R G A C
Sbjct: 102 DAGNVKAYHRRGLAHC 117

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           A  LK +GNE   E ++++AIK Y  A++  K+  +YSNRS  Y  +G+ E  V D T A
Sbjct: 102 AMGLKDKGNEFFKEKKFDDAIKYYNLALELKKDPVFYSNRSACYVSMGQLEKVVEDTTAA 161

Query: 142 INIDPSFSKAYSR 154
           + +   +SK   R
Sbjct: 162 LKLKSDYSKCLLR 174

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 49/80 (61%), Gaps = 1/80 (1%)

Query: 80  EEAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYEDAVNDA 138
           E A   K EGN  +    Y++AI+ YT+AI+  S +  +YSNR+LA+ KL  ++ A++D 
Sbjct: 10  EAALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDC 69

Query: 139 TLAINIDPSFSKAYSRLGYA 158
             AI +D +  KAY R G A
Sbjct: 70  NDAIKLDNNNIKAYHRRGLA 89

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 51/101 (50%)

Query: 69  NTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKL 128
           N  E +Q++    A ALK  GNE   +  Y+ A+K Y  A+   K+  +YSN S  Y  L
Sbjct: 88  NIEELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYALVVKKDPVFYSNISACYVSL 147

Query: 129 GRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGM 169
           G+ +  V ++T A+ + P +SKA  R   A    +   D M
Sbjct: 148 GQLDKVVENSTKALELKPDYSKALLRRASANESLENYADAM 188

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 64/120 (53%), Gaps = 2/120 (1%)

Query: 65  QENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSL 123
           Q+ LN L  + +I + +A +    G   MI   Y  A   + +A+ + S+N  ++ +  +
Sbjct: 341 QKALNLLLKSLEIDSTDATSWYHLGRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGV 400

Query: 124 AYSKLGRYEDAVNDATLAINIDPSFSKAYSRLG-YAKCCQDKLEDGMTAYKRAIDLEGTN 182
            Y ++ +Y DA++  T AI ++P  S+ +  LG   + C +++ D + AYK+A  L+  N
Sbjct: 401 LYYQIAQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQVNDALDAYKQAARLDPNN 460

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (57%)

Query: 84  ALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAIN 143
           ALK +GN+   E +YE+A+K Y  A+   ++  +YSN S  Y  LG  E  V  +T A+ 
Sbjct: 101 ALKDKGNQFFKEQKYEDALKYYNYALDLKQDPVFYSNISACYVSLGNLEKVVESSTKALE 160

Query: 144 IDPSFSKAYSR 154
           + P +SKA  R
Sbjct: 161 LKPDYSKALLR 171

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 63/120 (52%), Gaps = 2/120 (1%)

Query: 65  QENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSL 123
           Q+ LN L  + +++  +A      G   MI   Y  A   + +A+ + S+N  ++ +  +
Sbjct: 259 QKALNFLLKSLEVNPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGV 318

Query: 124 AYSKLGRYEDAVNDATLAINIDPSFSKAYSRLG-YAKCCQDKLEDGMTAYKRAIDLEGTN 182
            Y ++ +Y DA++  T AI ++P  S+ +  LG   + C ++L D + AYK+A  L+  N
Sbjct: 319 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPEN 378

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 61/120 (50%), Gaps = 2/120 (1%)

Query: 65  QENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSL 123
           Q+ LN L  + +I   +A      G   MI   Y  A   + +A+ + S+N  ++ +  +
Sbjct: 288 QKALNLLLKSLEIDPSDAATWYHLGRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSIGV 347

Query: 124 AYSKLGRYEDAVNDATLAINIDPSFSKAYSRLG-YAKCCQDKLEDGMTAYKRAIDLEGTN 182
            Y ++ +Y DA++  T AI ++P  S+ +  LG   + C  +L D + AYK+A  L+  N
Sbjct: 348 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNKQLNDALDAYKQAARLDPDN 407

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 62/120 (51%), Gaps = 2/120 (1%)

Query: 65  QENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSL 123
           Q  LN L  + ++ + +A      G   M+   Y  A   + +A+ + S+N  ++ +  +
Sbjct: 291 QTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGV 350

Query: 124 AYSKLGRYEDAVNDATLAINIDPSFSKAYSRLG-YAKCCQDKLEDGMTAYKRAIDLEGTN 182
            Y ++ +Y DA++  T AI ++P  S+ +  LG   + C ++L D + AYK+A  L+  N
Sbjct: 351 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPNN 410

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 47/88 (53%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           A ALK +GN    E ++E+AI+ Y  AI+  ++  ++SN S  Y  LG  +  V  +T A
Sbjct: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISACYVSLGDLDKVVESSTRA 152

Query: 142 INIDPSFSKAYSRLGYAKCCQDKLEDGM 169
           + + P +SKA  R   A     + +D M
Sbjct: 153 LELKPDYSKALLRRASAYENMGRYQDAM 180

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 63/120 (52%), Gaps = 2/120 (1%)

Query: 65  QENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSL 123
           Q+ L  L  + ++ +++A      G   MI   Y  A   + +A+ + S+N  ++ +  +
Sbjct: 294 QKALGYLLKSLEVDSQDATTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGV 353

Query: 124 AYSKLGRYEDAVNDATLAINIDPSFSKAYSRLG-YAKCCQDKLEDGMTAYKRAIDLEGTN 182
            Y ++ +Y DA++  T AI ++P  S+ +  LG   + C ++L D + AYK+A  L+  N
Sbjct: 354 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLDPEN 413

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 62/121 (51%), Gaps = 2/121 (1%)

Query: 65  QENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSL 123
           Q+ LN L  + ++   ++      G   MI   Y  A   + +A+ + S+N  ++ +  +
Sbjct: 289 QKALNYLLKSLEVDPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGV 348

Query: 124 AYSKLGRYEDAVNDATLAINIDPSFSKAYSRLG-YAKCCQDKLEDGMTAYKRAIDLEGTN 182
            Y ++ +Y DA++  T AI ++P  S+ +  LG   + C ++L D + AYK+A  L+  N
Sbjct: 349 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLDPEN 408

Query: 183 A 183
            
Sbjct: 409 V 409

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 49/120 (40%), Gaps = 16/120 (13%)

Query: 96  GQYEEAIKKYTEAIQFSKNVAYYSNRSL-AYSKLGRYEDAVNDAT----LAINIDPSFSK 150
           G  + A   Y   +QF+      S ++L + + L R  D    A      A++I+P  S 
Sbjct: 70  GDADRAAMAYDATLQFNPQ----STKALTSLAHLYRSRDMFQRAAELYERALSINPELSD 125

Query: 151 AYSRLGYAKCCQDKLEDGMTAYKRAI-DLEGTNASK------TLYDDYEDARFKYEQLKK 203
            ++ LG+     D L+    +Y++A+  L   N  K       LYD Y    +  E   K
Sbjct: 126 VWATLGHCYLMLDDLQRAYNSYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAK 185

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 81  EAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK-NVAYYSNRSLAYSKLGRYEDAVNDAT 139
           EA   K +GN+ +    Y +AI+ YT+AI+       ++SNR+LA  KL R++ A+ D++
Sbjct: 8   EALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSS 67

Query: 140 LAINIDPSFSKAYSRLGYA 158
            AI +D S  K Y R G A
Sbjct: 68  KAIELDSSNVKGYHRRGMA 86

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 62/120 (51%), Gaps = 2/120 (1%)

Query: 65  QENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSL 123
           Q+ LN L  + ++   +A      G   M+   Y  A   + +A+ + S+N  ++ +  +
Sbjct: 298 QKALNYLLKSLEVDPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGV 357

Query: 124 AYSKLGRYEDAVNDATLAINIDPSFSKAYSRLG-YAKCCQDKLEDGMTAYKRAIDLEGTN 182
            Y ++ +Y DA++  T AI ++P  S+ +  LG   + C ++L D + AYK+A  L+  N
Sbjct: 358 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPEN 417

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (54%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           A ALK +GNE   E   EEAIK Y  A++F K+  +Y+N S  Y  L  +E  + +   A
Sbjct: 106 ALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKA 165

Query: 142 INIDPSFSKAYSR 154
           + + P +SK   R
Sbjct: 166 LELKPDYSKVLLR 178

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 62/120 (51%), Gaps = 2/120 (1%)

Query: 65  QENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSL 123
           Q+ L+ L  + ++   +A      G   MI   Y  A   + +A+ + S+N  ++ +  +
Sbjct: 287 QKALSFLSKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGV 346

Query: 124 AYSKLGRYEDAVNDATLAINIDPSFSKAYSRLG-YAKCCQDKLEDGMTAYKRAIDLEGTN 182
            Y ++ +Y DA++  T AI ++P  S+ +  LG   + C ++L D + AYK+A  L+  N
Sbjct: 347 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPEN 406

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 62/120 (51%), Gaps = 2/120 (1%)

Query: 65  QENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSL 123
           Q  LN L  + ++ + +A      G   M+   Y  A   + +A+ + S+N  ++ +  +
Sbjct: 361 QTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGV 420

Query: 124 AYSKLGRYEDAVNDATLAINIDPSFSKAYSRLG-YAKCCQDKLEDGMTAYKRAIDLEGTN 182
            Y ++ +Y DA++  T AI ++P  S+ +  LG   + C ++L D + AYK+A  L+  N
Sbjct: 421 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLDPNN 480

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 61/120 (50%), Gaps = 2/120 (1%)

Query: 65  QENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSL 123
           Q  LN L  + ++ + +A      G   M+   Y  A   +  A+ + S+N  ++ +  +
Sbjct: 299 QTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGV 358

Query: 124 AYSKLGRYEDAVNDATLAINIDPSFSKAYSRLG-YAKCCQDKLEDGMTAYKRAIDLEGTN 182
            Y ++ +Y DA++  T AI ++P  S+ +  LG   + C ++L D + AYK+A  L+  N
Sbjct: 359 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDTNN 418

>ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR112C (CYC8)
          Length = 910

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 62/120 (51%), Gaps = 2/120 (1%)

Query: 65  QENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSL 123
           Q  LN L  + +  + +A      G   M+   Y  A   + +A+ + S+N  ++ +  +
Sbjct: 295 QTALNLLLKSLEADSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGV 354

Query: 124 AYSKLGRYEDAVNDATLAINIDPSFSKAYSRLG-YAKCCQDKLEDGMTAYKRAIDLEGTN 182
            Y ++ +Y DA++  T AI ++P  S+ +  LG   + C ++L D + AYK+A+ L+  N
Sbjct: 355 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAVRLDPNN 414

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 51/97 (52%), Gaps = 8/97 (8%)

Query: 80  EEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKN-VAYYSNRSLAYSKLGRYEDAVNDA 138
           ++A   K EGN  +    Y +AI+KY +AI+       Y+SNR+L + KL  ++ A  D 
Sbjct: 7   DKALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDC 66

Query: 139 TLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRA 175
             A+ +DP   KAY R G A C       G+  +K+A
Sbjct: 67  DKALALDPKNVKAYHRRGLA-CV------GLLEFKKA 96

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 61/120 (50%), Gaps = 2/120 (1%)

Query: 65  QENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSL 123
           Q  LN L  + ++ + +A      G   M+   Y  A   +  A+ + S+N  ++ +  +
Sbjct: 295 QTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGV 354

Query: 124 AYSKLGRYEDAVNDATLAINIDPSFSKAYSRLG-YAKCCQDKLEDGMTAYKRAIDLEGTN 182
            Y ++ +Y DA++  T AI ++P  S+ +  LG   + C ++L D + AYK+A  L+  N
Sbjct: 355 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDTNN 414

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 62/120 (51%), Gaps = 2/120 (1%)

Query: 65  QENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSL 123
           Q+ LN L  + ++   +A      G   MI   Y  A   + +A+ + S+N  ++ +  +
Sbjct: 287 QKALNYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGV 346

Query: 124 AYSKLGRYEDAVNDATLAINIDPSFSKAYSRLG-YAKCCQDKLEDGMTAYKRAIDLEGTN 182
            Y ++ +Y DA++  T AI ++P  S+ +  LG   + C ++L D + AY++A  L+  N
Sbjct: 347 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYRQASRLDPDN 406

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 50/120 (41%), Gaps = 16/120 (13%)

Query: 96  GQYEEAIKKYTEAIQFSKNVAYYSNRSL-AYSKLGRYEDAVNDAT----LAINIDPSFSK 150
           G  + A   Y   +Q+++N    S ++L + + L R  D    A      A+ I+P  S 
Sbjct: 68  GDADRAAMAYDATLQYNQN----STKALTSLAHLYRSRDMFQRAAELYERAVTINPELSD 123

Query: 151 AYSRLGYAKCCQDKLEDGMTAYKRAI-DLEGTNASK------TLYDDYEDARFKYEQLKK 203
            ++ LG+     D L+    +Y++A+  L   N  K       LYD Y    +  E   K
Sbjct: 124 VWATLGHCYLMLDDLQRAYNSYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAK 183

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 52/96 (54%), Gaps = 2/96 (2%)

Query: 89  GNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPS 147
           G   MI   Y  A   + +A+ + S+N  ++ +  + Y ++ +Y DA++  T AI ++P 
Sbjct: 305 GRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 364

Query: 148 FSKAYSRLG-YAKCCQDKLEDGMTAYKRAIDLEGTN 182
            S+ +  LG   + C ++L D + AYK+A  L+  N
Sbjct: 365 ISEVWYDLGTLYETCNNQLSDALDAYKQAARLDPEN 400

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 1/80 (1%)

Query: 80  EEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVA-YYSNRSLAYSKLGRYEDAVNDA 138
           E A + K EGN+ + +  ++ A + YT+AI+     + +YSNR+LA  KL  + +A+ND 
Sbjct: 7   ELATSYKDEGNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDC 66

Query: 139 TLAINIDPSFSKAYSRLGYA 158
           T AI ++ S  KAY R G A
Sbjct: 67  TNAIELNSSNLKAYHRRGLA 86

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 45/88 (51%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           A ALK +GN+     +Y++AIK Y  A++  ++  +YSN S  Y  +G  +  V  +T A
Sbjct: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKA 158

Query: 142 INIDPSFSKAYSRLGYAKCCQDKLEDGM 169
           + + P +SK   R   A     K  D M
Sbjct: 159 LELKPDYSKVLLRRASANEGLGKFADAM 186

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 52/96 (54%), Gaps = 2/96 (2%)

Query: 89  GNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPS 147
           G   MI   Y  A   + +A+ + S+N  ++ +  + Y ++ +Y DA++  T AI ++P 
Sbjct: 297 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 356

Query: 148 FSKAYSRLG-YAKCCQDKLEDGMTAYKRAIDLEGTN 182
            S+ +  LG   + C ++L D + AYK+A  L+  N
Sbjct: 357 ISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNN 392

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 52/96 (54%), Gaps = 2/96 (2%)

Query: 89  GNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPS 147
           G   MI   Y  A   + +A+ + S+N  ++ +  + Y ++ +Y DA++  T AI ++P 
Sbjct: 305 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 364

Query: 148 FSKAYSRLG-YAKCCQDKLEDGMTAYKRAIDLEGTN 182
            S+ +  LG   + C ++L D + AYK+A  L+  N
Sbjct: 365 ISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNN 400

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 85  LKKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYEDAVNDATLAIN 143
            K +GNE + +  Y+ AI+ Y++AI   S    Y+SNR+LA+ K   +  AV D   A+ 
Sbjct: 15  FKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDNALK 74

Query: 144 IDPSFSKAYSRLG 156
           +DP   KAY R G
Sbjct: 75  LDPKNIKAYHRRG 87

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 52/96 (54%), Gaps = 2/96 (2%)

Query: 89  GNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPS 147
           G   MI   Y  A   + +A+ + S+N  ++ +  + Y ++ +Y DA++  T AI ++P 
Sbjct: 307 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 366

Query: 148 FSKAYSRLG-YAKCCQDKLEDGMTAYKRAIDLEGTN 182
            S+ +  LG   + C ++L D + AYK+A  L+  N
Sbjct: 367 ISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNN 402

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 52/96 (54%), Gaps = 2/96 (2%)

Query: 89  GNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPS 147
           G   MI   Y  A   + +A+ + S+N  ++ +  + Y ++ +Y DA++  T AI ++P 
Sbjct: 303 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 362

Query: 148 FSKAYSRLG-YAKCCQDKLEDGMTAYKRAIDLEGTN 182
            S+ +  LG   + C ++L D + AYK+A  L+  N
Sbjct: 363 ISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNN 398

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 38/71 (53%)

Query: 84  ALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAIN 143
           ALK +GN      ++EEAIK Y  AI+  +N  +YSN S  Y  L + E+ +     A+ 
Sbjct: 113 ALKDKGNSLFKADKFEEAIKYYNWAIELKENPIFYSNLSACYVSLNKLEEIIKYCNKALE 172

Query: 144 IDPSFSKAYSR 154
           + P +SK   R
Sbjct: 173 LKPDYSKVLLR 183

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 52/96 (54%), Gaps = 2/96 (2%)

Query: 89  GNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPS 147
           G   MI   Y  A   + +A+ + S+N  ++ +  + Y ++ +Y DA++  T AI ++P 
Sbjct: 292 GRIHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 351

Query: 148 FSKAYSRLGYA-KCCQDKLEDGMTAYKRAIDLEGTN 182
            S+ +  LG   + C ++L D + AYK+A  L+  N
Sbjct: 352 ISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPEN 387

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 50/101 (49%)

Query: 69  NTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKL 128
           N  E +++     + ALK +GNE   +  Y+ A+K Y  A+   K+  +YSN S  Y  +
Sbjct: 93  NVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNISACYVSM 152

Query: 129 GRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGM 169
            + +  V ++T A+ + P +SKA  R   A    +   D M
Sbjct: 153 NQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAM 193

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 44/88 (50%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           A ALK +GN+     +Y++AIK Y  A++  ++  +YSN S  Y  +G  +  V  +T A
Sbjct: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKA 158

Query: 142 INIDPSFSKAYSRLGYAKCCQDKLEDGM 169
           + I P +SK   R   A        D M
Sbjct: 159 LEIKPDYSKVLLRRASANEGLGNFADAM 186

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 47/91 (51%), Gaps = 2/91 (2%)

Query: 68  LNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSK 127
           ++ L A QK  ++ A  LK +GNE   E  YE A+K Y  A+   K+  +YSN S  Y  
Sbjct: 96  VDNLTADQK--DKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPVFYSNMSACYVS 153

Query: 128 LGRYEDAVNDATLAINIDPSFSKAYSRLGYA 158
           L   +  +  +T A+ + P +SKA  R   A
Sbjct: 154 LNELDKVIEMSTKALELKPDYSKALLRRATA 184

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 54/105 (51%), Gaps = 2/105 (1%)

Query: 76  KIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSLAYSKLGRYEDA 134
           +I   +A      G   MI   Y  A   + +A+ + S+N  ++ +  + Y ++ +Y DA
Sbjct: 307 EIDPSDAATWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 366

Query: 135 VNDATLAINIDPSFSKAYSRLG-YAKCCQDKLEDGMTAYKRAIDL 178
           ++  T AI ++P  S+ +  LG   + C ++L D + AYK+A  L
Sbjct: 367 LDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARL 411

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 3/78 (3%)

Query: 81  EAEALKKEGNEAMIEGQ-YEEAIKKYTEAIQFSKNVA-YYSNRSLAYSKLGRYEDAVNDA 138
           +A   K +GN   I+G+ + +A + Y++AI+     + Y+SNR+ A+ KL  ++ A+ND 
Sbjct: 11  KALEFKNQGN-VFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDC 69

Query: 139 TLAINIDPSFSKAYSRLG 156
             AI +DP   KAY R G
Sbjct: 70  NKAIELDPKNVKAYHRRG 87

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 40/70 (57%)

Query: 85  LKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINI 144
           LK +GN+      Y  AIK Y  A+  +K+  +YSN S  Y  LG+ +  +  +T A+ +
Sbjct: 125 LKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESSTKALEL 184

Query: 145 DPSFSKAYSR 154
           +P++SKA  R
Sbjct: 185 NPNYSKALLR 194

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 43/88 (48%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           A ALK +GN+     +Y++AIK Y  A++   +  +YSN S  Y  +G  +  V  +T A
Sbjct: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKA 158

Query: 142 INIDPSFSKAYSRLGYAKCCQDKLEDGM 169
           + + P +SK   R   A        D M
Sbjct: 159 LELKPDYSKVLLRRASANEGLGNFADAM 186

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 44/88 (50%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           A ALK +GN+     +Y++AIK Y  A++  ++  +YSN S  Y  +G  +  V  +T A
Sbjct: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKA 158

Query: 142 INIDPSFSKAYSRLGYAKCCQDKLEDGM 169
           + + P +SK   R   A        D M
Sbjct: 159 LELKPDYSKVLLRRASANEGLGNFADAM 186

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 49/84 (58%), Gaps = 1/84 (1%)

Query: 72  EATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGR 130
           E  +  + E+A  LK EGN+ + E  Y +A + YT+AI+   +N   YSNR+    KL  
Sbjct: 3   EEVKACNPEKALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDN 62

Query: 131 YEDAVNDATLAINIDPSFSKAYSR 154
           ++ +++DA  AI +D +  KAY R
Sbjct: 63  FQSSLDDAKRAIELDNNNLKAYHR 86

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 43/73 (58%), Gaps = 1/73 (1%)

Query: 112 SKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLG-YAKCCQDKLEDGMT 170
           S+N  ++ +  + Y ++G+  DA++  T AI ++P  S+ +  LG   + C D++ D + 
Sbjct: 445 SRNPIFWCSIGVLYYQIGQNHDALDAYTRAIRLNPYISEVWYNLGTLYETCNDQITDALD 504

Query: 171 AYKRAIDLEGTNA 183
           +Y+RA+ L+  N 
Sbjct: 505 SYERALSLDPENP 517

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 46/98 (46%), Gaps = 12/98 (12%)

Query: 118 YSNRSL-AYSKLGRYEDAVNDAT----LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAY 172
           YS ++L + + L R  D  + A+     A+ IDPS S  ++ LG+     D L+    AY
Sbjct: 196 YSTKALTSLASLYRARDMFHKASQLYERALAIDPSLSDIWATLGHCYLMLDDLQKAYNAY 255

Query: 173 KRAI-DLEGTNASK------TLYDDYEDARFKYEQLKK 203
           ++A+ +L   N  K       LYD Y    F  E  KK
Sbjct: 256 QQALNNLSDPNVPKLWHGIGILYDRYGSLDFAEEAFKK 293

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 36/66 (54%), Gaps = 1/66 (1%)

Query: 79  NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYEDAVND 137
           NE AE LK +GN     G YE AI  Y +A    S N  Y+SN + A  KL R+++AVN 
Sbjct: 38  NETAEDLKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNA 97

Query: 138 ATLAIN 143
               +N
Sbjct: 98  CDKGLN 103

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 54/111 (48%), Gaps = 5/111 (4%)

Query: 79  NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFS-----KNVAYYSNRSLAYSKLGRYED 133
           +E AE  K +GNE     +Y++A + Y + I+        N + +SNR+    +L  Y  
Sbjct: 75  HEVAENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRR 134

Query: 134 AVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNAS 184
            VND   A+  +P+  K + R+  A    DK ED   A +  + L+  +A+
Sbjct: 135 CVNDCRQALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIEFGLKLDSESAA 185

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 40/73 (54%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           A ALK +GN+   +  +E A+K Y  A+   ++  +YSN S  Y  LG+ E  V  +T A
Sbjct: 105 AMALKDKGNDYFKKQDFENALKYYNYALTLKQDPVFYSNISACYVSLGQLEKVVESSTEA 164

Query: 142 INIDPSFSKAYSR 154
           + +   +SKA  R
Sbjct: 165 LKLKHDYSKALLR 177

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 46/86 (53%), Gaps = 6/86 (6%)

Query: 72  EATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVA-YYSNRSLAYSKLGR 130
           EA QK     A   K +GN  + E +Y EA++ Y++AI+     + ++SNR+ +  KL  
Sbjct: 7   EAAQK-----ALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDN 61

Query: 131 YEDAVNDATLAINIDPSFSKAYSRLG 156
           +  A+ D   +I +DP   KA  R G
Sbjct: 62  FLTALEDCNKSIELDPKNIKAIHRRG 87

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 37/73 (50%)

Query: 79  NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDA 138
           NE A  LKK GN       YE AI  Y  A+Q   +  +YSN +  Y  L   ++A+   
Sbjct: 83  NEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLEHNKEAIEAC 142

Query: 139 TLAINIDPSFSKA 151
           + A+ ++P +SK 
Sbjct: 143 SKALELNPDYSKV 155

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 80  EEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVA-YYSNRSLAYSKLGRYEDAVNDA 138
           ++A   K +GN  + E +Y+EA++ Y++AI+     + Y+SNR+ +  +L  +  A  D 
Sbjct: 8   QQALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDC 67

Query: 139 TLAINIDPSFSKAYSRLG 156
             AI +DP   KA  R G
Sbjct: 68  DKAIALDPKNIKAIHRRG 85

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 38/91 (41%), Gaps = 1/91 (1%)

Query: 80  EEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKN-VAYYSNRSLAYSKLGRYEDAVNDA 138
           E A  LK +GN       +++AIK Y  AI+   N   +YSN S  Y   G     V   
Sbjct: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYT 182

Query: 139 TLAINIDPSFSKAYSRLGYAKCCQDKLEDGM 169
           T A+ I P  SKA  R   A        D M
Sbjct: 183 TKALEIKPDHSKALLRRASANESLGNFTDAM 213

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 48/102 (47%), Gaps = 8/102 (7%)

Query: 83  EALKKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           E  K+EGN    EG Y+ A + Y + +    +N   YSN+++A  KLGRY + V      
Sbjct: 4   EQYKEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKG 63

Query: 142 INIDPSFS-KAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
           +   P+ +   Y +L Y      +LE  +   K   D E +N
Sbjct: 64  LTFTPNTTDTVYKKLNY------RLEMALKNMKHVNDQEQSN 99

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 70/140 (50%), Gaps = 8/140 (5%)

Query: 79  NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNV-----AYYSNRSLAYSKLGRYED 133
           +E AE  KK+GN+     ++ +A + Y++ I     V     + Y+NR+    ++  Y  
Sbjct: 78  HEIAENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRR 137

Query: 134 AVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNAS-KTLYDDYE 192
            +ND   A+ ++P   K Y R+  A    ++L++ + + +    ++ TN S KTL    E
Sbjct: 138 CINDCKQALQLNPKNIKCYYRIAKAFTALERLDEALESIEFGEKIDNTNKSLKTLKLHIE 197

Query: 193 DARFKYE--QLKKNDDSEER 210
             + + E  +LK  ++ +ER
Sbjct: 198 TKQLEIEARRLKLENEKKER 217

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 36/89 (40%), Gaps = 1/89 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKN-VAYYSNRSLAYSKLGRYEDAVNDATL 140
           A  LK  GN       + EAIK Y  AI+   N   +YSN S  Y   G  E  +   T 
Sbjct: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186

Query: 141 AINIDPSFSKAYSRLGYAKCCQDKLEDGM 169
           A+ I P  SKA  R   A        D M
Sbjct: 187 ALEIKPDHSKALLRRASANESLGNFTDAM 215

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 49/98 (50%), Gaps = 5/98 (5%)

Query: 79  NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-----SKNVAYYSNRSLAYSKLGRYED 133
           +E AE  KK+GNE     ++++A + YT+ I       S N + ++NR+    +L  Y  
Sbjct: 80  HEIAENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRR 139

Query: 134 AVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTA 171
            + D + A+ I+P   K Y R   A     KLE+  +A
Sbjct: 140 CIEDCSKALTINPKNIKCYYRTSKAFFSLSKLEEAKSA 177

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 5/85 (5%)

Query: 79  NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFS-----KNVAYYSNRSLAYSKLGRYED 133
           +E AE  K +GN+     ++ EA   Y + I+        N A ++NR+    +L  Y  
Sbjct: 77  HEVAENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRS 136

Query: 134 AVNDATLAINIDPSFSKAYSRLGYA 158
            +ND   A+ ++P   K Y R+G A
Sbjct: 137 CINDCKHALTLNPKNIKCYYRMGKA 161

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 50/98 (51%), Gaps = 5/98 (5%)

Query: 79  NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-----SKNVAYYSNRSLAYSKLGRYED 133
           +E AE  KK+GNE     ++++A + Y++ +       S N + Y+NR+    +L  Y  
Sbjct: 80  HEIAENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRR 139

Query: 134 AVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTA 171
            + D + A+ I+P   K Y R   A    +KLE+  +A
Sbjct: 140 CIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEAKSA 177

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 46/93 (49%), Gaps = 5/93 (5%)

Query: 79  NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVA-----YYSNRSLAYSKLGRYED 133
           +E AE  K +GN+     ++ +A + YT+ I+   +VA      Y+NR+    +L  +  
Sbjct: 75  HEIAENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRS 134

Query: 134 AVNDATLAINIDPSFSKAYSRLGYAKCCQDKLE 166
            ++D   A+  +P   K Y R+G A    +K E
Sbjct: 135 CISDCKTALTYNPKNIKCYFRMGKAFTAINKFE 167

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 43/105 (40%), Gaps = 3/105 (2%)

Query: 66  ENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKN-VAYYSNRSLA 124
           + L  L A Q+     A  LK +GN       + +AIK Y  AI+   N   +YSN S  
Sbjct: 117 DRLRGLSAPQR--QAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISAC 174

Query: 125 YSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGM 169
           Y   G  +  V   T A+ I P  SKA  R   A        D M
Sbjct: 175 YISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAM 219

>AFR663W Chr6 (1648116..1651232) [3117 bp, 1038 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR047C (TFC4)
          Length = 1038

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 45/105 (42%), Gaps = 1/105 (0%)

Query: 75  QKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYED 133
           Q+  + E   L  E NEA +    + A + Y E I+  +KN A Y      Y   GRY D
Sbjct: 119 QRAIDPEVAQLLSEANEAFVRNDIQVAEQLYNEVIKKDAKNFAAYKTLGDIYHLQGRYND 178

Query: 134 AVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDL 178
             N   LA +++PS  + +  +         +   +  Y RAI +
Sbjct: 179 CCNSWFLAAHLNPSDWEFWKMVATLSSELKHIRQAVYCYSRAISM 223

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 5/98 (5%)

Query: 79  NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-----SKNVAYYSNRSLAYSKLGRYED 133
           +E AE  KK+GNE     ++++A + YT+ +       S N + ++NR+    +L  Y  
Sbjct: 80  HEIAENFKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRK 139

Query: 134 AVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTA 171
            V D   A+ I+P   K Y R+  +     KLE+  +A
Sbjct: 140 CVEDCGKALTINPKNIKCYYRISKSFFQLRKLEEAKSA 177

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 66/147 (44%), Gaps = 11/147 (7%)

Query: 79  NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQF----SK-NVAYYSNRSLAYSKLGRYED 133
           +E AE  K +GN+     +Y++A + Y   I      SK N + +SNR+    +L  Y  
Sbjct: 75  HEVAENFKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRR 134

Query: 134 AVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNASKTLYDDYED 193
            VND   A+  +    K Y R+  A    +KLED   A +  + L+  N +        D
Sbjct: 135 CVNDCKRALQYNVKNIKCYYRIAKAFLLLNKLEDAKQAAEFGLKLDPENQALNALRQNVD 194

Query: 194 ARFKYEQLKKNDDSEERKSIKEVTSEE 220
            +      K++ D+ E K +KE T  E
Sbjct: 195 KK------KQDADAFEAKKLKEQTERE 215

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 52/111 (46%), Gaps = 5/111 (4%)

Query: 79  NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFS-----KNVAYYSNRSLAYSKLGRYED 133
           +E A   K +GN+     ++ +A + Y +AI         N + Y+NR+    +L  Y  
Sbjct: 71  HEIAGNFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRR 130

Query: 134 AVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNAS 184
            +ND  +A++++P   K Y R+  A    +K +D   A +  +  +  N S
Sbjct: 131 CINDCKMALSLNPKNIKCYFRMAKAFLAIEKFDDCKEAIQFGLKFDLENKS 181

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           A+ LK +GN+       E AIK Y  A++  ++  +YSN S  Y  + + +  +  +  A
Sbjct: 158 AKELKNKGNQYFKSKDNENAIKYYEYALRLDQDPVFYSNISACYFAMNQLDKVIESSNKA 217

Query: 142 INIDPSFSKAYSR 154
           + + P +SKA  R
Sbjct: 218 LELKPDYSKALLR 230

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 52/112 (46%), Gaps = 6/112 (5%)

Query: 79  NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNV------AYYSNRSLAYSKLGRYE 132
           +E AE  K +GN+     ++++A   Y + IQ   N       + ++N++    +L  + 
Sbjct: 73  HEIAENFKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACELELKNFR 132

Query: 133 DAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNAS 184
             +ND   A+ ++P   K Y R+  A    DKLE+   + +  +  +  N S
Sbjct: 133 RCINDCKNALQLNPKNVKCYFRMTRAFFALDKLEEAKESVEFGLKFDPENTS 184

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 5/81 (6%)

Query: 80  EEAEAL--KKEGNEAMIEGQYEEAIKKYTEAIQF--SKNVAYYSNRSLAYSKLGRYEDAV 135
           + A+AL  K +GN+ + +  + +A + YT+AI+   +K++ ++SNR+LA+ K   ++ ++
Sbjct: 8   DSAKALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSI-FFSNRALAHLKQDNFQLSL 66

Query: 136 NDATLAINIDPSFSKAYSRLG 156
           ND   A+ +D    KAY R G
Sbjct: 67  NDCDKALELDSKNIKAYHRRG 87

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 54/111 (48%), Gaps = 5/111 (4%)

Query: 79  NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-----SKNVAYYSNRSLAYSKLGRYED 133
           +E AE  K +GN+     +Y++A + Y + ++      + N + + NR+    +L  +  
Sbjct: 77  HEIAENFKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNHRR 136

Query: 134 AVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNAS 184
            +ND   A+  +P   K + R+G A    +KLE+   A +  +  +  NA+
Sbjct: 137 CINDCKEALRYNPKNVKCFYRMGRAFFSLNKLEEAKEAIEFGLRFDSNNAA 187

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 36/89 (40%), Gaps = 1/89 (1%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKN-VAYYSNRSLAYSKLGRYEDAVNDATL 140
           A  LK +GN       + EAIK Y  AI+   N   +YSN S  Y   G     +   T 
Sbjct: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183

Query: 141 AINIDPSFSKAYSRLGYAKCCQDKLEDGM 169
           A+ I P  SKA  R   A        D M
Sbjct: 184 ALEIKPDHSKALLRRASANESLGNFTDAM 212

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 85  LKKEGNEAMIEGQYEEAIKKYTEA-IQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAIN 143
           L+ +GN+   +G+YE A+  Y  A +    N  + +N S+A  KL R+EDA++    A+ 
Sbjct: 11  LRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDRALE 70

Query: 144 I 144
           I
Sbjct: 71  I 71

>TDEL0B02330 Chr2 complement(423968..426076) [2109 bp, 702 aa] {ON}
           Anc_5.689 YOR080W
          Length = 702

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 9/86 (10%)

Query: 89  GNEAMIEGQYEEAIKKYT-------EAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           G+E + + + +  ++KYT         I   K V    N S  Y KLG  + A++ AT  
Sbjct: 40  GDEELTQLRAKHGLRKYTIPEPDKDSRIHHPKYVRLLDNMSATYEKLGDLKKALSYATKM 99

Query: 142 INIDPSFSKAYSRLGYAKCCQDKLED 167
           + +DP   K Y RLG  K  Q ++ D
Sbjct: 100 VEVDPYNLKCYIRLG--KILQKQVRD 123

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 51/109 (46%), Gaps = 5/109 (4%)

Query: 79  NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-----SKNVAYYSNRSLAYSKLGRYED 133
           +E A   K +GN+     +Y++A   Y++ I+      S N + Y NR+    +L  +  
Sbjct: 76  HEVAANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNFRS 135

Query: 134 AVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
            +ND   A+N +    KA+ R+G A     KLE+   +    + L+  N
Sbjct: 136 CINDCKKALNFNAKCVKAFYRMGQAYFKLKKLEEAKGSVLFGLKLDSQN 184

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 47/98 (47%), Gaps = 5/98 (5%)

Query: 79  NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYS-----NRSLAYSKLGRYED 133
           +E AE  K +GN+     ++ +A   Y + I+   + A  S     NR+    +L  Y  
Sbjct: 74  HEVAENFKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRR 133

Query: 134 AVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTA 171
            +ND   A+ ++P   KA+ R+G A    DKLE+   A
Sbjct: 134 CINDCREALKLNPKNPKAFFRIGKAFLQLDKLEEAAEA 171

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 37/88 (42%), Gaps = 7/88 (7%)

Query: 109 IQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDG 168
           I   K +    NR+  + K+G  E A+ DAT    I+P   K + R G       KL+D 
Sbjct: 88  IYHPKYIKLLDNRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDA 147

Query: 169 MTAYKRAI-------DLEGTNASKTLYD 189
              YK A+       D    N SKT  D
Sbjct: 148 YNTYKTALRNANFATDSLKINVSKTFID 175

>SAKL0C02816g Chr3 complement(264072..267428) [3357 bp, 1118 aa]
           {ON} similar to uniprot|P33339 Saccharomyces cerevisiae
           YGR047C
          Length = 1118

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 46/105 (43%), Gaps = 1/105 (0%)

Query: 75  QKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYED 133
           +++ + E   L  E NEA +    + A + Y + I+  +KN A Y      Y   GR+ D
Sbjct: 177 ERVLDPEVAQLLSEANEAFVRNDIQVAEQLYNDVIKMDAKNFAAYKTLGDIYQLQGRFND 236

Query: 134 AVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDL 178
             N   LA +++ S  + +  +       D +   +  Y RAI +
Sbjct: 237 CCNAWFLAAHLNSSDWEFWKMVATLSADLDHVRQAIYCYSRAISV 281

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 66/144 (45%), Gaps = 10/144 (6%)

Query: 79  NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-----SKNVAYYSNRSLAYSKLGRYED 133
           +E A   K +GN+     ++++A + Y + I+      S N + Y+NR+    ++  Y  
Sbjct: 75  HEIAGNFKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRR 134

Query: 134 AVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNASKTLYDDYED 193
            +ND   A+  +P   K Y R+G A    + LE+   + +  + ++ +N          D
Sbjct: 135 CLNDCKTALQYNPKNLKCYYRMGKAFLALELLEEAQKSVEFGLQVDSSNKP---LQSLLD 191

Query: 194 ARFKYEQLKK--NDDSEERKSIKE 215
              K ++ KK  N   E+ K I+E
Sbjct: 192 IVLKKQEAKKEQNSKKEQEKQIRE 215

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 35.4 bits (80), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 83  EALKKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYEDAV 135
           E LK +GN +   G Y EAI  Y   I     N   YSN+++A  K  R+++A+
Sbjct: 4   EELKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAI 57

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 37.0 bits (84), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 51/111 (45%), Gaps = 5/111 (4%)

Query: 79  NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFS-----KNVAYYSNRSLAYSKLGRYED 133
           +E AE  KK+GNEA    QY  A   Y   I+ +      N   + N++    ++  Y  
Sbjct: 71  HEIAENFKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRS 130

Query: 134 AVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNAS 184
            +ND   A++ +P   K Y R+  A    +K ++   + +  + ++  N+S
Sbjct: 131 CINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRESIEFGLKVDSRNSS 181

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 35.0 bits (79), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 85  LKKEGNEAMIEGQYEEAIKKYTEAIQFS-KNVAYYSNRSLAYSKLGRYEDAV 135
            K EGN+   EG Y  AIK Y + I+ + +N   YSN+++A  K  + ++AV
Sbjct: 6   FKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAV 57

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 34.7 bits (78), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 83  EALKKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYEDAVN 136
           E  K++GN    +G Y EA+  Y + I    +N   YSN+++A  KLG Y  A+ 
Sbjct: 5   EKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQ 59

>KLTH0F02508g Chr6 complement(214785..217952) [3168 bp, 1055 aa]
           {ON} similar to uniprot|P33339 Saccharomyces cerevisiae
           YGR047C
          Length = 1055

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 47/120 (39%), Gaps = 6/120 (5%)

Query: 75  QKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFS-KNVAYYSNRSLAYSKLGRYED 133
           +++ + E   L  E NEA +    + A   Y E I+   KN A Y      Y   GR+ D
Sbjct: 145 ERVLDPEVAQLLSEANEAFVRNDIQVAEHLYNEVIKKDVKNFAAYKTLGDIYQLQGRFND 204

Query: 134 AVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAI-----DLEGTNASKTLY 188
             N   LA +++PS  + +  +         +   +  Y RA+     D E       LY
Sbjct: 205 CCNSWFLAAHLNPSDWEFWKVVATLSSDLGHIRQAIYCYTRALRMNSDDWECLYGRSILY 264

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 7/66 (10%)

Query: 118 YSNRSLAYSKLGRYEDAVNDATLAI-------NIDPSFSKAYSRLGYAKCCQDKLEDGMT 170
           Y N S+++  +G Y   +ND   AI        I+P F+ AY+  G+ +   D  +    
Sbjct: 614 YPNNSISWCFIGNYFSLINDHDKAIKYLKKATTINPRFTYAYTLEGHEQASIDAFDTAKN 673

Query: 171 AYKRAI 176
            Y++AI
Sbjct: 674 CYRKAI 679

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 50/111 (45%), Gaps = 5/111 (4%)

Query: 79  NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-----SKNVAYYSNRSLAYSKLGRYED 133
           +E AE  K + N+     ++ +A + YT+ I+      S N + ++NR+    +L  Y  
Sbjct: 82  HEIAENFKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRS 141

Query: 134 AVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNAS 184
            V D   A+ I+P   K + R+G A     K ++   A    + ++  N  
Sbjct: 142 CVADCQKAMEINPMNLKCFYRMGKAFLALGKFKEAHDAVSFGLKIDEENVP 192

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 86  KKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYEDAV 135
           K++GN    +G Y EA+  Y   I    +N   YSN+++A  KLG +  A+
Sbjct: 12  KQQGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAI 62

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 49/98 (50%), Gaps = 5/98 (5%)

Query: 79  NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFS-----KNVAYYSNRSLAYSKLGRYED 133
           +E A   KK+GNE     ++++A + Y + +         N + ++N++    +L  Y  
Sbjct: 80  HEIAGGFKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRR 139

Query: 134 AVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTA 171
            + D + A++I+P  +K Y R   A    +KLE+  +A
Sbjct: 140 CIEDCSKALSINPKNTKCYYRTSKAFFQLNKLEEAKSA 177

>NCAS0B08010 Chr2 complement(1517575..1520772) [3198 bp, 1065 aa]
           {ON} Anc_1.88 YGR047C
          Length = 1065

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 43/106 (40%), Gaps = 1/106 (0%)

Query: 76  KIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYEDA 134
           ++ + E   L  E NEA +      A + Y E I+  ++N A Y      Y   GR  D 
Sbjct: 141 RVVDPEVAQLLSEANEAFVRNDLIVAERLYNEVIKKDARNFAAYETLGDIYQLQGRLNDC 200

Query: 135 VNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEG 180
            N   LA +I+ +  + +  +       D +   +  + R I L G
Sbjct: 201 CNSWFLAAHINSTDWEFWKVVAILSSELDHIRQAIYCFSRVIHLNG 246

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 49/111 (44%), Gaps = 5/111 (4%)

Query: 79  NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFS-----KNVAYYSNRSLAYSKLGRYED 133
           +E A   K  GNE     QY +A + YT+ I         N + Y+NR+    +L  +  
Sbjct: 71  HEIAGNFKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRK 130

Query: 134 AVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNAS 184
            + D   A++ +    K Y R+G A    D+ ++   + +  + ++  N S
Sbjct: 131 CIEDCKKALSFNVKNIKCYYRMGKAFLSVDRFDESKESIEFGLKIDSENKS 181

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 7/69 (10%)

Query: 115 VAYYSNRSLAYSKLGRY-------EDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLED 167
           + YY N+   +  +G Y       EDA+     A  IDP F+ AY+  G+     D  + 
Sbjct: 544 LTYYPNKPETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDA 603

Query: 168 GMTAYKRAI 176
               +++AI
Sbjct: 604 AKKCFRKAI 612

>NDAI0B05320 Chr2 (1299911..1303027) [3117 bp, 1038 aa] {ON}
           Anc_1.88 YGR047C
          Length = 1038

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 49/118 (41%), Gaps = 16/118 (13%)

Query: 75  QKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYED 133
           +++ + E   L  E NEA +    + A + Y E I+  ++N A Y      Y   GR  D
Sbjct: 118 ERVLDPEVAQLLSEANEAFVRSDLQVAERLYNEVIKKDARNFAAYETLGEIYQLQGRLND 177

Query: 134 AVNDATLAINI---DPSFSKAYSRLG------------YAKCCQDKLEDGMTAYKRAI 176
             N   LA +I   D  F K  + L             +++ C    E+  + Y+R++
Sbjct: 178 CCNSWFLAAHINSTDWEFWKVVAILSADLDHIRQAIYCFSRVCALNHEEWESLYRRSL 235

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 32.3 bits (72), Expect = 0.43,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 1/70 (1%)

Query: 86  KKEGNEAMIEGQYEEAIKKYTEAIQFS-KNVAYYSNRSLAYSKLGRYEDAVNDATLAINI 144
           K+EGNE   +G Y +AI  Y   I    +N   +SN+++A  KLG +  A+      + +
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQL 67

Query: 145 DPSFSKAYSR 154
             S   A  R
Sbjct: 68  AASPQHAALR 77

>TDEL0C06130 Chr3 (1108534..1111611) [3078 bp, 1025 aa] {ON}
           Anc_1.88 YGR047C
          Length = 1025

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 43/105 (40%), Gaps = 1/105 (0%)

Query: 75  QKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYED 133
           Q++ + E   L  E NEA +    + A + Y E I+  ++N A Y      Y   GR  D
Sbjct: 113 QRVLDPEVSQLLSEANEAFVRNDLQVAERLYNEVIKKDARNFAAYETLGEIYQLQGRLND 172

Query: 134 AVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDL 178
             N   LA +++ S    +  +         +   +  Y R I++
Sbjct: 173 CCNSWFLAAHLNSSDWSFWKIVAILSADLGHIRQAIYCYSRVINM 217

>Kwal_33.13428 s33 complement(219925..223083) [3159 bp, 1052 aa]
           {ON} YGR047C (TFC4) - transcription factor tau (TFIIIC)
           subunit 131 [contig 117] FULL
          Length = 1052

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 49/124 (39%), Gaps = 16/124 (12%)

Query: 75  QKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFS-KNVAYYSNRSLAYSKLGRYED 133
           +++ + E   L  E NEA +    + A + Y E I+   KN A Y      Y    R+ D
Sbjct: 144 ERVLDPEVAQLLSEANEAFVRNDIQVAEQLYNEVIKKDVKNFAAYKTLGDIYQLQQRFND 203

Query: 134 AVNDATLAINIDPS---FSKAYSRLG------------YAKCCQDKLEDGMTAYKRAIDL 178
             N   LA +++PS   F K  + L             Y +  +   E+    Y RA+  
Sbjct: 204 CCNSWFLAAHLNPSDWEFWKVVATLSADLGHIRQSIYCYTRALRMNSEEWECVYGRAVLY 263

Query: 179 EGTN 182
             TN
Sbjct: 264 RKTN 267

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 32.0 bits (71), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 3/75 (4%)

Query: 86  KKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYEDAVNDAT--LAI 142
           K+ GN    +G Y EA+  Y + I    +N   YSN+++A  KL  Y  A+      L  
Sbjct: 12  KELGNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRY 71

Query: 143 NIDPSFSKAYSRLGY 157
            + P  +   S+L Y
Sbjct: 72  ALGPEHAAIRSKLQY 86

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 32.0 bits (71), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 83  EALKKEGNEAMIEGQYEEAIKKYTEAIQFSK-NVAYYSNRSLAYSKLGRYEDA 134
           E  K +GN A  +  + +A+  Y +AI +   N   YSN ++A  KL  Y DA
Sbjct: 5   EEFKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNYADA 57

>SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {ON}
           highly similar to uniprot|Q12024 Saccharomyces
           cerevisiae YOR272W YTM1 microtubule-associated protein
          Length = 446

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 53/111 (47%), Gaps = 12/111 (10%)

Query: 44  FSLDGDILPTSLKERTLKTIL-QENLNTLEATQKI---------HNEEAEALKKEGNEAM 93
           F +DG++L TSL++  +K  L  E    +E T+ +         +NE+  +    GN  +
Sbjct: 56  FLIDGELLRTSLEDYLVKKGLSSETFLNIEYTRAVLPPSYLSSFNNEDWVSALDVGNREI 115

Query: 94  IEGQYEEAIKKYTEAIQFSKNVAYYSN--RSLAYSKLGRYEDAVNDATLAI 142
           I G Y+  ++ +  + +  K  + +S   R++ Y    R   A ND TL +
Sbjct: 116 ISGSYDGIVRTWNLSGKVEKQYSGHSGPIRAVKYISNTRLVSAGNDRTLRL 166

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 68/151 (45%), Gaps = 28/151 (18%)

Query: 33  LRVAITCIGESFSLDGDILPTSLKERTLKTILQENLNTLEATQKIHNEEAE--ALKKEGN 90
           + VAI+ I E +    D+   ++  + L+T         E  QK  +E+A+  +L K   
Sbjct: 357 MTVAISYINEGY----DVSALTMLGKWLET------KYPEVVQKRTDEQADRFSLSK--- 403

Query: 91  EAMIEGQYEEAIKKYTEA---IQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPS 147
             +I  QY + I    E    +Q    V +Y+N          ++  ++    A+++ P+
Sbjct: 404 --VITDQYLKVINTLPEIDPDVQLGLGVLFYAN--------DEFDKTIDCFKAALHVRPN 453

Query: 148 FSKAYSRLGYAKCCQDKLEDGMTAYKRAIDL 178
               ++RLG +    ++ E+ + AY RAI L
Sbjct: 454 DECMWNRLGASLANSNRSEEAIQAYHRAIQL 484

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/114 (20%), Positives = 56/114 (49%), Gaps = 10/114 (8%)

Query: 70  TLEATQKIHNEEAEALKKEGNEAMIE--GQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSK 127
           T E +++I ++  + L    N  MI+   +  E++ ++   ++  + + YY+        
Sbjct: 392 TTEESKRIESDLEDDLSHNFNAVMIKKFNRLAESLPEHDAKLELIRGLLYYAEDD----- 446

Query: 128 LGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGT 181
              ++  +     ++ I+P+    ++RLG +    +K ED + AY RA++L+ +
Sbjct: 447 ---FDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNLKPS 497

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 46/98 (46%), Gaps = 8/98 (8%)

Query: 95  EGQYEEAIKKYTEAIQFSKNVAYYSNR---SLAYSKLGRYEDAVNDATLAINIDPSFSKA 151
           E  +++ I+ + E+++ + N     NR   SLA S   + EDA+     A+N+ PSF +A
Sbjct: 444 EDDFDKTIECFKESLKINPNDEVMWNRLGASLANS--NKPEDAIQAYHRALNLKPSFVRA 501

Query: 152 YSRLGYAKC---CQDKLEDGMTAYKRAIDLEGTNASKT 186
              L  A     C  +  + +    R   +EG N  +T
Sbjct: 502 RYNLAVASMNIGCYKEAGEHLLTVLRMHQVEGVNNVET 539

>AEL062C Chr5 complement(519416..520567) [1152 bp, 383 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR032W
           (CPR7)
          Length = 383

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query: 118 YSNRSLAYSKLGRYEDAVNDATLAINID--PS--FSKAYSRLGYAKCCQDKLEDGMTAYK 173
           Y N +LA   +G Y+ A++     + +D  PS   +KAY R G     ++ LE+ ++ YK
Sbjct: 286 YLNMTLALFNMGSYDSAISYTNYVLEMDRVPSMDLAKAYYRRGNCYLAKNLLEEALSNYK 345

Query: 174 RA 175
           R 
Sbjct: 346 RC 347

>TPHA0G00240 Chr7 complement(37417..41709) [4293 bp, 1430 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1430

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 8/73 (10%)

Query: 129 GRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDK------LEDGMTAYKRAIDLEGTN 182
           G YE+A++     + +D     AY  LG +  C D       +E+ ++AY+ AID   +N
Sbjct: 27  GDYEEAIDICKQTLKLDKHNYFAYVFLGKSYSCLDSGDISKNIENAISAYREAIDSIPSN 86

Query: 183 --ASKTLYDDYED 193
             A K L+  +E+
Sbjct: 87  LLAWKGLFKLFEE 99

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 45/96 (46%), Gaps = 1/96 (1%)

Query: 89  GNEAMIEGQYEEAIKKYTEAIQFSKNVAY-YSNRSLAYSKLGRYEDAVNDATLAINIDPS 147
           GN   ++  +E+AIK + +A Q   N AY Y+ +   +S    ++ A N    A+  DP 
Sbjct: 542 GNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQ 601

Query: 148 FSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNA 183
              AY  LG +     + ++ +  +++A  +   N 
Sbjct: 602 HYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINV 637

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 96  GQYEEAIKKYTEAIQFSKNVA-YYSNRSLAYSKLGRYEDAVNDATLAINIDP 146
           G+Y  A++ + E  + + + A  +      Y  LGR +DAV + T+A+N+DP
Sbjct: 685 GRYSVALQYFEELTKLAPDEATVHFLLGQLYQILGRKKDAVKEFTIAMNLDP 736

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 26/46 (56%)

Query: 131 YEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAI 176
           +E+++     +  +DPSF+ AY+  G+     D  +  MT Y++A+
Sbjct: 426 HEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKAL 471

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 37/65 (56%), Gaps = 3/65 (4%)

Query: 84  ALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVA--YYSNRSLAYSKLGRYEDAVNDATLA 141
           AL K     +  G+Y  A++ + + ++ + + A  ++    L Y  +GR +DAV + T+A
Sbjct: 548 ALFKRAQLLLAMGKYNYALESFEKLVKIAPDEATIHFLLGQL-YQIVGRKQDAVKELTIA 606

Query: 142 INIDP 146
           +N+DP
Sbjct: 607 MNLDP 611

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 11/88 (12%)

Query: 71  LEATQKIHNEEAEALK-KEG-NEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKL 128
           +E  +   +EE E L+ K G  +  + GQ +    KY + +          NR+ ++ KL
Sbjct: 34  IELARSYSDEELENLRLKSGLPKRCVNGQGKPWHPKYIKLLD---------NRAASWEKL 84

Query: 129 GRYEDAVNDATLAINIDPSFSKAYSRLG 156
           G+ + A+ DA   I ++P   K Y R G
Sbjct: 85  GKLDKALKDAKNMIRVEPHNLKCYIRCG 112

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 84  ALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVA-YYSNRSLAYSKLGRYEDAVNDATLAI 142
           AL K+       GQY  A++ + +  Q + N A  +      Y  +GR +DA+   T+A+
Sbjct: 576 ALFKKSQLLFNLGQYSNALQNFEKLEQLTPNEAPVHFLLGQLYQIVGRKKDAITQFTIAM 635

Query: 143 NIDP 146
           N+DP
Sbjct: 636 NLDP 639

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 18/22 (81%)

Query: 125 YSKLGRYEDAVNDATLAINIDP 146
           YS LGR +DA+ + T+A+N+DP
Sbjct: 708 YSILGRKKDAIKEYTIALNLDP 729

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 41/96 (42%), Gaps = 1/96 (1%)

Query: 89  GNEAMIEGQYEEAIKKYTEAIQFSKNVAY-YSNRSLAYSKLGRYEDAVNDATLAINIDPS 147
           GN   ++  + EAIK + +A Q     AY Y+ +   Y+    ++ A      AI  DP 
Sbjct: 535 GNFLSLQKNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKAIACDPG 594

Query: 148 FSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNA 183
              AY  LG       + E+ +  +++A  +   N 
Sbjct: 595 HYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINV 630

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 84  ALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVA-YYSNRSLAYSKLGRYEDAVNDATLAI 142
           AL K+       GQY  A++ + +  Q + N A  +      Y  +GR +DA+   T+A+
Sbjct: 595 ALFKKSQLLFNLGQYSNALQNFEKLEQLTPNEAPIHFLLGQLYQIVGRKKDAITQFTIAM 654

Query: 143 NIDP 146
           N+DP
Sbjct: 655 NLDP 658

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 42/81 (51%), Gaps = 3/81 (3%)

Query: 68  LNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKY--TEAIQFSKNVAYYSNRSLAY 125
           LN  E   ++    + AL K+    +  GQY  A+  +   E++   +   ++   +L Y
Sbjct: 614 LNFYELATELQPNSSLALFKKSQLLLNMGQYSSALHNFERLESLTPDEAHVHFLLGNL-Y 672

Query: 126 SKLGRYEDAVNDATLAINIDP 146
             +G+ +DA+N  T+A+N+DP
Sbjct: 673 QIVGKKQDAMNQYTIAMNLDP 693

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 30/52 (57%)

Query: 131 YEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTN 182
           +++A+     AI +DP F+ AY+  G+     D  ++  + +++A+ +E T+
Sbjct: 508 HDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALTIEKTH 559

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 58/132 (43%), Gaps = 11/132 (8%)

Query: 55  LKERTLKTILQENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKN 114
           L+++T  + L   L TL+    I      A    GN   +   ++EAI  + +AIQ    
Sbjct: 471 LQDKTHLSALCAELLTLDKYNPI------AWCSMGNLHSLNKDHDEAITAFGKAIQLDPF 524

Query: 115 VAY-YSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQD--KLEDGMTA 171
            AY Y+ +   YS    +++A +    A+ I+ +   A   LG   CC    K E+ +  
Sbjct: 525 FAYAYTLQGHEYSNNDAFDNAKSCFRKALTIEKTHYNALYGLG--MCCVKLGKFEEALLF 582

Query: 172 YKRAIDLEGTNA 183
           +++A  L   N 
Sbjct: 583 FEKARALNPVNV 594

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 83  EALKKEGNEAMIEGQYEEAIKKYTEAIQFSK-NVAYYSNRSLAYSK 127
           +  K  GNE   +G+Y+ AI++Y + I     N   YSN ++AY K
Sbjct: 36  QHFKDIGNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLK 81

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 26/46 (56%)

Query: 131 YEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAI 176
           +E+++     +  +DPSF+ AY+  G+     D  +  MT Y++A+
Sbjct: 425 HEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKAL 470

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 84  ALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVA--YYSNRSLAYSKLGRYEDAVNDATLA 141
           AL K     +  G+Y  A++ + + +  + + A  ++    L Y  +GR +DAV + T+A
Sbjct: 547 ALFKRAQLLLAMGKYNFALENFEKLVTIAPDEATIHFLLGQL-YQIVGRKQDAVKELTIA 605

Query: 142 INIDP 146
           +N+DP
Sbjct: 606 MNLDP 610

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 80  EEAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYEDAVN 136
           E+ + LK +GN    +  YE A+  Y +AI     N   YSN ++   KL ++ +AV+
Sbjct: 2   EDFDTLKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVD 59

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 96  GQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDP 146
           G+Y  A++ + + I+  S+N   +      Y  +GR +DAV + T+A+N+DP
Sbjct: 644 GRYSLAVELFEDLIKLDSENPNLHYMLGKIYQTMGRKKDAVKEYTVAMNLDP 695

>NCAS0A08420 Chr1 complement(1667102..1668286) [1185 bp, 394 aa]
           {ON} Anc_1.456
          Length = 394

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 23/119 (19%)

Query: 80  EEAEALKKEGNEAMIEGQYEEAIKKYTEAIQF------------SKNVAY-------YSN 120
           E A+ +K  G+    +  Y+ A+ KY +++++              N+ +       Y N
Sbjct: 239 EAADIIKNSGSLLFKQKDYKNALFKYKKSLKYVNEYIPEPDVDEKNNIKFLTLKMKLYLN 298

Query: 121 RSLAYSKLGRYEDAVNDATLAINID--PSF--SKAYSRLGYAKCCQDKLEDGMTAYKRA 175
            SL    L +Y+D++  AT  +++D  P+   +KAY R G +   +  LED    YK+ 
Sbjct: 299 MSLMMYYLKQYDDSILYATYLLDMDNVPNLDKAKAYYRRGNSYYMKKLLEDAKKDYKKC 357

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 32/71 (45%)

Query: 106 TEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKL 165
           ++ I   K V  Y N S  Y KL   + A   ++  I+I+P   K Y R+G     Q K 
Sbjct: 62  SDKIYHPKLVKLYDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKD 121

Query: 166 EDGMTAYKRAI 176
            +    YK+ +
Sbjct: 122 PEAYKCYKKGL 132

>TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {ON}
           Anc_8.721 YOR272W
          Length = 457

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 55/118 (46%), Gaps = 13/118 (11%)

Query: 38  TCIGESFSLDGDILPTSLKERTLKTIL-QENLNTLEATQKI---------HNEE-AEALK 86
           T I   F +DG +L TSL+E  +   L  E    +E T+ +         +NE+   AL 
Sbjct: 51  TVIPFDFLIDGKLLRTSLEEYLVANGLSSETFLNVEYTRAVLPPSFLNSFNNEDWVSALD 110

Query: 87  KEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSN--RSLAYSKLGRYEDAVNDATLAI 142
              N+ +I G Y+  ++ YT + +  K  A ++   R++ Y    R   A ND ++ +
Sbjct: 111 VGDNKHLISGSYDGVLRSYTMSGKVVKQYAGHNGAIRAVKYISNTRLVSAGNDRSVRL 168

>TPHA0A00550 Chr1 complement(91847..96736) [4890 bp, 1629 aa] {ON}
           Anc_3.61 YNL297C
          Length = 1629

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 52/126 (41%), Gaps = 15/126 (11%)

Query: 126 SKLGRYEDAVNDAT-LA-------INIDPSFSKAYSRLGYAKCCQDKLE----DGMTAYK 173
           S+LG   D+   AT LA         + P+F K YSR  Y   C+  L+      +   K
Sbjct: 95  SQLGALLDSFISATHLADEIKLKVFQVLPTFFKTYSRYIYGPLCEKLLQCCSSSLLLGSK 154

Query: 174 RAIDLEGTNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTSEECPEKNNNQDEGFT 233
            A+ ++  NA+     D    R  YE    ++D E +  + EV  +       NQD   T
Sbjct: 155 TAVIIDTANATMQQLIDEIFERLDYEW--NSNDKETQSVLNEVIYDVIVADGENQDNKQT 212

Query: 234 A-VNHY 238
             VN Y
Sbjct: 213 IKVNAY 218

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 39/86 (45%), Gaps = 7/86 (8%)

Query: 125 YSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAI-DLEGTNA 183
           Y     ++ AV+    A+ +D + ++ +S LG++    D+L+    AY++A+  L   N 
Sbjct: 79  YRSTDAFDKAVHYYEKAVALDSTLAEVWSLLGHSYLMLDELQKAYNAYQQALYHLADPNV 138

Query: 184 SK------TLYDDYEDARFKYEQLKK 203
            +       LYD Y    +  E   K
Sbjct: 139 PRLWHGIGILYDRYGSLEYAEEAFAK 164

>ZYRO0F16544g Chr6 (1360946..1364032) [3087 bp, 1028 aa] {ON}
           similar to uniprot|P33339 Saccharomyces cerevisiae
           YGR047C
          Length = 1028

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 39/99 (39%), Gaps = 1/99 (1%)

Query: 81  EAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYEDAVNDAT 139
           E   L  E NEA +    + A + Y E I+  +KN   Y      Y   GR  D  N   
Sbjct: 118 EVAQLLSEANEAFVRSDLQVAERVYNEVIKKDAKNFVAYETLGDIYQLQGRLNDCCNSWF 177

Query: 140 LAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDL 178
           LA +++ S  + +  +         +   +  Y R I++
Sbjct: 178 LAAHLNSSDWEFWKIVAVLSADLGHIRQAIYCYSRVINI 216

>SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} similar
           to uniprot|P47103 Saccharomyces cerevisiae YJR032W CPR7
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 432

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 51/115 (44%), Gaps = 23/115 (20%)

Query: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK-------------------NVAYYSNRS 122
           A  +K+ G +   +  +++A  KY +A+++                      +  Y N S
Sbjct: 279 ANKIKESGTQLFKKKDFQDAFFKYRKALRYVNEYIPDMDVDEELSVKFAELKMKLYLNIS 338

Query: 123 LAYSKLGRYEDAVNDATLAINID--PSF--SKAYSRLGYAKCCQDKLEDGMTAYK 173
           L    L +Y+ A+  AT  + ++  P+   +KAY R G     +++LE+ +  YK
Sbjct: 339 LVLFNLKKYDSAITHATYLLEMEKVPTLDKAKAYYRRGNCYLAKNRLEEALKDYK 393

>NCAS0D02940 Chr4 complement(558088..559923) [1836 bp, 611 aa] {ON}
           Anc_6.73
          Length = 611

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 96/219 (43%), Gaps = 28/219 (12%)

Query: 64  LQENLNTLEATQKIHNEEAEALKKE--GNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNR 121
           L++NL T   +  + N++ + LKK+   + A+++   +E  K  T+ IQ+   V+ +   
Sbjct: 207 LKKNLQTFLMSATL-NDDIQELKKKFCRSPAILKFNDDEINKDQTKLIQYYVKVSEFDKF 265

Query: 122 SLAYS--KLGRYEDAVNDATLAI--NIDPSF--SKAYSRLGYAKCCQDKLEDGMTAYKRA 175
            L Y   KLG     +   TL    NID  +       + G   C  +  E    + +  
Sbjct: 266 LLCYVIFKLG----LIKGKTLIFVNNIDRGYRLKLVLEQFGIKSCILNS-ELPANSRQHI 320

Query: 176 IDLEGTNASKTLY--DDYEDARFKYEQLKKNDDSEERKSIKEVTSEECPEKNNNQDEGFT 233
           +D    N    L   DD E        +K+ D+ E    +++V+ EE  E+N     G  
Sbjct: 321 VDQFNKNIYSLLIATDDTE-------YIKEEDELENESKVEDVSGEEKTEQNETLSTG-N 372

Query: 234 AVNHYAQNNDNKSKEET----KEENRSQAADLSNIARLL 268
           A +    NND+K K++T    KE   S+  D  N+A +L
Sbjct: 373 ADDKVDINNDDKKKKQTFRKDKEYGVSRGVDFKNVACVL 411

>KLTH0G07304g Chr7 (585983..591001) [5019 bp, 1672 aa] {ON} similar
           to uniprot|P47054 Saccharomyces cerevisiae YJL039C
           NUP192 Essential structural subunit of the nuclear pore
           complex (NPC) localizes to the nuclear periphery of
           nuclear pores homologous to human p205
          Length = 1672

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (61%)

Query: 131 YEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDK 164
           Y D V+D TLA NI P+F +  S+LG  K   +K
Sbjct: 143 YIDLVSDGTLAKNIIPAFKQIESQLGEIKVLVNK 176

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 29.6 bits (65), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 2/77 (2%)

Query: 83  EALKKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141
           E  K  GN    +G Y +A++ Y + I+   +N   YSN +++  KL +Y +A+      
Sbjct: 4   EEYKTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTG 63

Query: 142 IN-IDPSFSKAYSRLGY 157
           +  ++ + S+ Y +L Y
Sbjct: 64  LKYVNDADSQVYKKLQY 80

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 43/103 (41%), Gaps = 11/103 (10%)

Query: 49  DILPTSLKERTLKTILQENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEA 108
           D    +LK   +      NL  LE          E  K++G  +   G Y  A + Y ++
Sbjct: 298 DFEAPALKTSNVPATYSPNLTELE------RHSFEEFKEKGANSFRTGDYHAAFQNYEKS 351

Query: 109 IQ-----FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDP 146
           +          V  +SN  +   K+G Y +A++DA+ A+ + P
Sbjct: 352 LNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDASSALKLIP 394

>YNL313C Chr14 complement(45308..48022) [2715 bp, 904 aa] {ON}
           EMW1Essential conserved protein with a role in
           maintaining cell wall integrity; contains six TPR
           (tetratricopeptide repeat) domains clustered in the
           C-terminal region; conditional mutant is suppressed by
           overexpression of GFA1
          Length = 904

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 129 GRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNASKTLY 188
           G+ + A    T  +++DP  + ++S L  A    DKL++  +  KRAI  +     K ++
Sbjct: 651 GKMQIAAEAFTRCVSLDPYHALSWSNLSAAYTKMDKLKEAYSCLKRAISCDAQKNWK-IW 709

Query: 189 DDY 191
           ++Y
Sbjct: 710 ENY 712

>Ecym_8161 Chr8 (333872..335359) [1488 bp, 495 aa] {ON} similar to
           Ashbya gossypii ADR296C
          Length = 495

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 16/26 (61%)

Query: 146 PSFSKAYSRLGYAKCCQDKLEDGMTA 171
           P F  A   +G  +CCQD L++G+ +
Sbjct: 442 PKFQVALFSIGLKECCQDMLKNGLIS 467

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 85  LKKEGNEAMIEGQYEEAIKKYTEAI-----QFSKNVAYYSNRSLAYSKLGRYEDAVNDAT 139
            +  G E   +G Y+ A+ +Y +++     +    +  YSN   A  K+G Y  +V D  
Sbjct: 549 FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCD 608

Query: 140 LAINIDPSFSKAYSRL 155
           +A+ + P   K +++ 
Sbjct: 609 VALELFPKNDKQWTQF 624

>TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON}
           Anc_8.721 YOR272W
          Length = 451

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 57/117 (48%), Gaps = 12/117 (10%)

Query: 38  TCIGESFSLDGDILPTSLKER-TLKTILQENLNTLEATQKI---------HNEEAEALKK 87
           T +   F +DG++L TSL++  T K +  E+   +E T+ +         +NE+  +   
Sbjct: 51  TAVPFDFLIDGELLRTSLQDYLTRKGLSSESSLNVEYTRAVLPPSYLASFNNEDWISSID 110

Query: 88  EGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSN--RSLAYSKLGRYEDAVNDATLAI 142
            G++ +I G Y+  ++ +  + +  K  + +S   R++ Y    R   A ND TL +
Sbjct: 111 VGDKHIINGSYDGIVRTWNLSGKVDKQYSGHSGPIRAVKYISDTRLVSAGNDRTLRL 167

>KLLA0C02453g Chr3 complement(216740..219826) [3087 bp, 1028 aa]
           {ON} similar to uniprot|P33339 Saccharomyces cerevisiae
           YGR047C
          Length = 1028

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 42/100 (42%), Gaps = 7/100 (7%)

Query: 81  EAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYEDAVNDAT 139
           E   L  E NEA +    + A + Y + I+  +KN A Y      Y   GR+ D  N   
Sbjct: 110 EVAQLLSEANEAYVRNDIQVAEQLYNKVIKADAKNFAAYKTLGDIYHLQGRFNDCCNSWF 169

Query: 140 LAINI---DPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAI 176
           LA ++   D  F K  + L  A+     +   +  Y RAI
Sbjct: 170 LAAHLNSTDWEFWKMVAELS-AELAH--VRQAIYCYTRAI 206

>TPHA0B04430 Chr2 (1036315..1039527) [3213 bp, 1070 aa] {ON}
           Anc_1.88 YGR047C
          Length = 1070

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 37/86 (43%), Gaps = 4/86 (4%)

Query: 75  QKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQF-SKNVAYYSNRSLAYSKLGRYED 133
           +KI + E   L  + NEA +      A K Y + I+  ++N A Y      Y   GR  D
Sbjct: 141 EKIIDPELAQLISDANEAFVRNDLLVAEKLYNDIIKKDARNFAAYETLGDIYQLQGRLND 200

Query: 134 AVNDATLAINI---DPSFSKAYSRLG 156
             N   LA ++   D  F K  +RL 
Sbjct: 201 CCNSWFLAAHLNSSDWQFWKVVARLS 226

>Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR080W
           (DIA2) - may be involved in regulation of invasive
           growth and budding pattern [contig 126] FULL
          Length = 690

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%)

Query: 106 TEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLG 156
           TE +   + V    NR+  + KLG    A+ DA  A+  +P   K Y R G
Sbjct: 62  TEKVVHPRFVKLLDNRAATWEKLGDLTKALKDANRAVKYEPYNLKCYLRKG 112

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 131 YEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAI--DLEGTNA 183
           +++A+     A  +DP+F  AY+  G+     D  +   T Y++AI  DL   NA
Sbjct: 606 HDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKAISNDLHHYNA 660

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 30.0 bits (66), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 8/89 (8%)

Query: 89  GNEAMIEGQYEEAIKKYTEAIQFSK-NVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPS 147
           G  AM  GQYEEA+  + +A   +  NV        +  KLG  E A+    LA ++ P+
Sbjct: 615 GTSAMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPT 674

Query: 148 FSKAYSRLGYAKCCQDKLEDGMTAYKRAI 176
            S +  ++G       +L   MT Y  A+
Sbjct: 675 SSLSKYKMG-------QLLYSMTRYNVAL 696

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.125    0.334 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,462,101
Number of extensions: 1906855
Number of successful extensions: 14058
Number of sequences better than 10.0: 697
Number of HSP's gapped: 14024
Number of HSP's successfully gapped: 787
Length of query: 350
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 240
Effective length of database: 40,868,139
Effective search space: 9808353360
Effective search space used: 9808353360
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 66 (30.0 bits)