Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0I001301.80ON44444421710.0
NCAS0J018401.80ON44544516350.0
TDEL0C062101.80ON47943012021e-162
Suva_5.31.80ON48343411981e-161
Skud_5.251.80ON48343411631e-156
YEL064C (AVT2)1.80ON48045211581e-155
ZYRO0F16720g1.80ON49244311501e-154
SAKL0C02574g1.80ON47344211351e-152
Smik_5.231.80ON48345511261e-150
KLTH0F02332g1.80ON46943611231e-150
Kwal_33.133861.80ON46942211141e-149
Ecym_10841.80ON49544410991e-146
KLLA0C02277g1.80ON4654269471e-124
AFR671W1.80ON4883929241e-120
KNAG0C007801.80ON5134639161e-118
ZYRO0B04026g7.420ON4363231924e-15
KAFR0L019107.420ON4454571845e-14
Ecym_71337.420ON4574071693e-12
KLTH0C06006g7.420ON4453081669e-12
Kwal_27.107027.420ON4674291623e-11
TBLA0F01390singletonON4283971597e-11
KNAG0B021907.420ON4613531588e-11
KLLA0E06931g7.420ON4564591525e-10
CAGL0H04587g7.420ON4452931482e-09
YER119C (AVT6)7.420ON4483401472e-09
Kpol_505.52.177ON6874621472e-09
AER380C2.177ON7164351454e-09
NCAS0B062102.295ON4811021436e-09
TBLA0F014007.420ON4532891429e-09
CAGL0E06468g5.252ON6814181421e-08
KLLA0C13277g2.177ON7214821402e-08
TPHA0K006707.420ON4643611373e-08
CAGL0M06611g2.295ON4851051364e-08
SAKL0E10362g2.177ON7334351374e-08
NDAI0E040107.420ON4713261365e-08
Skud_5.2607.420ON4483251347e-08
KLTH0D09042g2.177ON7184471358e-08
TBLA0C030305.252ON5234391349e-08
ZYRO0B09548g2.177ON7184191349e-08
Kwal_23.28395.252ON6144351331e-07
Suva_2.287.420ON4593271331e-07
Kwal_26.84012.177ON7204451331e-07
TPHA0C034602.295ON4731281321e-07
Suva_9.1122.295ON4911021322e-07
Kpol_1045.207.420ON4662181293e-07
ZYRO0A02112g2.295ON4671551284e-07
Kpol_1029.62.177ON7674281285e-07
Smik_9.972.295ON4901341276e-07
TDEL0C028207.420ON4543331266e-07
Skud_2.197.420ON4592481267e-07
Suva_5.2407.420ON4484301268e-07
YIL088C (AVT7)2.295ON4901351269e-07
KNAG0A053802.295ON4741051251e-06
Kpol_1032.885.252ON5754131251e-06
Smik_5.2647.420ON4483011232e-06
Smik_2.317.420ON4592531232e-06
Skud_9.862.295ON4901341222e-06
Kpol_1003.442.295ON4702781223e-06
SAKL0E07392g2.295ON4721701213e-06
KLLA0E08559g2.295ON4601681204e-06
Skud_11.815.252ON7124281205e-06
Smik_11.905.252ON6804321205e-06
Kwal_27.114852.295ON4713081187e-06
SAKL0F13134g7.420ON5103021179e-06
TDEL0G022502.295ON4671251161e-05
KLLA0E13795g5.252ON5733961161e-05
YBL089W (AVT5)7.420ON4593221142e-05
TPHA0B029802.177ON7494341143e-05
YKL146W (AVT3)5.252ON6924311134e-05
NCAS0F023105.252ON6684301124e-05
Ecym_82495.252ON6274461115e-05
TPHA0B025305.252ON5964171115e-05
Smik_14.2242.177ON7154211116e-05
KAFR0H036605.252ON6464141107e-05
AGL285C7.420ON4402701107e-05
CAGL0G03619g7.420ON4602951107e-05
NCAS0E024407.420ON4951761081e-04
NDAI0C037905.252ON7214151081e-04
NDAI0B035102.295ON4961021072e-04
Suva_14.2382.177ON7164331072e-04
Skud_14.2292.177ON7134351062e-04
TPHA0F017002.177ON4441991053e-04
ZYRO0A10538g5.252ON6084401053e-04
ADL205C2.295ON468921053e-04
KLTH0G10604g2.295ON4681791053e-04
Suva_11.795.252ON7194271053e-04
SAKL0G11462g5.252ON6164151053e-04
TDEL0F013202.177ON7154261044e-04
KAFR0J013202.295ON4791381035e-04
YNL101W (AVT4)2.177ON7134351035e-04
KNAG0I019702.177ON7364631000.001
NCAS0G026302.177ON705456970.003
TBLA0F03230singletonON561193950.005
KNAG0H023305.252ON643434930.009
CAGL0B04455g2.177ON605147910.012
KAFR0D020002.177ON714389910.015
KLTH0B02970g5.220ON599114880.029
CAGL0G06622g2.177ON733417870.047
Ecym_54082.177ON715120860.053
KLTH0G07502g5.252ON601393860.064
TBLA0B072102.295ON497312850.071
NDAI0F026602.177ON710112810.26
ZYRO0B10032g5.220ON609180800.33
KLLA0D09779g5.220ON628109790.45
NDAI0I020305.220ON616116780.54
KNAG0C033807.420ON545231770.61
TDEL0E037405.252ON613421770.71
Ecym_33352.295ON474296751.0
ACR030W5.220ON599112751.2
TDEL0E040905.220ON633121732.4
Kwal_33.152125.220ON602111722.4
TBLA0D031105.220ON644176722.4
NCAS0D028705.220ON60978722.7
SAKL0G12452g5.220ON602110704.2
TBLA0C056302.177ON742160704.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0I00130
         (444 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80 ...   840   0.0  
NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1....   634   0.0  
TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1...   467   e-162
Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL0...   466   e-161
Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON} Y...   452   e-156
YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}  AV...   450   e-155
ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} simi...   447   e-154
SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {...   441   e-152
Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON} Y...   438   e-150
KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {...   437   e-150
Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {...   433   e-149
Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}...   427   e-146
KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {...   369   e-124
AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic ...   360   e-120
KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {O...   357   e-118
ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {...    79   4e-15
KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {...    75   5e-14
Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar t...    70   3e-12
KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} simila...    69   9e-12
Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119...    67   3e-11
TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {O...    66   7e-11
KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.4...    65   8e-11
KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} simila...    63   5e-10
CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} simila...    62   2e-09
YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}  ...    61   2e-09
Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON} co...    61   2e-09
AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}...    60   4e-09
NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON} Anc_2...    60   6e-09
TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {O...    59   9e-09
CAGL0E06468g Chr5 (647086..649131) [2046 bp, 681 aa] {ON} simila...    59   1e-08
KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} simi...    59   2e-08
TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7....    57   3e-08
CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa] ...    57   4e-08
SAKL0E10362g Chr5 complement(860653..862854) [2202 bp, 733 aa] {...    57   4e-08
NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420     57   5e-08
Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C ...    56   7e-08
KLTH0D09042g Chr4 complement(746802..748958) [2157 bp, 718 aa] {...    57   8e-08
TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.2...    56   9e-08
ZYRO0B09548g Chr2 complement(742965..745121) [2157 bp, 718 aa] {...    56   9e-08
Kwal_23.2839 s23 (38499..40343) [1845 bp, 614 aa] {ON} YKL146W -...    56   1e-07
Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)    56   1e-07
Kwal_26.8401 s26 complement(767440..769602) [2163 bp, 720 aa] {O...    56   1e-07
TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {O...    55   1e-07
Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON...    55   2e-07
Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON} (42445....    54   3e-07
ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {...    54   4e-07
Kpol_1029.6 s1029 (11352..13655) [2304 bp, 767 aa] {ON} (11352.....    54   5e-07
Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}...    54   6e-07
TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {O...    53   6e-07
Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)    53   7e-07
Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON...    53   8e-07
YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}  ...    53   9e-07
KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.2...    53   1e-06
Kpol_1032.88 s1032 complement(188477..190204) [1728 bp, 575 aa] ...    53   1e-06
Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON...    52   2e-06
Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)    52   2e-06
Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}...    52   2e-06
Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa] ...    52   3e-06
SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} simila...    51   3e-06
KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {...    51   4e-06
Skud_11.81 Chr11 (157889..160027) [2139 bp, 712 aa] {ON} YKL146W...    51   5e-06
Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W...    51   5e-06
Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088...    50   7e-06
SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]...    50   9e-06
TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {O...    49   1e-05
KLLA0E13795g Chr5 complement(1216938..1218659) [1722 bp, 573 aa]...    49   1e-05
YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative...    49   2e-05
TPHA0B02980 Chr2 (679253..681502) [2250 bp, 749 aa] {ON} Anc_2.1...    49   3e-05
YKL146W Chr11 (171783..173861) [2079 bp, 692 aa] {ON}  AVT3Vacuo...    48   4e-05
NCAS0F02310 Chr6 complement(458165..460171) [2007 bp, 668 aa] {O...    48   4e-05
Ecym_8249 Chr8 (510061..511944) [1884 bp, 627 aa] {ON} similar t...    47   5e-05
TPHA0B02530 Chr2 (580212..582002) [1791 bp, 596 aa] {ON} Anc_5.2...    47   5e-05
Smik_14.224 Chr14 (414661..416808) [2148 bp, 715 aa] {ON} YNL101...    47   6e-05
KAFR0H03660 Chr8 (698211..700151) [1941 bp, 646 aa] {ON} Anc_5.2...    47   7e-05
AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON} S...    47   7e-05
CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {...    47   7e-05
NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420     46   1e-04
NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {O...    46   1e-04
NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295     46   2e-04
Suva_14.238 Chr14 (431876..434026) [2151 bp, 716 aa] {ON} YNL101...    46   2e-04
Skud_14.229 Chr14 (425174..427315) [2142 bp, 713 aa] {ON} YNL101...    45   2e-04
TPHA0F01700 Chr6 complement(387868..389202) [1335 bp, 444 aa] {O...    45   3e-04
ZYRO0A10538g Chr1 (852296..854122) [1827 bp, 608 aa] {ON} simila...    45   3e-04
ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON} S...    45   3e-04
KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {...    45   3e-04
Suva_11.79 Chr11 (157798..159957) [2160 bp, 719 aa] {ON} YKL146W...    45   3e-04
SAKL0G11462g Chr7 (980180..982030) [1851 bp, 616 aa] {ON} simila...    45   3e-04
TDEL0F01320 Chr6 (235988..238135) [2148 bp, 715 aa] {ON} Anc_2.1...    45   4e-04
KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2....    44   5e-04
YNL101W Chr14 (434999..437140) [2142 bp, 713 aa] {ON}  AVT4Vacuo...    44   5e-04
KNAG0I01970 Chr9 complement(379931..382141) [2211 bp, 736 aa] {O...    43   0.001
NCAS0G02630 Chr7 (473803..475920) [2118 bp, 705 aa] {ON} Anc_2.177     42   0.003
TBLA0F03230 Chr6 (785400..787085) [1686 bp, 561 aa] {ON}               41   0.005
KNAG0H02330 Chr8 (425024..426955) [1932 bp, 643 aa] {ON} Anc_5.2...    40   0.009
CAGL0B04455g Chr2 (435437..437254) [1818 bp, 605 aa] {ON} some s...    40   0.012
KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.1...    40   0.015
KLTH0B02970g Chr2 complement(232632..234431) [1800 bp, 599 aa] {...    39   0.029
CAGL0G06622g Chr7 complement(631859..634060) [2202 bp, 733 aa] {...    38   0.047
Ecym_5408 Chr5 complement(838376..840523) [2148 bp, 715 aa] {ON}...    38   0.053
KLTH0G07502g Chr7 (608628..610433) [1806 bp, 601 aa] {ON} simila...    38   0.064
TBLA0B07210 Chr2 (1705801..1707294) [1494 bp, 497 aa] {ON} Anc_2...    37   0.071
NDAI0F02660 Chr6 complement(649723..651855) [2133 bp, 710 aa] {O...    36   0.26 
ZYRO0B10032g Chr2 complement(783526..785355) [1830 bp, 609 aa] {...    35   0.33 
KLLA0D09779g Chr4 complement(824518..826404) [1887 bp, 628 aa] {...    35   0.45 
NDAI0I02030 Chr9 (472696..474546) [1851 bp, 616 aa] {ON} Anc_5.2...    35   0.54 
KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.4...    34   0.61 
TDEL0E03740 Chr5 (707081..708922) [1842 bp, 613 aa] {ON} Anc_5.2...    34   0.71 
Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}...    33   1.0  
ACR030W Chr3 (413856..415655) [1800 bp, 599 aa] {ON} Syntenic ho...    33   1.2  
TDEL0E04090 Chr5 complement(761896..763797) [1902 bp, 633 aa] {O...    33   2.4  
Kwal_33.15212 s33 (1013106..1014914) [1809 bp, 602 aa] {ON} YJR0...    32   2.4  
TBLA0D03110 Chr4 (753778..755712) [1935 bp, 644 aa] {ON} Anc_5.2...    32   2.4  
NCAS0D02870 Chr4 complement(545123..546952) [1830 bp, 609 aa] {O...    32   2.7  
SAKL0G12452g Chr7 complement(1058250..1060058) [1809 bp, 602 aa]...    32   4.2  
TBLA0C05630 Chr3 (1364052..1366280) [2229 bp, 742 aa] {ON} Anc_2...    32   4.8  

>NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80
           YEL064C
          Length = 444

 Score =  840 bits (2171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/444 (94%), Positives = 421/444 (94%)

Query: 1   MNYTIVPTDEEFQLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNA 60
           MNYTIVPTDEEFQLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNA
Sbjct: 1   MNYTIVPTDEEFQLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNA 60

Query: 61  GLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFAL 120
           GLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFAL
Sbjct: 61  GLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFAL 120

Query: 121 XXXXXXXXXXXDTIPHVLRIFIHSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLA 180
                      DTIPHVLRIFIHSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLA
Sbjct: 121 GGCIGFCIIIGDTIPHVLRIFIHSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLA 180

Query: 181 LXXXXXXXXXXXXFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFH 240
           L            FGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFH
Sbjct: 181 LISMTVIVMTVVVFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFH 240

Query: 241 SIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARV 300
           SIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARV
Sbjct: 241 SIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARV 300

Query: 301 CFGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTM 360
           CFGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTM
Sbjct: 301 CFGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTM 360

Query: 361 SVSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFT 420
           SVSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFT
Sbjct: 361 SVSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFT 420

Query: 421 VMIVSSFQTIVEALADNEQKHCEI 444
           VMIVSSFQTIVEALADNEQKHCEI
Sbjct: 421 VMIVSSFQTIVEALADNEQKHCEI 444

>NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1.80
           YEL064C
          Length = 445

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/445 (70%), Positives = 363/445 (81%), Gaps = 1/445 (0%)

Query: 1   MNYTIVPTDEEFQLQD-SEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKN 59
           M+Y+++P DEE QL D SE L KE+I+EN KKSN+YMAF+NMANSILGAGIITQPLAVKN
Sbjct: 1   MSYSMIPLDEESQLPDTSEELAKELIEENEKKSNVYMAFMNMANSILGAGIITQPLAVKN 60

Query: 60  AGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFA 119
           AG+  SI+ YI+LGFIVDWTLRLL+ NITLSSK TY DTVE+ MG+KGK+LIL CNGLFA
Sbjct: 61  AGILGSIICYILLGFIVDWTLRLLVINITLSSKQTYQDTVEHVMGKKGKFLILGCNGLFA 120

Query: 120 LXXXXXXXXXXXDTIPHVLRIFIHSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFL 179
           L           DTIPHVLRIF +S  +TRN VIF +TLFISYPLSLLR+I+ALS  SFL
Sbjct: 121 LGGCIGFSIIIGDTIPHVLRIFFNSEKITRNMVIFLTTLFISYPLSLLRNIAALSKASFL 180

Query: 180 ALXXXXXXXXXXXXFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIF 239
           AL             GP+LP+ELKG  +  SS   SPSLF+SLSI+SFALVCHHNTSFIF
Sbjct: 181 ALVSMVVIVFTVVIRGPALPSELKGEPLSHSSLFFSPSLFKSLSIISFALVCHHNTSFIF 240

Query: 240 HSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIAR 299
           HSIRNKSLTKFTKLTH+SVFISV FCM+MGY+GFFIFT KTKGNILNNFP     INIAR
Sbjct: 241 HSIRNKSLTKFTKLTHISVFISVAFCMLMGYSGFFIFTDKTKGNILNNFPAKDNIINIAR 300

Query: 300 VCFGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLT 359
           +CFGFNMLTT PLE+FVLRDV+AVILLE   +PS E  P +P L+RKWHF +TT +VFL+
Sbjct: 301 ICFGFNMLTTFPLEIFVLRDVVAVILLECHLVPSEENNPLLPYLSRKWHFCITTGLVFLS 360

Query: 360 MSVSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGF 419
           M +SL+TCNLGALFEL+G+TTASVMAYILPPYVNLLLRQ++  L   +K+PHYFCI FGF
Sbjct: 361 MGISLMTCNLGALFELIGSTTASVMAYILPPYVNLLLRQQRNELSFTTKLPHYFCIFFGF 420

Query: 420 TVMIVSSFQTIVEALADNEQKHCEI 444
           TVMI+SS +TI++A+   EQKHCEI
Sbjct: 421 TVMIISSTETILDAVFGTEQKHCEI 445

>TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1.80
           YEL064C
          Length = 479

 Score =  467 bits (1202), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 238/430 (55%), Positives = 301/430 (70%), Gaps = 8/430 (1%)

Query: 17  SEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIV 76
            E++V  ++ +N+KKS +  AF+NMANSILGAG++ QP A++N G+   I+ YI+L  +V
Sbjct: 56  DESMVINLLRDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCGIIGGILAYIILVLLV 115

Query: 77  DWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPH 136
           DWTLRL++ N+TL+ K TY DTVE+ +GRKG+ L+L  NGLFA            DTIPH
Sbjct: 116 DWTLRLIVINLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAFGGCIGFCIIIGDTIPH 175

Query: 137 VLRIFIHSH--FVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXF 194
            L+   HS   F  RN VI   TLFISYPLSL R+I+ALS  SFLAL             
Sbjct: 176 FLQSIFHSSNFFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALISMVVIVFSVVVQ 235

Query: 195 GPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLT 254
           GP +   LKG     +    S ++FR +S++SFALVCHHNTSFIF SI+N+SL KF +LT
Sbjct: 236 GPRVDMSLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLT 295

Query: 255 HLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLEL 314
           H+S FIS+IFCM+MGY+G+ +F  KTKGNILNNFP + + INIAR+CFGFNMLTT PLE+
Sbjct: 296 HISTFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEI 355

Query: 315 FVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMSVSLLTCNLGALFE 374
           FVLRDVIA  L   +     +E    P+ TRK  FI+TT+ V  TMS+SL TCNLGALFE
Sbjct: 356 FVLRDVIAAFLYGKK---EEDETEAPPLSTRKL-FIITTVCVVSTMSISLTTCNLGALFE 411

Query: 375 LVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQTIVEAL 434
           L+GATTAS MAYILPPY NL+L   KE    + K+PHY CI FGF VMIVSS QTI+E +
Sbjct: 412 LIGATTASTMAYILPPYTNLVL--SKEANTFRQKVPHYLCIFFGFMVMIVSSTQTIIEVV 469

Query: 435 ADNEQKHCEI 444
             ++Q+HCE+
Sbjct: 470 KGSDQRHCEL 479

>Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL064C
           (REAL)
          Length = 483

 Score =  466 bits (1198), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 240/434 (55%), Positives = 309/434 (71%), Gaps = 11/434 (2%)

Query: 17  SEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIV 76
            + LV  ++ EN+KKS++ MAF+N+ANSILGAGIITQP A+KNAG+   ++ YI LGFIV
Sbjct: 55  DDQLVNNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIV 114

Query: 77  DWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPH 136
           DWTLRL++ N+TL+ K TY  TVEY MG+KGK LIL  NGLFA            DTIPH
Sbjct: 115 DWTLRLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPH 174

Query: 137 VLR-IFIHS----HF-VTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXX 190
           VLR +F  +    HF + RN +I   T+FIS+PLSL R+I  LS  SFLA+         
Sbjct: 175 VLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLT 234

Query: 191 XXXFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKF 250
               GP LP + +G  +  S      ++FRSLS++SFALVCHHNTSFIF S+RN+S+ KF
Sbjct: 235 VVIRGPMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKF 294

Query: 251 TKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTL 310
           TKLTH+S+ ISVI C +MGY+GF  F  KTKGN+LN+FP    AIN+AR+CFGFNMLTT 
Sbjct: 295 TKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTF 354

Query: 311 PLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMSVSLLTCNLG 370
           P+E+FVLRDV+  +L E   I + +E      L+ K H I+T+++VF+TM +SL TCNLG
Sbjct: 355 PMEIFVLRDVVGNLLHECHLIKNYDEHTQ---LSNKQHTIITSMLVFITMGISLTTCNLG 411

Query: 371 ALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQTI 430
           ALFEL+GATTAS MAYILPPY NLLL  +K+    K+K+P+YFCI FGF +MIVSS QTI
Sbjct: 412 ALFELIGATTASTMAYILPPYTNLLLTSKKKNW--KAKLPYYFCICFGFMIMIVSSTQTI 469

Query: 431 VEALADNEQKHCEI 444
           ++A+   + +HC+I
Sbjct: 470 LDAVNGPDGQHCQI 483

>Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  452 bits (1163), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 239/434 (55%), Positives = 311/434 (71%), Gaps = 11/434 (2%)

Query: 17  SEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIV 76
            + LV  ++ EN+KKS++ MAF+N+ANSILGAGIITQP+A+KNAG+   ++ YI LGFIV
Sbjct: 55  DDPLVNSVLRENDKKSSMRMAFMNLANSILGAGIITQPVAIKNAGILGGLIAYIALGFIV 114

Query: 77  DWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPH 136
           DWTLRL++ N+TL+ K TY  TVE+ MG+KGK LIL  NGLFA            DTIPH
Sbjct: 115 DWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPH 174

Query: 137 VLR-IFIHS----HF-VTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXX 190
           VLR +F  +    HF + RN +I   T+FIS+PLSL R+I  LS  SFLA+         
Sbjct: 175 VLRAVFSQNDGEVHFWLRRNVIIVLVTIFISFPLSLKRNIEGLSKASFLAVISMIIIVLT 234

Query: 191 XXXFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKF 250
               GP LP + KG  +    ++   ++FRSLS++SFALVCHHNTSFIF S+RN+S+ KF
Sbjct: 235 VVIRGPMLPYDWKGHSLKWPDFLVKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKF 294

Query: 251 TKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTL 310
           T+LTH+S+ ISVI C +MG++GF  F  KTKGN+LNNFP    AIN+AR+CFGFNMLTT 
Sbjct: 295 TRLTHISIIISVICCGLMGFSGFAAFKEKTKGNVLNNFPGTDTAINVARLCFGFNMLTTF 354

Query: 311 PLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMSVSLLTCNLG 370
           P+E+FVLRDV+   L E   I S +E      L+ K H I+T+++VF+TMS+SL TCNLG
Sbjct: 355 PMEIFVLRDVVGNSLHECHLIKSYDEHTQ---LSDKQHTIITSLLVFITMSISLTTCNLG 411

Query: 371 ALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQTI 430
           ALFEL+G+TTAS MAYILPPY NLLL  +K+    K+K+P+Y CI FGF +MIVSS QTI
Sbjct: 412 ALFELIGSTTASTMAYILPPYTNLLLTSKKKNW--KAKLPYYLCICFGFMIMIVSSTQTI 469

Query: 431 VEALADNEQKHCEI 444
           ++A+   +++HCEI
Sbjct: 470 LDAINGADEQHCEI 483

>YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}
           AVT2Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 480

 Score =  450 bits (1158), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 240/452 (53%), Positives = 316/452 (69%), Gaps = 20/452 (4%)

Query: 8   TDEEFQLQDS---------EALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVK 58
           +D+  Q Q+S         + LV +++ EN+KKS++ MAF+N+ANSILGAGIITQP A+K
Sbjct: 34  SDDGSQGQNSLNIITPDMDDTLVNDVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIK 93

Query: 59  NAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLF 118
           NAG+   ++ Y+ LGFIVDWTLRL++ N+TL+ K TY  TVE+ MG+KGK LIL  NGLF
Sbjct: 94  NAGILGGLLSYVALGFIVDWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLF 153

Query: 119 ALXXXXXXXXXXXDTIPHVLR-IFIHS----HF-VTRNSVIFFSTLFISYPLSLLRDISA 172
           A            DTIPHVLR IF  +    HF + RN +I   T FIS+PLS+ R+I A
Sbjct: 154 AFGGCIGYCIIIGDTIPHVLRAIFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEA 213

Query: 173 LSSTSFLALXXXXXXXXXXXXFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCH 232
           LS  SFLA+             GP LP + KG  +  S +    ++FRSLS++SFALVCH
Sbjct: 214 LSKASFLAVISMIIIVLTVVIRGPMLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCH 273

Query: 233 HNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNG 292
           HNTSFIF S+RN+S+ KFT+LTH+S+ ISVI C +MGY+GF +F  KTKGN+LN+FP   
Sbjct: 274 HNTSFIFFSMRNRSVAKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTD 333

Query: 293 VAINIARVCFGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVT 352
            AINIAR+CFGFNMLTT P+E+FVLRDV+  +L E   I + +E      L+ K H ++T
Sbjct: 334 TAINIARLCFGFNMLTTFPMEIFVLRDVVGNLLHECNLIKNYDEHTQ---LSGKQHVVIT 390

Query: 353 TIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHY 412
           + +VF+TM +SL TCNLGALFEL+GATTAS MAYILPPY NLLL  +K+    K ++P Y
Sbjct: 391 SSLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKKKSW--KERLPFY 448

Query: 413 FCILFGFTVMIVSSFQTIVEALADNEQKHCEI 444
            CI FGF +MI+SS QTI++A+  ++ +HC+I
Sbjct: 449 LCICFGFMIMIISSTQTIIDAVNGSDGQHCQI 480

>ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} similar
           to uniprot|P39981 Saccharomyces cerevisiae YEL064C AVT2
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 492

 Score =  447 bits (1150), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 225/443 (50%), Positives = 309/443 (69%), Gaps = 17/443 (3%)

Query: 8   TDEEFQLQDS----EALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLC 63
           T+ E+ + D+    +  V ++I ENNKKS +  AF+NMANSILGAG+I QP+A+KN+G+ 
Sbjct: 61  TNLEYGIDDNYDNDDEFVNDVIRENNKKSTMKWAFMNMANSILGAGVIGQPIAIKNSGIV 120

Query: 64  ASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXX 123
            +I+ Y++L  +VDWTLRL++ N+TL+ K TY DTV + MG++G+  +L  NGLFA    
Sbjct: 121 GAIIAYLVLFVLVDWTLRLIVINLTLAGKKTYQDTVAFAMGKRGRIAVLTANGLFAFGGC 180

Query: 124 XXXXXXXXDTIPHVLRIFIHSH--FVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLAL 181
                   DT+PHV R FIH +  F++R  +I   T+ ISYPL+L R+I+ALS  SFLAL
Sbjct: 181 IGFCIIIGDTLPHVFRAFIHQNSVFLSRRLIITIVTICISYPLALQRNIAALSKASFLAL 240

Query: 182 XXXXXXXXXXXXFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHS 241
                        GP + A  K   +     + +P +FR +S++SFALVCHHNTSFI+ S
Sbjct: 241 ISMVIIVFTVIIRGPEIHA--KRDPLTWEDILVTPRIFRGISVISFALVCHHNTSFIYFS 298

Query: 242 IRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVC 301
           I+N+SL KF +LTH+S  ISV+FCMIMG++GF  F   TKGN+LNNF  +  A+NIAR+C
Sbjct: 299 IKNRSLRKFNRLTHISTSISVVFCMIMGFSGFAAFGQNTKGNVLNNFSADDKAVNIARLC 358

Query: 302 FGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMS 361
           FGFNMLTT PLE+FVLRDVIA       +I   +      +L++  HFI+TTI+VF TMS
Sbjct: 359 FGFNMLTTFPLEIFVLRDVIA------SFIGGHQPNGDPNVLSKSNHFIITTILVFGTMS 412

Query: 362 VSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTV 421
           +SLLTCNLGA+FEL+GATTAS+MAYILPP+VNLLL  +K     + K+PH+ CI FGF++
Sbjct: 413 ISLLTCNLGAIFELIGATTASMMAYILPPWVNLLLTSDKT---FRQKLPHFACIAFGFSI 469

Query: 422 MIVSSFQTIVEALADNEQKHCEI 444
           M++SS QTI++ +   ++K CE+
Sbjct: 470 MLISSIQTILDTMNGTDEKQCEL 492

>SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 473

 Score =  441 bits (1135), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 237/442 (53%), Positives = 298/442 (67%), Gaps = 15/442 (3%)

Query: 9   DEEFQLQDSEA-----LVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLC 63
           D+E +  D+ A     LV  I+ EN  KSNIYMAF+NMANSILGAGII QP A+ N GL 
Sbjct: 39  DDETKFVDTGADVEDPLVSGIVTENQTKSNIYMAFMNMANSILGAGIIGQPFAINNCGLA 98

Query: 64  ASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXX 123
             +   ++L  +VDWT+RL++ N+ L+ K TY D+VE+ MGR+GK LIL  NGLFA    
Sbjct: 99  GGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDSVEFAMGRRGKLLILAANGLFAFGGC 158

Query: 124 XXXXXXXXDTIPHVLRIFI--HSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLAL 181
                   DTIPHVLR F   H+    RN++IFF TLF+SYPLSL RDIS LS  S LAL
Sbjct: 159 IGFCIIIGDTIPHVLRAFFPAHTALFHRNAIIFFVTLFVSYPLSLNRDISKLSKASMLAL 218

Query: 182 XXXXXXXXXXXXFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHS 241
                        GP L A  KGS + +S    +P +F+ +S++SFALVCHHNTSFI+ S
Sbjct: 219 ASMLLIVVIVIVKGPMLDAAYKGS-LTASKLFITPRIFQGISVISFALVCHHNTSFIYFS 277

Query: 242 IRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVC 301
           ++N SL +F KLTHLS  +S++ C +MGY+GF +F  KTKGNILNNFP +   IN+AR C
Sbjct: 278 LKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFC 337

Query: 302 FGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMS 361
           FGFNMLTT PLE+FVLRDV+  +   +       E      L+ K H  VT+ +VFLTM+
Sbjct: 338 FGFNMLTTFPLEIFVLRDVVRDLAHFHSG-----EATAPAELSTKKHVAVTSALVFLTMT 392

Query: 362 VSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTV 421
           VSL TCNLGALFEL+GATTAS+MAYILPP  NLLL    + L  + K+P+Y CI+FGF V
Sbjct: 393 VSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTL--RQKLPYYGCIVFGFAV 450

Query: 422 MIVSSFQTIVEALADNEQKHCE 443
           M++SS QTI+ A+   EQKHCE
Sbjct: 451 MVISSTQTILAAINGGEQKHCE 472

>Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  438 bits (1126), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 242/455 (53%), Positives = 316/455 (69%), Gaps = 23/455 (5%)

Query: 8   TDEEFQLQDS------------EALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPL 55
           +D+  Q +DS            + LV +++ EN+KKS++ MAF+N+ANSILGAGIITQP 
Sbjct: 34  SDDRSQGKDSLKAIYPIASDTDDTLVNKVLLENDKKSSMRMAFMNLANSILGAGIITQPF 93

Query: 56  AVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCN 115
           A+KNAG+   ++ YI LGFIVDWTLRL++ N+TL+ K TY  TVE+ MG+KGK LIL  N
Sbjct: 94  AIKNAGILGGLISYIALGFIVDWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTN 153

Query: 116 GLFALXXXXXXXXXXXDTIPHVLR-IFIHS----HF-VTRNSVIFFSTLFISYPLSLLRD 169
           GLFA            DTIPHVLR IF       HF + RN +I   T+FIS+PLSL R+
Sbjct: 154 GLFAFGGCIGYCIIIGDTIPHVLRAIFSQKDGDIHFWLRRNVIIIIVTIFISFPLSLKRN 213

Query: 170 ISALSSTSFLALXXXXXXXXXXXXFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFAL 229
           I ALS  SFLA+             GP LP + KG  +    +    ++FRSLS++SFAL
Sbjct: 214 IEALSKASFLAVISMIIIVVTVVIRGPMLPYDWKGHSLQLRDFFVKTTIFRSLSVISFAL 273

Query: 230 VCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFP 289
           VCHHNTSFIF S+RN+S+ KFT+LTH+S+ ISVI C +MGY+GF  F  KTKGNILN+FP
Sbjct: 274 VCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCGLMGYSGFAAFKEKTKGNILNSFP 333

Query: 290 PNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHF 349
               AINIAR+CFGFNMLTT P+E+FVLRDV+  +L E + I + +E      L+ K H 
Sbjct: 334 GTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNLLHECKIIKNYDEHTQ---LSGKQHI 390

Query: 350 IVTTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKI 409
           ++T+++VF+TM +SL TCNLGALFEL+GATTAS MAYILPPY NLLL  +K+     +K+
Sbjct: 391 VITSLLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKKKSWS--AKL 448

Query: 410 PHYFCILFGFTVMIVSSFQTIVEALADNEQKHCEI 444
           P Y CI FGF +MI+SS QTI++A+  ++ +HC+I
Sbjct: 449 PFYLCICFGFMIMIISSTQTILDAVNGSDGQHCQI 483

>KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 469

 Score =  437 bits (1123), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 228/436 (52%), Positives = 286/436 (65%), Gaps = 10/436 (2%)

Query: 10  EEFQLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIY 69
           E   +   +      + E   KSNI MAF+NMANSILGAGII QP AVKN GL   ++  
Sbjct: 41  ERLSVDSEDRFTSTFLHEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCGLLGGVLAI 100

Query: 70  IMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXX 129
           ++L  +VDWT+RL++ N+ +S K TY D+VE  MGRKGK LIL  NGLFA          
Sbjct: 101 VLLSLLVDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAFGGCIGFCII 160

Query: 130 XXDTIPHVLRIFI--HSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXX 187
             DTIPHVLR F   H +   RN VI   T  IS+PLSL RDIS LS  S LAL      
Sbjct: 161 IGDTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMVVI 220

Query: 188 XXXXXXFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSL 247
                  GP   +  KGS   SS+ + +P +F+ LS++SFALVCHHNTSFI+ S++  SL
Sbjct: 221 VVIVVIKGPGTDSAYKGS-FNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSL 279

Query: 248 TKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNML 307
            +F +LTH S FI++IFC +MG+ GF +F  KTKGNILNNFP N  A+N+AR CFGFNML
Sbjct: 280 KRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNML 339

Query: 308 TTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMSVSLLTC 367
           TT PLE+FVLRDVI  ++  N      E K    +L+ K H I++T +VF TM++SL TC
Sbjct: 340 TTFPLEIFVLRDVIKDLMFFNS-----EPKSQPRVLSLKLHVIISTALVFGTMAISLTTC 394

Query: 368 NLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTVMIVSSF 427
           NLGALFEL+GATTAS+MAYILPP+VNL L      L  + +IPHY CI FGF +M++SS 
Sbjct: 395 NLGALFELIGATTASLMAYILPPWVNLKLVGGN--LKWRDRIPHYVCIGFGFAIMLISST 452

Query: 428 QTIVEALADNEQKHCE 443
           QTI+  +   +QKHCE
Sbjct: 453 QTIISYINGGDQKHCE 468

>Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {ON}
           YEL064C - Hypothetical ORF [contig 118] FULL
          Length = 469

 Score =  433 bits (1114), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 221/422 (52%), Positives = 285/422 (67%), Gaps = 10/422 (2%)

Query: 25  IDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLI 84
           + EN  KSNI+MAF+NMANSILGAG+I QP A+KN GL   I   I+L  +VDWT+RL++
Sbjct: 56  LRENRSKSNIFMAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIV 115

Query: 85  TNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRIFI-- 142
            N+ ++ K TY D+VE+ MGRKGK LIL  NGLFA            DTIPHVLR F   
Sbjct: 116 VNMKITGKTTYQDSVEFAMGRKGKLLILLSNGLFAFGGCVGFCIIIGDTIPHVLRAFFPG 175

Query: 143 HSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPSLPAEL 202
           H +   RN +I   T FIS+PLSL R+IS LS  S LAL             GP +    
Sbjct: 176 HENLFHRNIIIILVTCFISFPLSLNRNISKLSKASMLALVSMVFIVVIVLVKGPMIDDAY 235

Query: 203 KGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISV 262
           KGS   ++    +P +F+ +S++SFALVCHHNTSFI+ S++  SL +F +LTH S F+++
Sbjct: 236 KGS-FNTTELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAM 294

Query: 263 IFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIA 322
           IFC +MGY GF +F  +TKGNILNNFP +   +N+AR CFGFNMLTT PLE+FVLRDVI 
Sbjct: 295 IFCFLMGYTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIR 354

Query: 323 VILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMSVSLLTCNLGALFELVGATTAS 382
             +  N    +  ++     L+ K H I+TTI+V  TM +SL TCNLGALFEL GATTAS
Sbjct: 355 DFMFFNSKDTNQSQE-----LSLKLHVILTTILVMTTMLISLTTCNLGALFELTGATTAS 409

Query: 383 VMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQTIVEALADNEQKHC 442
           +MAYILPP VNLLL  ++    ++ K+PHY CI+FGFT+M+VSS QTI+  +   +QKHC
Sbjct: 410 LMAYILPPSVNLLLIGKRS--TVREKLPHYACIIFGFTIMVVSSSQTIIAYIRGGDQKHC 467

Query: 443 EI 444
           E+
Sbjct: 468 EV 469

>Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}
           similar to Ashbya gossypii AFR671W
          Length = 495

 Score =  427 bits (1099), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 230/444 (51%), Positives = 292/444 (65%), Gaps = 11/444 (2%)

Query: 2   NYTIVPTDEEFQLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAG 61
           N   V  + E  LQ  +  V ++ + N  KSN+YMAF+NMANSILGAG+I QP A+KN G
Sbjct: 60  NNKNVQNNVELNLQFEDPNVSQLTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKNCG 119

Query: 62  LCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALX 121
           L   + + ++L  IVDWT+RL++ N+ L+ K TY D+VE+ MG KGK LIL  NGLFA  
Sbjct: 120 LIGGVCLIVLLTIIVDWTIRLIVINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAFG 179

Query: 122 XXXXXXXXXXDTIPHVLRIFI--HSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFL 179
                     D+IPHVL+ F   HS    RN VI   TLFISYPLSL R+IS LS  S L
Sbjct: 180 GCVGFCIIIGDSIPHVLKAFFPSHSELFRRNVVISVVTLFISYPLSLNRNISKLSKASML 239

Query: 180 ALXXXXXXXXXXXXFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIF 239
           AL              P +  E KG      +++ +P +F+ +SI+SFALVCHHNTSFIF
Sbjct: 240 ALVSLLLIVALVIIRAPKVEDEYKGQFTWEEAFI-TPRVFQGISIISFALVCHHNTSFIF 298

Query: 240 HSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIAR 299
            S++N SL +F  LTH+S  IS++ C+I GY GF  F  KTKGNILNNFP N   IN AR
Sbjct: 299 FSLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFAR 358

Query: 300 VCFGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLT 359
            CFGFNMLTT PLE+FVLRDV+  +L    +  S + +    ILT K HFIVT+++VF++
Sbjct: 359 FCFGFNMLTTFPLEIFVLRDVVRDLL----YFQSADSES--IILTTKEHFIVTSVLVFIS 412

Query: 360 MSVSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGF 419
           MS+SL TCNLGAL ELVG+TTAS+ AYILPP   L L  + + L  K + P+Y CI+FGF
Sbjct: 413 MSISLTTCNLGALLELVGSTTASLTAYILPPATTLALTGKTKTL--KERTPYYACIMFGF 470

Query: 420 TVMIVSSFQTIVEALADNEQKHCE 443
           ++MIVSS QTI+ A+   E KHCE
Sbjct: 471 SIMIVSSTQTILSAIYGTEIKHCE 494

>KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 465

 Score =  369 bits (947), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 203/426 (47%), Positives = 271/426 (63%), Gaps = 11/426 (2%)

Query: 12  FQLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIM 71
           F + + + L  +I   N  KSN YMAF+NMANSILG+G+I QP A+KN G+   +   I+
Sbjct: 49  FNVNEEDPLTDDIYLSNEAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATIL 108

Query: 72  LGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXX 131
           +  +VDWT+RL++ N+ L+ K TY  +VE  MG+ G  LIL  NGLFA            
Sbjct: 109 MSILVDWTIRLIVINLKLTGKSTYQASVETAMGQWGGLLILVSNGLFAFGGCVGFCIIIG 168

Query: 132 DTIPHVLRIFIHSH--FVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXX 189
           D+IPHVL  F  SH     RN +I   TLFIS+PLSL RDIS LS TS LAL        
Sbjct: 169 DSIPHVLSAFFPSHTDLFHRNVIITLVTLFISFPLSLNRDISKLSKTSMLALLGLIAIVI 228

Query: 190 XXXXFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTK 249
                 P +  E KG+      ++ +P +F+ +S++SFALVCHHNTSFIF S+RN SL +
Sbjct: 229 IIVVKAPLVSGEYKGTFHLHQLFI-TPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKR 287

Query: 250 FTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTT 309
           F +LTH+S+ +S I C+   Y+GF  F  KT GNILNNFP +   IN AR+  GFNMLTT
Sbjct: 288 FNQLTHVSLILSCIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTT 347

Query: 310 LPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMSVSLLTCNL 369
            PLE+FVLRDVI  I+  N      ++ P    LT K H ++T+ +V + M ++L T NL
Sbjct: 348 FPLEIFVLRDVIRDIIYYN------KDDPEPVKLTTKMHALITSGLVLIIMCIALSTSNL 401

Query: 370 GALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQT 429
           GAL E++GAT+AS+MAYILPP  NL++  +K+ L  K K+P+  CI+FG  +M VS+ QT
Sbjct: 402 GALLEIIGATSASLMAYILPPLTNLVITGKKKSL--KEKLPYCGCIVFGVILMFVSTAQT 459

Query: 430 IVEALA 435
           I+EA A
Sbjct: 460 ILEAFA 465

>AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL064C (AVT2)
          Length = 488

 Score =  360 bits (924), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 195/392 (49%), Positives = 255/392 (65%), Gaps = 13/392 (3%)

Query: 55  LAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCC 114
           L +KN GL   +V+ ++L  IVDWT+RL+I N+ L+ K TY DTVE+ MGR GKY +L  
Sbjct: 106 LRLKNCGLLGGLVLTMLLTVIVDWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAVLFA 165

Query: 115 NGLFALXXXXXXXXXXXDTIPHVLRIFIHSH--FVTRNSVIFFSTLFISYPLSLLRDISA 172
           NG+FA            D+IPHVLR F  ++  +  RN +I   T+F+SYPLSL R+IS 
Sbjct: 166 NGMFAFGGCVGFCIIIGDSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPLSLNRNISK 225

Query: 173 LSSTSFLALXXXXXXXXXXXXFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCH 232
           LS  S LAL             GP++  + +GS      +V  P LF+ +S++SFALVC 
Sbjct: 226 LSKASMLALVSLLLIVVIIVVRGPTVGNDYRGSFDLEELFV-KPRLFQGISVISFALVCL 284

Query: 233 HNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNG 292
           HNTSFI+ S+R  SL +F  LTH+S  IS++ C+I GY+GF  F  KTKGNILNNFP + 
Sbjct: 285 HNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSD 344

Query: 293 VAINIARVCFGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPI-LTRKWHFIV 351
             IN AR CFGFNMLTT PLE+FVLRDVI  ++       S E   G P+ L+ K HFI+
Sbjct: 345 NYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI-------STETPKGEPLRLSTKRHFII 397

Query: 352 TTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPH 411
           TT +V  TM +SL TCNLGAL ELVG+TTAS+ AYILPP  NL+L  E+     K K+PH
Sbjct: 398 TTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERR--AAKEKLPH 455

Query: 412 YFCILFGFTVMIVSSFQTIVEALADNEQKHCE 443
           Y CILFGF++M++SS Q I+ A+  ++   C+
Sbjct: 456 YACILFGFSIMVISSTQAIITAIHSDKSSQCD 487

>KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {ON}
           Anc_1.80 YEL064C
          Length = 513

 Score =  357 bits (916), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 207/463 (44%), Positives = 282/463 (60%), Gaps = 39/463 (8%)

Query: 7   PTDEEFQLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASI 66
           P+ E  +L++   L+  II+ N +KS ++MAF+NMANSILGAGII+QP AV+ AG+  + 
Sbjct: 15  PSYELHELENP--LIAGIIETNEEKSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAF 72

Query: 67  VIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXX 126
           V+YI LGF+VDWTLRL++ N+ ++   TY ++V   +G  G+  IL  NGLFA       
Sbjct: 73  VVYIALGFLVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVAF 132

Query: 127 XXXXXDTIPHVLRIFIHSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXX 186
                DTIPHVLR      ++ RN VI   TL IS PLSL + I  L   SFLAL     
Sbjct: 133 CIIIGDTIPHVLRTVCPPQYIERNWVIIVVTLLISLPLSLSKKIKQLERASFLALVSMAV 192

Query: 187 XXXXXXXFGPSLPAELKGS-GIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNK 245
                   GP LP+ELK    + +  +    ++F+S+SIVSFALVCHHNTSFIFHS+RNK
Sbjct: 193 IVVTVAVRGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNK 252

Query: 246 SLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFN 305
           S+ KF +LTH S  +SV  CM+MGY GF  F  KTKGN+LNNF  +   IN+AR+ FGFN
Sbjct: 253 SIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFN 312

Query: 306 MLTTLPLELFVLRDVIAVILL--ENEWI------------------PSIE---------- 335
           MLTT PLE+FVLR+V+  I     + W                   P  E          
Sbjct: 313 MLTTFPLEIFVLRNVVLDIWAGPTHRWYQHRRHHPPRGGHTATQQPPPPEPHGSSPARGP 372

Query: 336 --EKPGMPI---LTRKWHFIVTTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILPP 390
               PG+P     + + H  VT ++V  TM V+L+TCNLGAL E++G+TT ++ AYILPP
Sbjct: 373 AGPHPGLPPDPEPSEQPHTAVTVVLVLATMGVALVTCNLGALLEVIGSTTGALTAYILPP 432

Query: 391 YVNLLL-RQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQTIVE 432
             ++LL R+  +P   + ++ H  C++FG TVM+VS+ QT+++
Sbjct: 433 LTHVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVSTTQTLLD 475

>ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 436

 Score = 78.6 bits (192), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 77/323 (23%), Positives = 133/323 (41%), Gaps = 30/323 (9%)

Query: 132 DTIPHVLRIFIHSH-FVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXX--X 188
           D IP +   F  +   + RN  I    LF+  PL  ++ +++L   S +AL         
Sbjct: 104 DLIPQIFTTFTSNKILLERNFHITMVMLFLVSPLCFMKRLTSLRKASLVALSSVAYLCCL 163

Query: 189 XXXXXFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLT 248
                  PS   + +   +        P+   +L I  FA  CHHN   +++  ++ S  
Sbjct: 164 VVVHFIWPSNEIDQRKGKVSIGFPRNEPTPLTTLPIFVFAYTCHHNAFSVYNEQKDTSTR 223

Query: 249 KFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLT 308
           +  K+    + I+ +   I+G AG+  F     GNI+  +PP+ ++  I RV     ++ 
Sbjct: 224 QLNKIGRYGMSIAFVLYTIIGGAGYLTFGDHIAGNIITLYPPS-LSTTIGRVAIVLLVML 282

Query: 309 TLPLELFVLRDVIAVILL--------------------ENEWIPSIEEKPGMPILTRKWH 348
             PL+    R  I  IL                     E E + S    P +P L  K  
Sbjct: 283 AFPLQCHPARSSINNILYSFQSVEKNLQGQTENSNLISEEESVESQAHGPPVPPLQGKRF 342

Query: 349 FIVTTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILPPYVNLLL---RQEKEPLPI 405
            ++T +I+  +  +++   +L  L  +VG+T ++ +++ILP      L       E LP 
Sbjct: 343 TVITLVILIASYLLAISVTSLARLLAIVGSTGSTSISFILPGIFGYWLIGSEYTPEELPR 402

Query: 406 KSKIPHYFCIL---FGFTVMIVS 425
             K   +  +L   +GF VMI S
Sbjct: 403 NLKFAKFAGLLLAIWGFIVMIAS 425

>KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {ON}
           Anc_7.420 YER119C
          Length = 445

 Score = 75.5 bits (184), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 102/457 (22%), Positives = 181/457 (39%), Gaps = 76/457 (16%)

Query: 32  SNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGF-----------IVDWTL 80
           S+I    + + ++  GAGI+  P A K  GL    ++  + GF           +  +T 
Sbjct: 3   SSIRSGVITLLHTACGAGILAMPYAFKPFGLVPGFLMIAICGFCALSGLILQAQVAKYTA 62

Query: 81  RLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRI 140
               +  TLS  ++   +V + +    K     C G+              D +P +  +
Sbjct: 63  SGSASFFTLSQLISPSLSVVFDLAIAVK-----CFGV-----GVSYMIVVGDLMPQIFAV 112

Query: 141 FIHSH-FVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXX---FGP 196
           F  SH  + R+  I    LFI  PL  LR +++L   S +A+               F  
Sbjct: 113 FTTSHILLNRDFHISLIMLFIVSPLCFLRKLNSLRYASMIAISAVAYLCVLVVAHFIFQT 172

Query: 197 SLPAELKGS---GIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKL 253
               +LKG    G+P       PS   +L I  FA  CHHN   + +   N + T   K+
Sbjct: 173 EDVHDLKGVVSIGLPKHE----PSPLTTLPIFVFAYTCHHNFFSVINEQSNIAFTHIKKI 228

Query: 254 THLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLE 313
             +++ ++ +  +++G++G+  F     GNI+  +P    +  I R+   F ++   PL+
Sbjct: 229 PIIAMILAYLLYILIGFSGYLTFGDNIVGNIITLYPRTASS-TIGRLAIVFLVMLAFPLQ 287

Query: 314 LFVLR-------------------------------DVIAVILLENEWIPSIEEKPGMPI 342
               R                                ++AV L+E +     EE P    
Sbjct: 288 CHPCRASIHHIWHYIQEKNSNEIATQPINVPPDEEDTLLAVELIEEDSPKQPEEIP---- 343

Query: 343 LTRKWHFIVTTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILPPYVNLLL-----R 397
           L  K   I+T  I+  + ++++   +L  +  +VGAT ++ +++ILP      L      
Sbjct: 344 LRGKRFNIITVCILLFSYTLAISVNSLAKVLAIVGATGSTSISFILPGIFGFKLIGSEFS 403

Query: 398 QEKEPLPIKSKIPHY---FCILFGFTVMIVSSFQTIV 431
               PLP  ++   Y   F  ++G  VMI S   T++
Sbjct: 404 ATSSPLPKSARFFRYLGLFLSIWGLFVMIASLAATLL 440

>Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar to
           Ashbya gossypii AGL285C
          Length = 457

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 84/407 (20%), Positives = 163/407 (40%), Gaps = 52/407 (12%)

Query: 31  KSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGF--IVDWTLRLLITNIT 88
           +S++    + + ++  GAGI+  P A ++ GL    +I +  GF  +    L+  ++   
Sbjct: 2   RSSVQSGVLTLLHTACGAGILAMPYAFRSFGLLPGFLIIVFCGFSALTGLVLQSYVSKYV 61

Query: 89  LSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRIFIHSHFV- 147
               +++ +  + +       +  C   +              D +P ++  F  + ++ 
Sbjct: 62  APRHVSFFELAQISYPEL-SIVFDCAIAVKCFGVGISYMVVVGDLMPQIVSTFTSNQWLL 120

Query: 148 TRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXX---XFGPSLPAELKG 204
            R   I    LFI  PL  +R + +L   S +A+               F  S   + KG
Sbjct: 121 ERTLQITLCMLFIVTPLCFMRKLDSLRYASMVAISSVAYLCVLVVYHFLFPSSDIRQAKG 180

Query: 205 S---GIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFIS 261
               G P ++  AS  +  S  I  FA  CHHN   I + +R+ SLT   ++  +++ ++
Sbjct: 181 IVSIGFPENNSAAS--MLSSFPIFVFAYTCHHNMFSIVNELRDNSLTNCVRVVLIAMGLA 238

Query: 262 VIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVI 321
           V    ++G +G+  F     GNI+  + P  V+  +AR+     ++   PL+    R  I
Sbjct: 239 VSLYTVIGGSGYLTFGDNITGNIVTIY-PRSVSSTLARIAIVLLVMLAFPLQCHPARASI 297

Query: 322 AVIL-----------LENE-------------------------WIP---SIEEKPGMPI 342
             I            L NE                         W P   S +  P    
Sbjct: 298 NNIWCYFSESKIFSPLANEESGLMRHEGSPRTPPSNNEFSISPDWSPLQTSSQPIPTTTT 357

Query: 343 LTRKWHFIVTTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILP 389
           +  K  F++TT I+  + ++++   +   +  +VGAT ++ +++ILP
Sbjct: 358 IEGKRFFVITTSILIASYTLAVSVSSFARVLAIVGATGSTSISFILP 404

>KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 445

 Score = 68.6 bits (166), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 76/308 (24%), Positives = 135/308 (43%), Gaps = 42/308 (13%)

Query: 132 DTIPHVLRIFI-HSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXX 190
           D +P +   F  H   ++RN  I    LF+  PL  ++ + +L   S +A+         
Sbjct: 104 DLMPRIFATFTSHGLLLSRNLHITLVMLFVVSPLCFMKRLDSLRYASMVAISSVAYLCVL 163

Query: 191 XXX--FGPSLP-AELKGS---GIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRN 244
                  PS    EL+G    G P  S+ A  S F    I  FA  CHHN   I + +R+
Sbjct: 164 VLVHYVWPSDEIRELRGHVSLGKPVGSFAALLSCF---PIFVFAYTCHHNMFSIVNELRD 220

Query: 245 KSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGF 304
            SL    K++ +SV +++   +++G +G+  F     GNI+  +P +  A  + RV    
Sbjct: 221 NSLKGIYKVSIISVALAMSLYLLIGGSGYATFGDNVAGNIIMLYPQS-AATTVGRVAIAL 279

Query: 305 NMLTTLPLELFVLRDVIAVIL-----------------LENEWIPS------IEEKPG-- 339
            ++   PL+    R  +  IL                   ++ IPS      + E+ G  
Sbjct: 280 LVMLAFPLQCHPARASVDHILHYFGAGKSHEAAPSPSSESSQLIPSSDTEDIVVEEGGPR 339

Query: 340 ----MPILTRKWHFIVTTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILPPYVNL- 394
               MP+  +++   +TT I+ L+  +++   +L  +  +VGAT ++ +++ILP      
Sbjct: 340 QLAVMPLEGKRF-IAITTSILLLSYLLAISVTSLARVLAVVGATGSTSISFILPGIFGFQ 398

Query: 395 LLRQEKEP 402
           L+  E +P
Sbjct: 399 LIGSEDQP 406

>Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119C -
           Hypothetical ORF [contig 33] FULL
          Length = 467

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 95/429 (22%), Positives = 163/429 (37%), Gaps = 74/429 (17%)

Query: 13  QLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIML 72
           Q +  +     I + N   S++    + + ++  GAGI+  P A K  GL        +L
Sbjct: 7   QTRACKKRYSSIYNPNAMSSSVGSGVLTLLHTACGAGILAMPYAFKPFGL--------VL 58

Query: 73  GF-IVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILC------------------ 113
           GF ++ +      T + L ++++     +Y   R   +  L                   
Sbjct: 59  GFCMIVFCGACSATGLMLQARVS-----KYAKERNASFFALSQITYPQLSVVFDLAIAVK 113

Query: 114 CNGLFALXXXXXXXXXXXDTIPHVLRIFI-HSHFVTRNSVIFFSTLFISYPLSLLRDISA 172
           C G+              D +P +   F  HS  + RN  I      I  PL  +R + +
Sbjct: 114 CFGV-----GVSYLVVVGDLMPRIFATFTSHSLLLNRNFHITLVMALIVSPLCFMRRLDS 168

Query: 173 LSSTSFLALXXXXXXXXXXXX---FGPSLPAELKGS---GIPSSSYVASPSLFRSLSIVS 226
           L   S +A+               F      ELKG      P+ S+ A   L     I  
Sbjct: 169 LRYASMIAVSSVAYLCVLVVVHFLFPSEELRELKGYVSIQKPAGSFSA---LLSCFPIFV 225

Query: 227 FALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILN 286
           FA  CHHN   I + +R+ SL    K+  +SV +S+   +++G +G+  F     GNI+ 
Sbjct: 226 FAYTCHHNMFSIINELRDNSLKGIYKVCAISVALSMTLYLLIGGSGYATFGDNVPGNIIT 285

Query: 287 NFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVIL----------LEN-------- 328
            + P      I RV     ++   PL+    R  I  I+          L+N        
Sbjct: 286 LY-PQSTTTTIGRVAIALLVMLAFPLQCHPARASIDHIIQYFSKASDNPLQNSEASHLIS 344

Query: 329 -----EWIPSIEEKPGMPI---LTRKWHFIVTTIIVFLTMSVSLLTCNLGALFELVGATT 380
                E + + E+ P  P    L  K    +T  I+  +  +++   +L  +  +VGAT 
Sbjct: 345 SPRVSEDVMAEEDSPQQPQVVPLEGKRFIAITAGILIFSFLLAISVTSLARVLAVVGATG 404

Query: 381 ASVMAYILP 389
           ++ +++ILP
Sbjct: 405 STSISFILP 413

>TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {ON} 
          Length = 428

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 102/397 (25%), Positives = 165/397 (41%), Gaps = 68/397 (17%)

Query: 39  VNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDT 98
           V + ++  GAGI+  P A K  GL   +++ ++ G          I  + L +K+     
Sbjct: 8   VTLLHTACGAGILAIPFAFKPFGLFPGLMVLVVCGIAA-------IFGLLLQAKI----- 55

Query: 99  VEYT-MGRKGKYLILCCNG------LFALXXXXXXXXXXXD---TIPHVLRIFIHSHFVT 148
           ++YT    K  + IL          LF L                I   L + + + +  
Sbjct: 56  IKYTPTNEKHSFFILATKLHPTLAILFDLAIAVKCFGVSTSYLIAIGDFLAVLLDNEY-- 113

Query: 149 RNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXF--GPSLP-AELKGS 205
           R + I F  LFI  PLS LR I+AL  TS LA+                PS   +EL+G+
Sbjct: 114 RMNTITFVWLFIILPLSYLRKINALRYTSLLAVTSVFYLCILVTYHYCKPSEEISELRGT 173

Query: 206 G---IPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTH---LSVF 259
               +P SS + SP  F++L I  FA  CHHN   +F  I  +  T F +L     +++ 
Sbjct: 174 VSLFLPKSSGI-SP--FKTLPIFVFAYTCHHN---MFAVINEQKHTDFKRLKFIPLIAIS 227

Query: 260 ISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLE------ 313
           I+ I  +I+G  G+  F      NI+  +P N V   + +      +    PL+      
Sbjct: 228 IACILYLIVGCLGYATFGANITSNIVAKYPTNSVLTVLGQTAMLTVVTLAYPLQCQPARA 287

Query: 314 -----LFVL----------------RDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVT 352
                L+ L                 D   V L EN+     E     P +    H IVT
Sbjct: 288 SILNILYALFPKLKNNKSDVEEASMNDGYQVDLEENKQQSEPERIISEPSIIL--HSIVT 345

Query: 353 TIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILP 389
           ++I+F +  +++   +L  +  +VGAT ++ +++ILP
Sbjct: 346 SLILFGSWCIAVSVNSLAQVLAIVGATGSTFISFILP 382

>KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.420
           YER119C
          Length = 461

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 78/353 (22%), Positives = 148/353 (41%), Gaps = 65/353 (18%)

Query: 132 DTIPHVLRIFIHSHFV-TRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXX 190
           D +P +  ++  +  +  R+  I    +FI  PL  ++ +++L   S +A+         
Sbjct: 104 DLLPQIWSVWTSNKLLLNRDFHITMVMIFIVAPLCFMKKLNSLRYASMIAISAVAYLCVL 163

Query: 191 XXXF------GPSLPAELKGS---GIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHS 241
                       +   +LKG    G+P       P +  +L I  FA  CHHN   + + 
Sbjct: 164 VIYHFIFQDPNDTHFQDLKGRISIGLPRDE----PPILTTLPIFVFAYTCHHNMFSVINE 219

Query: 242 IRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVC 301
             ++     TK+   S+ ++ +  +++GY+G+  F  K  GNI+  + PN  +  I R+ 
Sbjct: 220 QVDQKFNVITKIAKYSMSLAFLLYIVIGYSGYLTFGDKIVGNIVTLY-PNNASSTIGRIA 278

Query: 302 FGFNMLTTLPLELFVLRDVI------------------AVILLENEWI-PSIEEKP---- 338
               +  T PL+    R  I                  A++L + E + P +E  P    
Sbjct: 279 IAILVTLTFPLQCHPARASIHHIIHFFQARSAENGNGSAMVLNQMEGVSPELETTPLTDA 338

Query: 339 -------------------GMPILTRKWHFIVTTIIVFLTMSVSLLTCNLGALFELVGAT 379
                               MP+  +++ FI  TI+ F +  +++   +L  +  +VGAT
Sbjct: 339 ANCAEVDTAIEEGSPEELQVMPLEGKRFIFITCTIL-FCSYLLAVSVTSLAKVLAIVGAT 397

Query: 380 TASVMAYILPPYVNL-LLRQEKE---PLPIKSKIPHY--FCI-LFGFTVMIVS 425
            ++ +++ILP      L+  E E    LP ++K+  Y   C+ ++G  VM+ S
Sbjct: 398 GSTSISFILPGIFGYKLIGSECETGAELPFQTKMFKYLGLCLAVWGLVVMVAS 450

>KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 456

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 108/459 (23%), Positives = 185/459 (40%), Gaps = 69/459 (15%)

Query: 31  KSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLS 90
            S++    + + ++  GAGI+  P A K  GL   + + I  G      L L      +S
Sbjct: 2   SSSVQSGVITLLHTACGAGILAMPYAFKPFGLILGLSMIIFCGLCSSTGLYL---QSYVS 58

Query: 91  SKLTYGDTVEYTMGRKGK-YLILCCNGLFALX---XXXXXXXXXXDTIPHVLRIFI-HSH 145
             +  G    +T+ R  +  L +  +   A+              D +P ++  F  H  
Sbjct: 59  KYVPPGHASFFTLCRLTRPELSVVFDAAIAVKCFGVGVSYLVVVGDLLPQIMSTFTTHGW 118

Query: 146 FVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPSLP----AE 201
            ++R   I   TL I  PL  ++ + +L  TS +A+            F  ++P      
Sbjct: 119 LLSRQFHITAVTLIIVTPLCFIKKLDSLRYTSSIAITAVGYLCVLVV-FHFAVPNSEIDH 177

Query: 202 LKGS-GIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFI 260
           L+G   I   S V S S+  S  I  FA  CHHN   I +   +KSL   TKL  +++ +
Sbjct: 178 LRGHVSIWKPSDVDS-SMLSSFPIFVFAYTCHHNMFSIINEQSDKSLDSITKLIRIAITL 236

Query: 261 SVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDV 320
           ++   + +G  G+  F     GNI+  + PN ++  I R+     ++   PL+    R  
Sbjct: 237 AMSLYISIGALGYCTFGDHITGNIITLY-PNSISSTIGRIAIALLVILAFPLQCHPARAS 295

Query: 321 IAVIL-------------------------------------LENEWIP--SIEEKPGMP 341
           +  IL                                      E+E I   S  + P + 
Sbjct: 296 VNHILHYFSKGNTHPPMTTTSAEQNSLLRDSELESSEQLTYECEDELIEENSANQPPVVT 355

Query: 342 ILTRKWHFIVTTIIVF---LTMSVSLLTCNLGALFELVGATTASVMAYILPPY--VNLLL 396
           +   ++ FI + I++F   L MSV+    +L  +  +VGAT ++ +++ILP      L+ 
Sbjct: 356 LEGPRFIFITSGILLFSYILAMSVT----SLANVLSIVGATGSTSISFILPGIFGYKLIA 411

Query: 397 RQEKEPL--PIKSKIPHYFCIL---FGFTVMIVSSFQTI 430
            +  + +  P K +I     +L   +GF VMI S   TI
Sbjct: 412 SEYAKSVVPPAKERILRIISLLLAIWGFIVMITSLSATI 450

>CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119c
          Length = 445

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/293 (21%), Positives = 122/293 (41%), Gaps = 38/293 (12%)

Query: 132 DTIPHVL-RIFIHSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXX 190
           D +P +  R+      ++RN  I    LFI  PL  +R +++L   S +A+         
Sbjct: 103 DLMPKIWSRVSSSGLLLSRNVNITLVMLFIVGPLCFMRRLNSLRYASMIAIGSVAYLCIL 162

Query: 191 XX---XFGPSLPAELKGS---GIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRN 244
                    +   ELKG    G+P       P+   +L I  FA  CHHN   + +  +N
Sbjct: 163 VIVHFAHQTTELRELKGEVSVGLPH----GEPTPLTTLPIFVFAYTCHHNMFSVINEQKN 218

Query: 245 KSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGF 304
              T    +  +S+ ++ +  +++G  G+  F     GNI+  + P+ ++  I R+    
Sbjct: 219 TGFTYVRYIAIVSILVAFVLYVVIGSTGYLTFGDNITGNIIALY-PDTLSTTIGRIAIVL 277

Query: 305 NMLTTLPLELFVLRDVI--AVILLENEWIP---------------------SIEEKPG-- 339
            ++   PL+    R+ I   +  +++ + P                     SI  +    
Sbjct: 278 LVMLAFPLQCHPARESINNMIKYVQDRYSPQTSYELTAVDADNLEINNDVTSINSRANDK 337

Query: 340 -MPILTRKWHFIVTTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILPPY 391
               +  K   I+T  I+F +  +++   +L  +  +VGAT ++ +++ILP Y
Sbjct: 338 EEECMDTKRFMIITACILFCSYLLAISVTSLARVLAIVGATGSTTISFILPGY 390

>YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}
           AVT6Vacuolar aspartate and glutamate exporter; member of
           a family of seven genes (AVT1-7) related to vesicular
           GABA-glycine transporters; involved in
           compartmentalizing acidic amino acids in response to
           nitrogen starvation
          Length = 448

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 81/340 (23%), Positives = 142/340 (41%), Gaps = 53/340 (15%)

Query: 132 DTIPHVLRIFIHSHFV-TRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXX 190
           D +P ++ ++  + ++  RN  I    LF   PLS L+ +++L   S +A+         
Sbjct: 104 DLMPQIMSVWTRNAWLLNRNVQISLIMLFFVAPLSFLKKLNSLRYASMVAISSVAYLCVL 163

Query: 191 XXX--FGPSLPA-ELKGSGIPSSSYVASP-----SLFRSLSIVSFALVCHHNTSFIFHSI 242
                  PS     LKG      SY+  P     ++  +L I  FA  CHHN   I +  
Sbjct: 164 VLLHYVAPSDEILRLKGR----ISYLLPPQSHDLNVLNTLPIFVFAYTCHHNMFSIINEQ 219

Query: 243 RNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCF 302
           R+       K+  +++ +++I  + +G AG+  F     GNI+  + P  V+  I R+  
Sbjct: 220 RSSRFEHVMKIPLIAISLALILYIAIGCAGYLTFGDNIIGNIIMLY-PQAVSSTIGRIAI 278

Query: 303 GFNMLTTLPLELFVLRDVIAVILL----ENEWIPS------------------------- 333
              ++   PL+    R  I  IL     EN  I +                         
Sbjct: 279 VLLVMLAFPLQCHPARASIHQILQHFAEENVSISATSADEPTVATESSPLIRDSSLDLNE 338

Query: 334 -IEE----KPGMPILTRKWHFIVTTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYIL 388
            IEE    +P    L  K   ++T  I+  +  V++   +L  +  +VGAT ++ +++IL
Sbjct: 339 VIEEESIYQPKETPLRGKSFIVITCSILVASYLVAISVSSLARVLAIVGATGSTSISFIL 398

Query: 389 PPY--VNLLLRQEKEPLPIKSKIPHYFCIL---FGFTVMI 423
           P      L+  + K  +P+ +KI  Y  +L   +G  +MI
Sbjct: 399 PGLFGYKLIGTEHKTAVPLTTKIFKYTGLLLFIWGLIIMI 438

>Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON}
           complement(5011..7074) [2064 nt, 688 aa]
          Length = 687

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 103/462 (22%), Positives = 198/462 (42%), Gaps = 47/462 (10%)

Query: 2   NYTIVPTDEEFQLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAG 61
           N +++  ++  Q  +S   ++++ ++  +K++   +F+ +  S +G G++  P A  N G
Sbjct: 242 NASLINANKSLQNSESNYQIEQVSNDKEQKTSTLKSFLLLLKSFVGTGVLFLPSAFHNGG 301

Query: 62  LCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALX 121
           L  SIV+ +  G    W   LL+   T++   ++G+  +   G   K++IL    L  L 
Sbjct: 302 LFFSIVMIMFFGVYSFWCYYLLVRVKTITGLTSFGNMGQRVFGPWMKFIILLSLILSQLG 361

Query: 122 XXXXXXXXXXDTIPHVLRIFIHSHFVTRNSVIFFSTLF---ISYPLSLLRDISALSSTSF 178
                            + FI +    ++  I +  L    I  PLS +R +S L+  S 
Sbjct: 362 FGSTYVIFTAKN----FKAFIENVTNIKDFNIIYPILLQFIIFVPLSYIRRVSKLTLPSL 417

Query: 179 LALXXXXXXXXXXXXFG-PSLPAELKG---SGIPSSSYVASPSLFRSLSIVSF---ALVC 231
           +A             F    L  +L G    GI S       +LF   +I +F    L+ 
Sbjct: 418 IANGFILIGLSLVIYFSIDHLAGDLHGKPADGIISFFNTKHWTLFIGTAIFAFEGIGLII 477

Query: 232 HHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPN 291
                 + +S+R+ S  KF  +  L +  + +  +I+   G+  +   T+  IL NFP  
Sbjct: 478 P-----LQNSMRDPS--KFPLVLGLVMICTTVMFIIIATIGYLSYGSSTETIILQNFPQK 530

Query: 292 GVAINIARVCFGFNMLTTLPLELFVLRDVIAVILLENEWIP----SIEEKPGMPILT--- 344
            + +N+ ++ +   +L + PL++F      A+ ++E++  P      E K  +PI T   
Sbjct: 531 NIVVNLIQLFYALAILLSTPLQIFP-----AIEIVEDKIFPKPGSDPECKDEIPITTIYN 585

Query: 345 ---------RKW--HFIVTTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILPPYVN 393
                     KW  + I T I+  + +     + NL  L  ++G+     + Y+ PP ++
Sbjct: 586 ANSGGLDWRIKWFKNMIRTMIVTCVILLAYFGSNNLDKLVAIIGSLACIPLVYMYPPMLH 645

Query: 394 LL---LRQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQTIVE 432
           L    +   K      SK   Y  I+FG   M+ +++Q+I +
Sbjct: 646 LKTYSIPMSKGKRFTWSKSFDYILIVFGGVSMVYTTYQSIKD 687

>AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL101W
           (AVT4)
          Length = 716

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 100/435 (22%), Positives = 175/435 (40%), Gaps = 57/435 (13%)

Query: 31  KSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLS 90
           K++ + AF+ M  S +G G++  P A  N GL  SI +         W   +L+ +   +
Sbjct: 298 KTSTFKAFLLMIKSFIGTGVLFLPNAFSNGGLAFSISMLFFFSAYSYWCYYILVRSKDAT 357

Query: 91  SKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXX-XXXDTIPHVLRIFIHSHFVTR 149
              ++GD      G   K++IL    L  +            + I  +  +F       +
Sbjct: 358 GVSSFGDIGGILFGSWMKFIILFSLVLTQMGFAGAYVVFTAKNLIAFLDNVFNWPDIPVK 417

Query: 150 NSVIFFSTLFISYPLSLLRDISALSSTSFLA-------LXXXXXXXXXXXXFGPSL-PAE 201
              +  + LFI  PLS +R++S LS TS  A       L            +  S  PAE
Sbjct: 418 --YLLLTQLFIFIPLSFVRNVSKLSITSLFANFFIISGLIIVVYYTACRWMYDLSFKPAE 475

Query: 202 LKGSGIPSSSYVASPSLFRSLSIVSF---ALVCHHNTSFIFHSIRNKSLTKFTKLTHLSV 258
               G+         SLF   +I +F    L+       +  S+R+    +F K+  L +
Sbjct: 476 ----GVIMVFNPNRWSLFIGTAIFAFEGIGLIIP-----VQESMRHPE--EFPKVLGLVI 524

Query: 259 FISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLR 318
             + +  + +G  G+  +  + +  IL N P + +++N+ ++ +   +L + PL+LF   
Sbjct: 525 ITTTVLFITIGTLGYLAYGSQIQSVILLNLPQDALSVNMIQLFYSMAILLSTPLQLFP-- 582

Query: 319 DVIAVILLENEWIP---------------SIEEKPGMPILTRKW-HFIVTTIIVFLTMSV 362
              A+ ++EN++ P                +++  G      KW   +V +IIV L + +
Sbjct: 583 ---AIGIIENKFFPRFTKVDIKGQDSADFQLQQNSGRANWRVKWSKNLVRSIIVLLVIIL 639

Query: 363 SLLTC-NLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSK--------IPHYF 413
           +     NL     +VG      + YI P    L LR    P   KS         +  Y 
Sbjct: 640 AYFGADNLDLFVSIVGCLACIPLVYIYPSM--LHLRSCSTPDHEKSNTWKTRCSVLIDYI 697

Query: 414 CILFGFTVMIVSSFQ 428
            I+FGF  M  +S+Q
Sbjct: 698 LIIFGFVSMCYTSYQ 712

>NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON}
           Anc_2.295
          Length = 481

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (51%)

Query: 217 SLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIF 276
            L  + SI+ FA V   N   I   + N S+    K+ + S+ IS IF +++G +G+  F
Sbjct: 188 GLLSTFSIIIFAYVGAMNLFSICRELENDSMENILKVINGSIGISSIFFLLVGISGYLTF 247

Query: 277 TGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLR 318
               +GNI+ N+ PN + I + + C  F +L + PL    LR
Sbjct: 248 GSNVQGNIILNYDPNSIWIYLGKFCLAFMLLLSFPLLFHPLR 289

>TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {ON}
           Anc_7.420 YER119C
          Length = 453

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 73/289 (25%), Positives = 123/289 (42%), Gaps = 63/289 (21%)

Query: 159 FISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPSLPAE----LKGSG---IPSSS 211
           FI  PLS L+ I+AL  TSFLA+            F  + P++    L+G+     P   
Sbjct: 124 FIIAPLSFLKKITALRYTSFLAVVSVIYLSILVT-FHYADPSQEIIDLRGNVSLFFPGED 182

Query: 212 YVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHL---SVFISVIFCMIM 268
              S S F++L I  FA  CHHN   +F  +  +S  +F+KL ++   ++ I+ I  +I+
Sbjct: 183 QHNSVSPFKTLPIFVFAYTCHHN---MFAVLNEQSTNEFSKLKYIPLTAISIACIMYLIV 239

Query: 269 GYAGFFIFTGKTKGNILNNFPPNGVA---------------------------INIARVC 301
           G  G+  F      NI+  +P N +A                           INI    
Sbjct: 240 GTFGYVTFGSNITSNIVAQYPTNSIATILGQTAMLTVVTLAFPLQCQPARASFINIINAF 299

Query: 302 FGFNMLTTLPLE----LFVLRDVIAVILL--------------ENEWIPSIEEKPGMPIL 343
           F     T  PL+    +++     ++                  NE  P IE +  +P  
Sbjct: 300 FPRFKYTPPPLQDEESMYISSTADSINNNNNQNSTPSTPRESTPNETTP-IEARSKLPFA 358

Query: 344 ---TRKWHFIVTTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILP 389
              T+  H ++TTII+  +  +++   +L  +  +VGAT ++ +++ILP
Sbjct: 359 QEPTQFQHILLTTIILLGSWLIAISVKSLAHVLAIVGATGSTSISFILP 407

>CAGL0E06468g Chr5 (647086..649131) [2046 bp, 681 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146w or
           uniprot|P50944 Saccharomyces cerevisiae YNL101w
          Length = 681

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 96/418 (22%), Positives = 161/418 (38%), Gaps = 42/418 (10%)

Query: 28  NNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNI 87
           +  KS+   A + +  S +G G++  P A  N G   S  + ++   I  W   LLI   
Sbjct: 286 HGHKSSTTKAVLLLLKSFVGTGVLFLPRAFHNGGWGFSSSVLLICALISYWCFVLLIDTK 345

Query: 88  TLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRIFIHSHFV 147
                  YGD   +  G   K  IL    L  +                 L++F ++ F 
Sbjct: 346 NHVGLDGYGDMGNHLYGSSMKLAILWSIALSQIGFSSAYTVFTATN----LQVFTNNVFK 401

Query: 148 TRNSVIFFSTLFISY--PLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPSLPAELKGS 205
               +  F  + + +  PL+L R+I+ LS T+ +A             F  S    +   
Sbjct: 402 QEYGITIFIIIQVLFFLPLALTRNIAKLSGTALIADLFILLGLVYVYWFSIS---HVSTH 458

Query: 206 GIPSSSYV----ASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFIS 261
           G+ S + +    A  SLF   +I +F  +       +   I+        K  H    +S
Sbjct: 459 GVASETMLMFNKADWSLFIGTAIFTFEGIG------LLIPIQE----SMKKPEHFHASLS 508

Query: 262 VIFCMIM------GYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELF 315
            + C++       G   +  F    +  +L NFP   +     ++ +   +L + PL+LF
Sbjct: 509 GVMCVVTVVFISCGLICYCAFGADVETVVLLNFPQESIYTRAVQLLYALAILLSTPLQLF 568

Query: 316 VLRDVIAVILLENEWIPSIEEKPGMPILTRKW--HFIVTTIIVFLTMSVSLLTCNLGALF 373
                 A+ +LEN W  S     G      KW  ++    I+ F  +       +L    
Sbjct: 569 P-----AIKILEN-WTFS-PHSSGKHNPKVKWLKNYFRAAIVCFSALIAWAGANDLDKFV 621

Query: 374 ELVGATTASVMAYILPPYVNL-LLRQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQTI 430
            LVG+     + YI PP ++    +++K  L + S I   F + FG  VMI +S QTI
Sbjct: 622 SLVGSFACIPLIYIYPPMLHFKAFKKDKSKLFMASDI---FLLFFGIIVMIYTSLQTI 676

>KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} similar
           to uniprot|P50944 Saccharomyces cerevisiae YNL101W AVT4
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 721

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 100/482 (20%), Positives = 188/482 (39%), Gaps = 89/482 (18%)

Query: 9   DEEFQLQDSE-----ALVKEIIDENNK--------KSNIYMAFVNMANSILGAGIITQPL 55
           DE+ +  +SE     A  +E +  N +        K++ + AF+ M  S +G G++  P 
Sbjct: 269 DEDDEFNESEVPLLNASDRERLGHNKRVIARPSQVKTSTFKAFLLMLKSFIGTGVLFLPS 328

Query: 56  AVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDT--------VEYT----- 102
           A  N GL  S+++    G    W   +LI +   +   ++GD         + Y      
Sbjct: 329 AFANGGLIFSVLMLSFFGMYSYWCYYILIRSKVATGVSSFGDIGIKLYGPWMRYAILASL 388

Query: 103 ----MGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRIFIHSHFVTRNSVIFFSTL 158
               +G    Y++  C  L A                H LRI    H +   ++IF    
Sbjct: 389 ILTQLGFSAAYVVFTCKNLLAFFQNVFHL--------HSLRI---EHLLILQTIIFI--- 434

Query: 159 FISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPS---LPAELK-GSGIPSSSYVA 214
               PL+ +R++S LS TS LA             F      +  +LK  +GI      +
Sbjct: 435 ----PLAFIRNVSKLSLTSLLANFFTMAGLIIIVFFVVKHLVIDLDLKPEAGIIYGFNSS 490

Query: 215 SPSLFRSLSIVSF---ALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYA 271
             SLF   +I +F    L+     S        +   KF  +  L +  + +  + +   
Sbjct: 491 KWSLFIGTAIFAFEGIGLIIPVQDSM-------RKPEKFPLVLGLVILTATVLFISIAAL 543

Query: 272 GFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVILLENEWI 331
           G+  F    +  IL N P + + +N+ +  +   +L + PL+LF      A+ ++E++ +
Sbjct: 544 GYLAFGRYIETVILLNLPQDNIFVNLVQFFYSLAILLSTPLQLFP-----AIGIIESKLV 598

Query: 332 PSIEE--------------KPGMPILTRKW--HFIVTTIIVFLTMSVSLLTCNLGALFEL 375
           P   +                G      KW  +F+ + I++F+       +  L      
Sbjct: 599 PKFRKTVSPTNKNDVQLSPNSGKLDWKVKWTKNFLRSIIVIFVICLAYFGSSKLDVFVSF 658

Query: 376 VGATTASVMAYILPPYVNLLLRQE---KEPLPIKSKI---PHYFCILFGFTVMIVSSFQT 429
           +G      + Y+ PP ++L    +   K+   +K+++     Y  ++FG   M+ +S+Q 
Sbjct: 659 IGCFACIPLVYMYPPLLHLKSCSQPAYKQNQTLKNRLMITMDYGLVIFGGVSMLYTSYQC 718

Query: 430 IV 431
           I+
Sbjct: 719 IM 720

>TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7.420
           YER119C
          Length = 464

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 81/361 (22%), Positives = 140/361 (38%), Gaps = 68/361 (18%)

Query: 132 DTIPHVLRIFIHSHF-VTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXX 190
           D +P +L  F  + F + RN  I    LFI  PL  L+++++L   S  A+         
Sbjct: 104 DVMPQILGTFTDTEFFLNRNVNITIVMLFIVTPLCFLKNLNSLRYASIAAISAVIYLCFL 163

Query: 191 XXX--FGPSLPAELKGSGIPSSSYVASPSL--FRSLSIVSFALVCHHNTSFIFHSIRNKS 246
                F P+   E++ +  P S       L    +L I  FA  CHHN   +F  I  + 
Sbjct: 164 VMFHFFIPN--EEIRDTRGPVSWGFPKDGLNPLNTLPIFVFAYTCHHN---MFSVINEQQ 218

Query: 247 LTKFTKLTHLSVFISVIFC---MIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFG 303
              F KL  + +F  ++ C   +I+G +G+  F     GNI+  +  N  A  + R+   
Sbjct: 219 DIHFNKLKQICIFAMLLACTLYIIIGGSGYLTFGNAITGNIITLY-SNSAATTVGRIAIV 277

Query: 304 FNMLTTLPLELFVLRDVIAVI--------------------------LLENEWIP----- 332
             ++   PL+    R  I  I                          L++NE  P     
Sbjct: 278 ILVMLAFPLQCHPARASINHILHYFQLINCDNNQVQESESGHRESSGLIDNEITPQPQLQ 337

Query: 333 -SIEEKPG------MPILTRKWHFIVTTIIVFLTMSVSLLTC---------NLGALFELV 376
            + E+ P        P   + +  +      F  +++ +L C         +L  +  +V
Sbjct: 338 EAFEQPPDEVVEEEFPEQQKSFEPVTLDPKTFTVVTICILICSYILAVSVTSLAKVLAIV 397

Query: 377 GATTASVMAYILPPYVNLLL----RQEKEPLPIKSKIPHYFCI---LFGFTVMIVSSFQT 429
           GAT ++ +A+ILP      L        + +P+ +K+  Y  +   ++G  VM  S F  
Sbjct: 398 GATGSTSIAFILPGVFGYQLIGSEYSTSQIVPLPTKLLKYSAVALTIWGVFVMTASLFAA 457

Query: 430 I 430
           +
Sbjct: 458 L 458

>CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa]
           {ON} similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 485

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 52/105 (49%)

Query: 217 SLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIF 276
            L  + SI+ FA V   N   I + +++ S+T   K+   S+ IS I  + +G  G+  F
Sbjct: 191 GLLSTFSIIIFAYVGAMNIFTIVNELQDNSMTNVRKVVDSSILISTILFLFVGLFGYLTF 250

Query: 277 TGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVI 321
              T GNIL N+  + +AI I + C    ++ T PL    LR  I
Sbjct: 251 GSLTMGNILLNYDSDSLAIGIGKFCLAMMLILTFPLLFHPLRTAI 295

>SAKL0E10362g Chr5 complement(860653..862854) [2202 bp, 733 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 733

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 103/435 (23%), Positives = 167/435 (38%), Gaps = 55/435 (12%)

Query: 32  SNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSS 91
           ++ + AF+ M  S +G G++  P A  N GL  S+ +    G    W   +LI +   + 
Sbjct: 316 TSTFKAFLLMIKSFIGTGVLFLPNAFANGGLTFSVCMLSFFGIYSYWCYYILIQSKVATK 375

Query: 92  KLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRIFIHSHFVTRNS 151
             ++GD      G   K++IL    L  L             +   L      H V    
Sbjct: 376 VSSFGDIGFRLYGTWMKFVILFSLVLTQLGFSGAYVVFTAKNLIAFLDNVFRWHDVPIEY 435

Query: 152 VIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPS--------LPAELK 203
           ++F   L I  PLS +R++S LS TS +A             F            PAE  
Sbjct: 436 LLFLQ-LAIFIPLSFIRNVSKLSLTSLIANFLVMAGLIIVVFFVLKHLILDLHFTPAEGV 494

Query: 204 GSGIPSSSYVASPSLFRSLSIVSF---ALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFI 260
             G  SSS+    SLF   +I +F    L+     S        K   KF  +  L +  
Sbjct: 495 IMGFNSSSW----SLFIGTAIFAFEGIGLIIPVQDSM-------KHPEKFPLVLGLVIGA 543

Query: 261 SVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDV 320
           + +  + +   G+  +   T+  IL N P   + +N+ +  +   +L + PL+LF     
Sbjct: 544 ATVLFVTIATLGYLSYGQNTETVILLNLPQGNLCVNLIQFFYSLAILLSTPLQLFP---- 599

Query: 321 IAVILLENEWIP-------------SIEEKPGMPILTR--KW--HFIVTTIIVFLTMSVS 363
            A+ ++EN+  P              +E +P    L    KW  + + + I+ F+ +   
Sbjct: 600 -AIAIIENKVFPRFTKIYVKKNNRTDVELRPNSGKLDWKVKWLKNSVRSVIVSFVILLAY 658

Query: 364 LLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEP-----LPIKSKIP---HYFCI 415
             + NL     +VG      + Y+ PP   L LR   +P          K P    Y  I
Sbjct: 659 YGSENLDKFVSIVGCFACIPLVYMYPPL--LHLRSCSKPQCHGVTKWWKKWPIGLDYLLI 716

Query: 416 LFGFTVMIVSSFQTI 430
            FG   MI +S+Q +
Sbjct: 717 TFGGVSMIYTSYQCV 731

>NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420
          Length = 471

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 78/326 (23%), Positives = 133/326 (40%), Gaps = 50/326 (15%)

Query: 149 RNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPSLPAELKGSGIP 208
           RN  I    L I  PL  ++++S+L   S +A+               S   E+K     
Sbjct: 136 RNFHITIMMLCIVSPLCFMKNLSSLRYASMVAISSVVYLCVLVVFHFLSPSQEIKDLKGE 195

Query: 209 SSSYVAS--PSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCM 266
            S ++ +  PS   +L I  FA  CHHN   + +   + S     KL  +++ ++    +
Sbjct: 196 LSYWLPNNEPSPLVTLPIFVFAYTCHHNMFSVINEQIDNSFHNIKKLAIIAMSLAFSLYI 255

Query: 267 IMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVILL 326
           I+G +G++ F     GNI+  + P  V+  I R+   F +    PL+    R  I  I+L
Sbjct: 256 IIGGSGYYTFGDNIVGNIITLY-PQSVSSTIGRMAIVFLVTLAFPLQCHPARASIHHIIL 314

Query: 327 --------ENEWIPS-----------------------------IEEKPGMPI---LTRK 346
                     E  PS                              EE P  P+   L  K
Sbjct: 315 YITMKINDAKEIKPSNPQQEPLALSANNQERAMLIRSERSDTLIEEESPLQPVTVPLEGK 374

Query: 347 WHFIVTTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEK----EP 402
              ++TT I+  +  +++   +L  +  +VGAT ++ +++ILP      L   +    E 
Sbjct: 375 QFILITTSILICSYLLAISVSSLAHVLAIVGATGSTSISFILPGVFGYKLIGSEMLTTEQ 434

Query: 403 LPIKSKIPHYFCIL---FGFTVMIVS 425
           LPIK+++  Y  +L   +G  +MI S
Sbjct: 435 LPIKTRLFKYSGLLLSIWGVFIMITS 460

>Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C
           (REAL)
          Length = 448

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 69/325 (21%), Positives = 135/325 (41%), Gaps = 48/325 (14%)

Query: 132 DTIPHVLRIFIHSHFV-TRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXX 190
           D +P ++ ++  + ++ +RN  I    +F+  PLS L+ +++L   S +A+         
Sbjct: 104 DLMPQIMSVWTRNAWLLSRNVQISLIMVFLVAPLSFLKKLNSLRYASMIAISSVAYLCVL 163

Query: 191 XXXFGPSLPAE----LKGS---GIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIR 243
                 + P+E    +KG      P  S+    ++  +  I  FA  CHHN   I +  R
Sbjct: 164 VLVHYIA-PSEEILHMKGRISYFFPKQSH--DLNILNTFPIFVFAYTCHHNMFSIINEQR 220

Query: 244 NKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFG 303
           +       K+  +++ +++I  + +G AG+  F     GNI+  + P   +  + RV   
Sbjct: 221 SSRFEHVMKIPLIAISLALILYVAIGCAGYLTFGDNIIGNIIMLY-PQTTSSTVGRVAIV 279

Query: 304 FNMLTTLPLELFVLRDVIAVILLE-------------------NEWIPSIEE-------- 336
             ++   PL+    R  I  IL                     NE  P I +        
Sbjct: 280 LLVMLAFPLQCHPARASIHQILQHFTEENATISTTSTSSPAPTNESSPLIRDNSLDINEV 339

Query: 337 -------KPGMPILTRKWHFIVTTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILP 389
                  +P    L  K   ++T  I+  +  V++   +L  +  +VGAT ++ +++ILP
Sbjct: 340 IEEESIYQPKETPLKGKSFIVITCAILIASYFVAISVSSLARVLAIVGATGSTSISFILP 399

Query: 390 PY--VNLLLRQEKEPLPIKSKIPHY 412
                 L+  + KE +P+ +++  Y
Sbjct: 400 GLFGYKLIGTEHKEGIPLGTRLFKY 424

>KLTH0D09042g Chr4 complement(746802..748958) [2157 bp, 718 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 718

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 99/447 (22%), Positives = 175/447 (39%), Gaps = 89/447 (19%)

Query: 37  AFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYG 96
           AF+ M  S +G G++  P A  N GL  S+ + +  G    W   +L  +   +   ++G
Sbjct: 306 AFLLMIKSFVGTGVLFLPGAFSNGGLFFSLAMLVFFGIYSYWCYYILTKSKIATKVSSFG 365

Query: 97  DT-----------------VEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLR 139
           D                  V   +G  G Y++     L A             TI H+L 
Sbjct: 366 DIGLTLYGPWMKFIILFSLVMTQLGFSGAYVVFTAKNLLAFVENVFYWPGV--TIVHLLA 423

Query: 140 IFIHSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPS-- 197
           + +         V+F        PLS +R+I+ LS +S +A             F     
Sbjct: 424 LQL---------VVFI-------PLSFIRNIAKLSFSSLVANFLVMGGIVIVIGFTAKHL 467

Query: 198 ------LPAELKGSGIPSSSYVASPSLFRSLSIVSF---ALVCHHNTSFIFHSIRNKSLT 248
                  PAE   +G  S S+    +LF   +I +F    L+    +S        K   
Sbjct: 468 FFDLNCKPAEGIVTGFNSQSW----TLFVGTAIFAFEGIGLIIPIQSSM-------KHPE 516

Query: 249 KFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLT 308
           KF  +  L +  + +  + +   G+  +  +T+  IL N P + + +N+ +  +   +L 
Sbjct: 517 KFPLVMALVIITATVLFVSVATLGYLSYGAETQTVILLNLPQDSILVNLIQFFYSSAILL 576

Query: 309 TLPLELFVLRDVIAVILLENEWIP-------------SIEEKPGMPILTR--KW--HFIV 351
           + PL+LF      A+ ++EN+  P              I+ KP    L    KW  +F+ 
Sbjct: 577 STPLQLFP-----AIAIIENKVFPKFTKIYVKRSDHTKIQYKPNSGKLDWRIKWLKNFVR 631

Query: 352 TTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPL-----PIK 406
           + I+  + ++      +L A   +VG+     + YI PP ++  LR   +P       + 
Sbjct: 632 SLIVSSVVIAAYFGANHLDAFVAIVGSLACIPLVYIYPPMLH--LRSCSKPRFAGEKSVW 689

Query: 407 SKIP---HYFCILFGFTVMIVSSFQTI 430
            K P    Y  ++FG   M+ +S+Q+I
Sbjct: 690 RKWPILLDYVLVVFGAIGMVYTSYQSI 716

>TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.252
           YKL146W
          Length = 523

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 97/439 (22%), Positives = 174/439 (39%), Gaps = 51/439 (11%)

Query: 15  QDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGF 74
           ++ + L        + KS+   A + +  S +G G++  P A  N G   S+V  I+   
Sbjct: 110 EEEQELEPTPPSSQHNKSSTTKAILLLLKSFIGTGVLFLPKAFSNGGYVFSLVSLIICSL 169

Query: 75  IVDWTLRLLITNITLSSKLTYGD-----------------TVEYTMGRKGKYLILCCNGL 117
           I  +   LL+   +  +   YGD                  V   +G    Y +     L
Sbjct: 170 ISYYCFILLLDTKSKLNVNGYGDLGLTLYGSILQKSILLSIVLSQLGFAAAYNVFTATNL 229

Query: 118 FALXXXXXXXXXXXDTIPHVLRIFIHSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTS 177
            +L            TIP                ++  + LFI  PLS  R+I+ LSST+
Sbjct: 230 HSLSTSLITNPPDFITIPFC--------------ILLQTFLFI--PLSFTRNITKLSSTA 273

Query: 178 FLALXXXXXXXXXXXXFGPSLPAELKGSGIPSSSYVASPSLFRSLSI-VSFALVCHHNTS 236
            +A             +    P ++  +  P      +P   +  S+ +  A+  +    
Sbjct: 274 LIADLFIFIGLIYLYYY----PIKIIATKGPDWQ-TMTPFNTKDWSLFIGTAIFTYEGIG 328

Query: 237 FIFHSIRN-KSLTKFTK-LTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVA 294
            +     + KS   F K L  + V I+++F  I G  G+  F       +L NFP +   
Sbjct: 329 LLIPIQESMKSPHHFKKSLILVLVIITLVFITI-GLLGYSAFGSNVDTVLLQNFPQDNPC 387

Query: 295 INIARVCFGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKW--HFIVT 352
            ++ ++ +   +L + PL+LF      A+ +LEN WI S ++  G    + KW  ++  +
Sbjct: 388 TSLVQLLYSLAILLSTPLQLFP-----AIKILEN-WIFS-KDASGKYNHSIKWAKNYFRS 440

Query: 353 TIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHY 412
           TI++  ++   L   +L     LVG+     + Y+ PP ++    Q       K+ +  +
Sbjct: 441 TIVILTSLISYLGANDLNKFVALVGSFACIPLIYVYPPLLHYKATQLDNTFTWKTLLADF 500

Query: 413 FCILFGFTVMIVSSFQTIV 431
             + FG   MI +S QTI+
Sbjct: 501 SLLTFGIITMIYTSLQTII 519

>ZYRO0B09548g Chr2 complement(742965..745121) [2157 bp, 718 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 718

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 92/419 (21%), Positives = 166/419 (39%), Gaps = 30/419 (7%)

Query: 37  AFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYG 96
           AF+ +  S +G G++  P A  N GL  SIV+ +  G    W   +LI    +    ++G
Sbjct: 307 AFLLLLKSFIGTGVLFLPHAFSNGGLFFSIVMLLFFGLYSFWCYYILIRAKEVVGVTSFG 366

Query: 97  DTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRIFIHS--HFVTRNSVIF 154
           D      G   K++IL       L           +     L+ F  +  HF     +++
Sbjct: 367 DIGLRLYGPWVKFIILFSLVFTQLGFSGAYVIFTAEN----LKAFCSNVLHFSENIPILY 422

Query: 155 F--STLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPSLPAELKGSGIPSSSY 212
           F  +   I  PLS +R++S LS  S LA             F     A L+    P+   
Sbjct: 423 FMLAQFAIFIPLSFIRNVSKLSLPSLLANFFVMGGLVIVLFFSLKQLA-LESHMKPAEGV 481

Query: 213 VASPSLFRSLSIVSFALVCHHNTSFIF---HSIRNKSLTKFTKLTHLSVFISVIFCMIMG 269
           V   +  R    +  A+        +     S+R+    KF  +  + +  S +  + +G
Sbjct: 482 VLLFNTNRWTMFIGTAIFAFEGIGLVIPVQDSMRHPE--KFPLVLGMVIITSTVLFITIG 539

Query: 270 YAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELF---------VLRDV 320
             G+  +  K K  IL N P   +++N+ +  +   ++ + PL+LF         V    
Sbjct: 540 SIGYLAYGYKIKTVILLNLPQANISVNLIQFFYSLAIMLSTPLQLFPAIKIIENKVFPKF 599

Query: 321 IAVILLENEWIPSIEEKPGMPILTR--KW--HFIVTTIIVFLTMSVSLLTCNLGALFELV 376
           I + + +++    +E +P    L    KW  +F+ + I+  + +        L     L+
Sbjct: 600 IKIYVKKDDNTTGVEMRPNSGKLNWKVKWLKNFVRSLIVGSVILMAYFGADQLDKFVALI 659

Query: 377 GATTASVMAYILPPYVNLL---LRQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQTIVE 432
           G+     + Y+ PP ++L    L   K      S    Y  I+FG   MI +S+Q++ +
Sbjct: 660 GSFACIPLVYMYPPMLHLRSCSLPNHKGGRINWSAGLDYVLIIFGAISMIYTSYQSVTQ 718

>Kwal_23.2839 s23 (38499..40343) [1845 bp, 614 aa] {ON} YKL146W -
           Hypothetical ORF [contig 246] FULL
          Length = 614

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 104/435 (23%), Positives = 167/435 (38%), Gaps = 37/435 (8%)

Query: 9   DEEFQLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVI 68
           DEE  L D     K        KS+ + A + +  S +G G++  P A  N G   S   
Sbjct: 199 DEETALIDGSRQRKRAAHRQAHKSSTFKAVLLLLKSFVGTGVLFLPRAFHNGGWAFSTGC 258

Query: 69  YIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXX 128
            +  G +  +   LLI   T      YGD      G K +  IL   G   L        
Sbjct: 259 LLACGVVSYYCFLLLINAKTKQKVNGYGDLGASVFGSKMEKAIL---GSIVLSQVGFVAA 315

Query: 129 XXXDTIPHVLRIFIHSHFVTRNSVIFFS--TLFISYPLSLLRDISALSSTSFLALXXXXX 186
               T  + L++F  + F  + S+ F+    L +  PLSL R+I+ LS T+ +A      
Sbjct: 316 YSVFTATN-LQVFFANVFKFKASMAFWLLIQLPVYLPLSLTRNIAKLSGTALIADAFILF 374

Query: 187 XXXXXXXFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSF---ALVCHHNTSFIFHSIR 243
                  +      +    G+ S S +    LF       F   A+  +     +     
Sbjct: 375 GLLYVYYYCSHYVVD---HGVASDSML----LFNKNDWTLFIGTAIFTYEGIGLLIPIQE 427

Query: 244 N-KSLTKFTKL---THLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIAR 299
           + K   KF+K       SV ++ I C ++ Y+    F    K  IL NFP +       +
Sbjct: 428 SMKHPEKFSKCLFGVMASVSVAFIVCGLLCYSA---FGDSVKIVILLNFPRDSAMTATVQ 484

Query: 300 VCFGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKW---HFIVTTIIV 356
           + +   +L + PL+LF +     + +LE    P        P +  KW   +F V   IV
Sbjct: 485 LLYALAILLSTPLQLFPI-----IRILETSIFPKDASGKYNPRV--KWMKNYFRVA--IV 535

Query: 357 FLTMSVSLLTCN-LGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCI 415
            L M ++ L  N L     LVG+     + YI PP ++     +     + + +      
Sbjct: 536 LLNMLIAWLGANDLDKFVSLVGSFACIPLIYIYPPMLHYKTFAQGGASKL-ALLGDQLIA 594

Query: 416 LFGFTVMIVSSFQTI 430
            FG  VMI +++Q +
Sbjct: 595 FFGVAVMIYTTYQAV 609

>Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/327 (20%), Positives = 129/327 (39%), Gaps = 43/327 (13%)

Query: 143 HSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPSLPAEL 202
           H  F+ R   I    +F+  PL   + +++L   S +A+            F     +EL
Sbjct: 128 HHMFLDRRLCISLVMMFVIAPLCFKKSLNSLRHASMIAIVSVAYLCGLII-FHFLYRSEL 186

Query: 203 KGSGI----PSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSV 258
           +   +    P      S S   +L I  FA  CHHN   + +   +KS     ++  L++
Sbjct: 187 ERGQVYFMTPHQD-AQSHSPLTTLPIFVFAYTCHHNMFSVINEQADKSFKILRRIPILAI 245

Query: 259 FISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLR 318
            ++ +  +++G  G+  F     GNI+  + PN +   I R+     +    PL+    R
Sbjct: 246 SLAYVLYVVIGGTGYMTFGDNIVGNIITLY-PNSIYTTIGRLAMLLLVTLAFPLQCHPCR 304

Query: 319 DVIAVILL----------------------------ENEWIPSIEEKPGMPILTRKWHFI 350
             I  +++                            + E      E+  +PI + +   +
Sbjct: 305 SSIKNMIVFIKNLRKDKTDDSTAGFIPLDDLSSEDPQEEVAQQNNEQSNLPIESSRQTNV 364

Query: 351 VTTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILPPYVNLLL-----RQEKEPLPI 405
           +T  I+  +  +++   +L  +  +VGAT ++ +++ILP      L         + +P 
Sbjct: 365 ITLCILIFSYLLAISITSLAKVLAIVGATGSTSISFILPGLFGYKLIGSEFTNSNDRVPT 424

Query: 406 KSKIPHYFCIL---FGFTVMIVSSFQT 429
           + K+  Y  +L   +G  VM+ S F T
Sbjct: 425 RVKLFKYLGLLLFIWGIAVMVASLFAT 451

>Kwal_26.8401 s26 complement(767440..769602) [2163 bp, 720 aa] {ON}
           YNL101W - Hypothetical ORF [contig 60] FULL
          Length = 720

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 100/445 (22%), Positives = 170/445 (38%), Gaps = 85/445 (19%)

Query: 37  AFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYG 96
           AF+ M  S +G G++  P A  N GL  S+++ I  G    W   +L  +   +   ++G
Sbjct: 308 AFLLMIKSFIGTGVLFLPGAFSNGGLVFSLIMLIFFGTYSFWCYYILTQSKVATRVASFG 367

Query: 97  DT-----------------VEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLR 139
           D                  V   +G  G Y++     L A             TI H+L 
Sbjct: 368 DIGLTLYGPWMKFIILLSLVMTQLGFSGAYVVFTAKNLLAFVNNVFYWPGV--TIVHLLA 425

Query: 140 IFIHSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPS-- 197
           + +         VIF        PLS +R+I+ LS +S +A             F     
Sbjct: 426 LQL---------VIFI-------PLSFIRNIAKLSLSSLVANFLVMGGIVIVIGFTAKHL 469

Query: 198 ------LPAELKGSGIPSSSYVASPSLFRSLSIVSF---ALVCHHNTSFIFHSIRNKSLT 248
                  PAE    G  SS +    +L+   +I +F    L+     S        K   
Sbjct: 470 FFDLNFKPAEDIVMGFNSSRW----TLYVGTAIFAFEGIGLIIPIQGSM-------KHPE 518

Query: 249 KFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLT 308
           KF  +  L +  + +  + +G  G+  +  KT+  IL N P   + +N+ +  +   +L 
Sbjct: 519 KFPLVLALVIISATVLFVTVGTLGYLSYGAKTETVILLNLPQGNILVNLIQFFYSSAILL 578

Query: 309 TLPLELFVLRDVIAVILLENEWIP-------------SIEEKPGMPILTR--KW--HFIV 351
           + PL+LF      A+ ++EN+  P              +  KP    L    KW  +F+ 
Sbjct: 579 STPLQLFP-----AIAIIENKVFPKFTKIYVKRSDHTKVHYKPNSGKLDWRVKWLKNFVR 633

Query: 352 TTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQE---KEPLPIKSK 408
           + I+  + ++      +L     +VG+     + YI PP ++L        +    I  K
Sbjct: 634 SLIVSLVVIAAYFGADHLDTFVSIVGSFACIPLVYIYPPMLHLESCSRPACQNETSIWKK 693

Query: 409 IP---HYFCILFGFTVMIVSSFQTI 430
            P    Y  I+FG   M+ +S+Q+I
Sbjct: 694 WPMAVDYVLIIFGAIGMVYTSYQSI 718

>TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {ON}
           Anc_2.295 YIL088C
          Length = 473

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 60/128 (46%)

Query: 221 SLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKT 280
           + +I+ FA     N   I + +   S+   + + + S+ IS I  + +G  G+  F   T
Sbjct: 193 TFNIIIFAFTGAMNLFSIINELEENSMKNISHVINYSIGISTILFLSVGITGYLTFGSNT 252

Query: 281 KGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGM 340
            GNI+ N+ PN V  N+   C G  ++ + PL    LRD +  I++  ++  S  ++   
Sbjct: 253 VGNIMLNYDPNSVWTNVGNFCLGAMVILSFPLLFHPLRDAVNNIIVYYQYYKSNNDQDSG 312

Query: 341 PILTRKWH 348
            I+   + 
Sbjct: 313 VIVGNNYD 320

>Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON}
           YIL088C (REAL)
          Length = 491

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 54/102 (52%)

Query: 217 SLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIF 276
            L  + SI+ FA     N   + + +++ S+   T + + S+ +S I  +I+G +G+  F
Sbjct: 189 GLLSTFSIIIFAYTGSMNLFPMINELKDNSMENITLVINNSITLSTILFLIVGLSGYLTF 248

Query: 277 TGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLR 318
             KT GN++ N+ PN + I I + C G  ++ + PL    LR
Sbjct: 249 GNKTSGNLMLNYDPNSIWIVIGKFCLGSMLILSFPLLFQPLR 290

>Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON}
           (42445..43845) [1401 nt, 467 aa]
          Length = 466

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 93/218 (42%), Gaps = 16/218 (7%)

Query: 132 DTIPHVLRIFI-HSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXX 190
           D +P VL  F  H   + RN  I    LFI  PL  L+++++L   S LA+         
Sbjct: 104 DVLPQVLSTFTNHEWLLNRNVNITLVMLFIVTPLCFLKNLNSLRYASMLAISSVAYLCAL 163

Query: 191 XXXFGPSLPAE----LKGS---GIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIR 243
                  +P +     KG    G+P +      +   +L I  FA  CHHN   + +   
Sbjct: 164 VLIHF-IMPNDETHNFKGDVSWGLPKNGL----NPLTTLPIYVFAYTCHHNMFSVINEQM 218

Query: 244 NKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFG 303
           + +     K+  +S+ ++    +++G AG+  F     GNI+  +P N ++  I R+   
Sbjct: 219 DPTYNSVKKIAIISMILAGFLYILIGGAGYLTFGDHITGNIITLYPQN-ISTTIGRIAII 277

Query: 304 FNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMP 341
           F +    PL+    R  I  I+  + + P+ + K   P
Sbjct: 278 FLVTLAFPLQCHPARASINHII--HYFKPAQDNKNSNP 313

>ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 467

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 69/155 (44%), Gaps = 6/155 (3%)

Query: 163 PLSLLRDISALSSTSF-----LALXXXXXXXXXXXXFGPSLPAELKGSGIPSSSYVASPS 217
           PL LL+ + +L  +S      LA             +      E++G  I   S      
Sbjct: 130 PLCLLKKLDSLKYSSIIGLFALAYLSLLILSTFVYEYSSGRYEEVRGD-ISWWSVYDYKG 188

Query: 218 LFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFT 277
           L  + SI+ FA     N   I + +RN ++T  T + + S+ I+ +F + +  AG+  F 
Sbjct: 189 LMSTFSIIIFAYTGSMNLFSIVNELRNNTMTNITAVVNRSIAIATVFFIAVALAGYLTFG 248

Query: 278 GKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPL 312
             T GNI+ N+    + ++I + C G  ++ T PL
Sbjct: 249 SNTLGNIMLNYDDTSIYVHIGKFCLGSMVVLTFPL 283

>Kpol_1029.6 s1029 (11352..13655) [2304 bp, 767 aa] {ON}
           (11352..13655) [2304 nt, 768 aa]
          Length = 767

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 94/428 (21%), Positives = 169/428 (39%), Gaps = 51/428 (11%)

Query: 37  AFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYG 96
           AF  +  S +G GI+  P A  N GL  SI + +  G    W   +LI +  ++   ++G
Sbjct: 356 AFFLLLKSFIGTGILFLPRAFDNGGLIFSICMLLFFGIYSYWCYYILIRSKNITQVTSFG 415

Query: 97  DTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPH-VLRIFIHSHFVTRNSVIFF 155
           D      GR  K++IL    L  L             +   V  +F    F  +  +IF 
Sbjct: 416 DIGYKLYGRWMKFVILFSLVLTQLGFAGAYVIFTAKNLKAFVENVFRVPDFDLKYLMIF- 474

Query: 156 STLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPS--------LPAELKGSGI 207
             LFI  PLS +R++S LS  S +A             F            P E    G 
Sbjct: 475 -QLFIFTPLSYVRNVSKLSFPSLVANFFIMSGLAIVIVFTMKHLFYDLNMRPEEGVIYGF 533

Query: 208 PSSSYVASPSLFRSLSIVSF---ALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIF 264
            S+ +    +LF   +I +F    L+     S        K    F  +  L +  + + 
Sbjct: 534 NSNGW----TLFIGTAIFAFEGIGLIIPIQDSM-------KHPEHFPLVLGLVIMTATVL 582

Query: 265 CMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVI 324
            + +   G+  +    +  IL N P + + +N+ ++ +   ++ + PL+LF      A+ 
Sbjct: 583 FVTIATIGYLAYGKLIETVILLNLPKSNIFVNLIQLFYSMAIMLSTPLQLFP-----AIK 637

Query: 325 LLENEWIPS----------------IEEKPGMPILTRKW--HFIVTTIIVFLTMSVSLLT 366
           ++EN+  P                 + +  G      KW  +F+ + I++ + +      
Sbjct: 638 IIENKVFPKFTKYYVKIDQTREGVRLRQNSGKLDWRVKWRKNFLRSVIVLIVILMAYYGY 697

Query: 367 CNLGALFELVGATTASVMAYILPPYVNLLLRQ--EKEPLPIKSK-IPHYFCILFGFTVMI 423
            +L     ++G+     + Y+ PP ++L        E L IK + I  Y  I FG   M+
Sbjct: 698 DDLDRFVSIIGSFACIPLVYMYPPMLHLRSYSIPSSEGLKIKYRVILDYILIAFGGVSML 757

Query: 424 VSSFQTIV 431
            +S+Q+++
Sbjct: 758 YTSYQSLM 765

>Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 65/134 (48%), Gaps = 9/134 (6%)

Query: 218 LFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFT 277
           L  + SI+ FA     N   + + +++ S+   T + + S+ +S    +I+G +G+  F 
Sbjct: 190 LLSTFSIIIFAYTGSMNLFPMINELKDNSMENITSVINNSISLSTALFLIVGLSGYLTFG 249

Query: 278 GKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVILLENEWI------ 331
            KT GN++ N+ P  + I I + C G  ++ + PL    LR  +  +++   WI      
Sbjct: 250 NKTLGNLILNYDPTSIWIVIGKFCLGLMLILSFPLLFQPLRIAVNNVII---WIEITFGD 306

Query: 332 PSIEEKPGMPILTR 345
            + EE P +   TR
Sbjct: 307 ANPEEDPQVSEYTR 320

>TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {ON}
           Anc_7.420 YER119C
          Length = 454

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 77/333 (23%), Positives = 133/333 (39%), Gaps = 61/333 (18%)

Query: 132 DTIPHVLRIFIHSHFV-TRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXX 190
           D  P +  +F  +H +  RN  I    LFI  PL  L+ +S+L   S +AL         
Sbjct: 104 DLTPQIASVFTSNHLLLDRNVHITLIMLFIVSPLCFLKRLSSLRYASLIALLSVAYLCVL 163

Query: 191 XXXF--GPSLP-AELKGS---GIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRN 244
                  PS    +LKG     IP      +P    +L I  FA  CHHN   + +  ++
Sbjct: 164 IFIHFVWPSEEIHDLKGHVSLWIPHDE--TNP--LTTLPIFVFAYTCHHNMFSVINEQKD 219

Query: 245 KSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGF 304
            S     K+   ++F+++   +++G  G+  F     GNI+  + P   +  + R+    
Sbjct: 220 TSFRHIKKVAIYAMFLALSLYLLIGGMGYLTFGDHIIGNIIKLY-PQFASTTVGRIAIVL 278

Query: 305 NMLTTLPLELFVLRDVIAVILL--------------------------------ENEWI- 331
            ++   PL+    R  I  IL                                 + E++ 
Sbjct: 279 LVMLAFPLQCHPARASINHILFYLQEHLSQSKQNTRTDNTANAVDEASTLIVNGDQEYMI 338

Query: 332 ------PSIEEKPGMPILTRKWHFIVTTIIVFLTMSVSLLTCNLGAL---FELVGATTAS 382
                  S  + P +P+  RK  F++ TI  FL ++  LL  ++ +L     +VG+T ++
Sbjct: 339 DELIEEDSANQPPVVPLHGRK--FVIITI--FLLLASYLLAISVSSLARVLAVVGSTGST 394

Query: 383 VMAYILPPYVNLLL---RQEKEPLPIKSKIPHY 412
            +++ILP      L     +   LP K+K+  Y
Sbjct: 395 SISFILPGIFGYQLIGSEVDSGSLPFKTKLFKY 427

>Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 105/248 (42%), Gaps = 41/248 (16%)

Query: 221 SLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKT 280
           +L I  FA  CHHN   + +   +K      ++  +++ ++ +  +I+G AG+  F    
Sbjct: 208 TLPIFVFAYTCHHNMFSVINEQADKGFRILKRIPIIAISLAFVLYVIIGGAGYMTFGKNI 267

Query: 281 KGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIA--VILLEN---------- 328
            GNIL  + PN V+  I R+     ++   PL+    R  I   +I +EN          
Sbjct: 268 VGNILTLY-PNSVSTTIGRLAMLLLVMLAFPLQCHPCRSSIKNIIIFIENFRKGKLQENR 326

Query: 329 -EWIP---------------SIEEKPGMPILTRKWHFIVTTIIVFLTMSVSLLTCNLGAL 372
            + IP                  E+   P  + +   I+T  I+  +  +++   +L  +
Sbjct: 327 DDCIPLDVLSSVNSQEESRQQNNEQQNFPSESSRHTNIITLCILGSSYLLAISITSLAKV 386

Query: 373 FELVGATTASVMAYILPPYVNLLL-------RQEKEPLPIKSKIPHYFCIL---FGFTVM 422
             +VGAT ++ +++ILP      L       R E+ P  +  KI  Y  +L   +G  VM
Sbjct: 387 LAIVGATGSTSISFILPGLFGYKLIGSEYISRDERVPASV--KILKYLGLLLFIWGIVVM 444

Query: 423 IVSSFQTI 430
           I S   T+
Sbjct: 445 IASLSATV 452

>Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 89/430 (20%), Positives = 172/430 (40%), Gaps = 57/430 (13%)

Query: 32  SNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSS 91
           ++I    + + ++  GAGI+  P A K  GL   +V+ ++ G      ++ L+    ++ 
Sbjct: 3   TSIRSGVLTLLHTACGAGILAMPYAFKPFGLVPGVVMIVICG---ACAMQSLLIQARVAR 59

Query: 92  KLTYGDTVEYTMGR----KGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRIFI-HSHF 146
            +  G     T+ R    +   +      +              D +P ++  +  ++  
Sbjct: 60  YVAPGKASFSTLTRLINPRLSIVFDLAIAVKCFGVGVSYMIVVGDLMPQIMSSWTGNAWL 119

Query: 147 VTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPSLPAE----L 202
           ++RN  I    LF   PLS L+ +++L   S +A+                +P++    L
Sbjct: 120 LSRNVQISLIMLFFVAPLSFLKKLNSLRYASMVAISSVAYLCVLVLVHY-VVPSDEILRL 178

Query: 203 KGSG---IPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVF 259
           KG      P  S+    +   +L I  FA  CHHN   I +  ++       K+  +S+ 
Sbjct: 179 KGRVSYLFPQQSH--DLNFLNTLPIFVFAYTCHHNMFSIINEQKSVRFEHVMKIPLISIS 236

Query: 260 ISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRD 319
           +++   + +G AG+  F     GNI+  + P  V+  + R+     ++   PL+    R 
Sbjct: 237 LALALYIAIGCAGYLTFGDNIIGNIIMLY-PQTVSSTVGRIAIVLLVMLAFPLQCHPARA 295

Query: 320 VIAVIL-------------------LENEWIP-----------SIEEKP-----GMPILT 344
            I  IL                   + NE  P            IEE+P       P L 
Sbjct: 296 SIHQILQYFTEENATTSTTSVAGRTVTNESSPLIRNNSIDINEVIEEEPIYQPKDTP-LR 354

Query: 345 RKWHFIVTTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILPPY--VNLLLRQEKEP 402
            K   I+T  I+  +  V++   +L  +  +VGAT ++ +++ILP      L+  + K  
Sbjct: 355 GKSFIIITCGILVASYCVAISVSSLAHVLAIVGATGSTSISFILPGLFGYKLIGTEHKAD 414

Query: 403 LPIKSKIPHY 412
           +P+ +++  Y
Sbjct: 415 IPLPTRLFKY 424

>YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}
           AVT7Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 490

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 66/135 (48%), Gaps = 9/135 (6%)

Query: 217 SLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIF 276
            L  + SI+ FA     N   + + +++ S+   T + + S+ +S    +I+G +G+  F
Sbjct: 189 GLLSTFSIIIFAFTGSMNLFPMINELKDNSMENITFVINNSISLSTALFLIVGLSGYLTF 248

Query: 277 TGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVILLENEWI----- 331
             +T GN++ N+ PN + I I + C G  ++ + PL    LR  +  +++   WI     
Sbjct: 249 GNETLGNLMLNYDPNSIWIVIGKFCLGSMLILSFPLLFHPLRIAVNNVII---WIEITYG 305

Query: 332 -PSIEEKPGMPILTR 345
             + EE P +   TR
Sbjct: 306 GANPEEDPQVSEYTR 320

>KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.295
           YIL088C
          Length = 474

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 53/105 (50%)

Query: 214 ASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGF 273
           +   L  + SI+ FA V   N   I + + + ++T  +K+ + S+ IS +  + +G  G+
Sbjct: 188 SGKGLLSTFSIIIFAYVGAMNLFTIINELSDNNITNISKIINRSIAISTVAFLSVGITGY 247

Query: 274 FIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLR 318
             F   T GNI+ N+ PN + +NI +      +L + PL    LR
Sbjct: 248 LTFGSNTLGNIILNYDPNSIWVNIGKFSLASMLLLSFPLLFHPLR 292

>Kpol_1032.88 s1032 complement(188477..190204) [1728 bp, 575 aa]
           {ON} complement(188477..190204) [1728 nt, 576 aa]
          Length = 575

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 95/413 (23%), Positives = 174/413 (42%), Gaps = 26/413 (6%)

Query: 27  ENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITN 86
           + +KK +   A + +  S +G GI+  P    N G   S +  ++   I  +   LLI+ 
Sbjct: 175 DKSKKVSTTKAILLLLKSFVGTGILFLPKGFSNGGYSFSTISLLLCSVISYYCFVLLIST 234

Query: 87  ITLSSKLT-YGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRIFIHSH 145
              +  +  YGD  ++  GR  K+ IL    L  +                 L+   +S 
Sbjct: 235 KDTTHGINGYGDLGQHLFGRPMKFAILLSIVLSQIGFSAAYTVFVATN----LKTLCNSV 290

Query: 146 FVTRNS-----VIFFSTLFISYPLSLLRDISALSSTSFLA---LXXXXXXXXXXXXFGPS 197
           F   +S     +IF + LFI  PLS  R+I+ L++T+ +A   +               S
Sbjct: 291 FENLDSSIKFFIIFQAILFI--PLSFTRNITKLTATALIADFFILIGLLYIYYYPISYIS 348

Query: 198 LPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLS 257
                +G+ +P ++   S SLF   +I +F  +       I  S+    L + + L+ + 
Sbjct: 349 YNGIARGTMVPFNN--KSWSLFIGTAIFTFEGIGLLIP--IQESMAKPHLFRLS-LSLVM 403

Query: 258 VFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVL 317
           V +++IF  + G   +  F    +  +L NFP +     I ++ +   +L + PL+LF  
Sbjct: 404 VIVTLIFVSV-GLLCYSAFGSDVETVVLLNFPQDSPYTLIVQLLYSLAILLSTPLQLFP- 461

Query: 318 RDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMSVSLLTCNLGALFELVG 377
               A+ +LEN    S       P +    ++  T +++  +    +   +L     LVG
Sbjct: 462 ----AIRILENWVFKSRYSGKYNPKIKWAKNYFRTLVVIGTSFIAWIGADDLDKFVSLVG 517

Query: 378 ATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQTI 430
           +     + YI PP +++   +    +     I     I+FGFT++I +S QTI
Sbjct: 518 SFACIPLIYIYPPLLHIKALKRNGTVTNLHLIVDSCMIIFGFTILIYTSCQTI 570

>Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 123/301 (40%), Gaps = 48/301 (15%)

Query: 132 DTIPHVLRIFIHSHFV-TRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXX 190
           D +P ++ ++ ++ ++ +RN  I    LF   PL  L+ +++L   S +A+         
Sbjct: 104 DLMPQIMSVWTNNAWLLSRNVQISLIMLFFVTPLCFLKKLNSLRYASMIAISSVAYLCAL 163

Query: 191 XXX--FGPSLPA-ELKGSGIPSSSYVASP-----SLFRSLSIVSFALVCHHNTSFIFHSI 242
                  PS     L+G      SY   P     ++  +L I  FA  CHHN   I +  
Sbjct: 164 VLVHYIAPSEDILRLRGQ----ISYFFPPQSHDLNVLNTLPIFVFAYTCHHNMFSIINEQ 219

Query: 243 RNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCF 302
           R+       K+  ++V +++I  + +G  G+  F     GNI+  +P   V+  + R+  
Sbjct: 220 RSSRFEHIMKIPLIAVSLALILYIAIGCTGYLTFGDNIIGNIIMLYPQT-VSSTVGRIAI 278

Query: 303 GFNMLTTLPLELFVLRDVIAVIL--LENEWIPS--------------------------- 333
              ++   PL+    R  I  IL  LE E I +                           
Sbjct: 279 VLLVMLAFPLQCHPARASIHQILQHLERENITTSTTSVSGPTFANENSPLMGDRGLDINE 338

Query: 334 -IEE----KPGMPILTRKWHFIVTTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYIL 388
            IEE    +P    L  K    +T  I+  +  V++   +L  +  +VGAT ++ +++IL
Sbjct: 339 VIEEESIYQPKETSLKGKSFVFITCGILLASYLVAISVSSLARVLAIVGATGSTSISFIL 398

Query: 389 P 389
           P
Sbjct: 399 P 399

>Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/253 (20%), Positives = 103/253 (40%), Gaps = 37/253 (14%)

Query: 214 ASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGF 273
           +S S   +L I  FA  CHHN   + +   +K+     ++   ++  + I  +I+G AG+
Sbjct: 201 SSHSPLTTLPIFVFAYTCHHNMFSVINEQTDKTFRILRRIPIFAISFAYILYLIIGGAGY 260

Query: 274 FIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVILL------- 326
             F     GNIL  + PN ++  I R+     ++   PL+    R  I  I +       
Sbjct: 261 MTFGENIVGNILTLY-PNSISTTIGRLAMLLLVMLAFPLQCHPCRSSIKNIFIFIEDFRK 319

Query: 327 ---------------------ENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMSVSLL 365
                                 +E      E P +   +++   ++T  ++  +  +++ 
Sbjct: 320 GRLHDNRTGFIPLDDFNSEEPHDELSQQSSEGPTLRSESQRHTNVITLCVLVFSYILAIS 379

Query: 366 TCNLGALFELVGATTASVMAYILPPYVNLLL-----RQEKEPLPIKSKIPHYFCI---LF 417
             +L  +  +VGAT ++ +++ILP      L         E +P+  KI  Y  +   ++
Sbjct: 380 ITSLAKVLAIVGATGSTSISFILPGLFGYKLIGSEFTNRNERVPVSIKIFKYLGLSLFIW 439

Query: 418 GFTVMIVSSFQTI 430
           G  +MI S   T+
Sbjct: 440 GLVIMIASLSATV 452

>Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 64/134 (47%), Gaps = 9/134 (6%)

Query: 218 LFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFT 277
           L  + SI+ FA     N   + + +++ S+   T + + S+ +S    +I+G +G+  F 
Sbjct: 190 LLSTFSIIIFAYTGSMNLFPMINELKDNSMGNITLVINNSISLSTALFLIVGLSGYLTFG 249

Query: 278 GKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVILLENEWI------ 331
             T GN++ N+ PN V I I + C G  ++ + PL    LR  +  +++   WI      
Sbjct: 250 NSTLGNLILNYDPNSVWIIIGKFCLGSMLILSFPLLFQPLRVAVNNVII---WIEITFGN 306

Query: 332 PSIEEKPGMPILTR 345
              EE P +   TR
Sbjct: 307 ADPEEDPQVSEYTR 320

>Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa]
           {ON} complement(104836..106248) [1413 nt, 471 aa]
          Length = 470

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/278 (21%), Positives = 107/278 (38%), Gaps = 65/278 (23%)

Query: 217 SLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIF 276
            L  + SI+ FA     N   I + + N S+   TK+ + S+ IS    +++G +G+  F
Sbjct: 192 GLCSTFSIIIFAFTGAMNLFSIINELENNSIRNITKVINRSIGISTFLFLLVGISGYLTF 251

Query: 277 TGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLR------------------ 318
              T GNI+ N+ P+     I + C G  ++ + PL    LR                  
Sbjct: 252 GSNTLGNIMLNYDPDSKWCYIGKFCLGSMIVLSFPLLFHPLRIAVNNMVIFYQINYGSNK 311

Query: 319 -------------------------------DVIAVILLENEWIPSIEEKPGM----PIL 343
                                          D +  +LL NE +  IEE   +    P  
Sbjct: 312 ENTSPNIRSNTSDLSPISLTINDDDIRSMPDDNVDDVLLSNE-VTEIEELDNVLCETPFP 370

Query: 344 TRKWHFIVTTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPL 403
             +++  ++ +++ +  SVSL   +   +  +VGAT  + +++ILP      L    + L
Sbjct: 371 NHRFY-TISLLLLLVMYSVSLTVTSFAYVLAIVGATGGTSISFILPGIFGYKLIGS-DSL 428

Query: 404 PIKSKIPH---------YFCILFGFTVMIVSSFQTIVE 432
            I   I            +  LFGF+VM  S +   ++
Sbjct: 429 AIGQMISDSDKFYKKCSLYLALFGFSVMFFSLYLIFID 466

>SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} similar
           to uniprot|P40501 Saccharomyces cerevisiae YIL088C AVT7
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 472

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 75/170 (44%), Gaps = 8/170 (4%)

Query: 149 RNSVIFFSTLFISYPLSLLRDISALSSTSFL---ALXXXXXXXXXXXXFGPSLPAELK-- 203
           R+  I  S L I  PL LLR + +L  +S L   AL            +G  L  + K  
Sbjct: 118 RDWWILGSALLI-IPLCLLRHLDSLKYSSILGLFALAYLVTLVIGTFVYGVVLHDDYKYT 176

Query: 204 -GSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISV 262
            G       Y  +  L  + SI+ FA  C  N   I + + + S++  TK+ + S+ I+ 
Sbjct: 177 RGDVFWVKVYDYN-GLISTFSIIIFAYTCTMNIFSIINELTDNSVSNVTKVANSSIGIAT 235

Query: 263 IFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPL 312
              + +G  G+  F     GNI+ N+ P+ +   + + C G  ++ + PL
Sbjct: 236 FLILSVGITGYLTFGSNVLGNIILNYDPDSIWTRVGKFCLGCMVVLSFPL 285

>KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 460

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 76/168 (45%), Gaps = 9/168 (5%)

Query: 148 TRNSVIFFSTLFISYPLSLLRDISALSSTS---FLALXXXXXXXXXXXXFGPSLPAELKG 204
           TR + I  S + I  PLSLLR   +L  TS    LAL            FG     ++  
Sbjct: 116 TRTNWILLSAIII-VPLSLLRHFDSLKYTSVIGLLALGYIGLLIIGSYSFGNYPKPKVDW 174

Query: 205 SGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIF 264
             I   S V +     + SI+ FA     N   I + ++  S+T   K+ + S+ +S   
Sbjct: 175 FSISDRSGVLT-----TFSIIVFAFTGSMNLFSIINELKENSMTNIKKIINNSIVVSSAC 229

Query: 265 CMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPL 312
            +I+G  G+  F  +T GN++ N+  + +++  AR   G  ++ + PL
Sbjct: 230 FIILGLFGYLTFGKETLGNVILNYDADKLSVRFARFNLGLMVVLSFPL 277

>Skud_11.81 Chr11 (157889..160027) [2139 bp, 712 aa] {ON} YKL146W
           (REAL)
          Length = 712

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 99/428 (23%), Positives = 167/428 (39%), Gaps = 36/428 (8%)

Query: 17  SEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIV 76
           S  LV    + +  KS+   A + +  S +G G++  P A  N G   S +  +    + 
Sbjct: 302 STQLVPREHERHPHKSSTVKAVLLLLKSFVGTGVLFLPRAFHNGGWGFSALCLLSCALVS 361

Query: 77  DWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPH 136
                 LI+         YGD      G K K+ IL    L  +             +  
Sbjct: 362 YGCFVSLISTKDKVGVDGYGDMGRILYGPKMKFAILLSIALSQIGFSAAYTVFTATNLQV 421

Query: 137 VLRIFIHSHFVTRNSVIF-FSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFG 195
               F H    + N   + F+ + I  PLSL R+I+ LS T+ +A               
Sbjct: 422 FFENFFHLKPGSINLATYIFAQVLIFVPLSLTRNIAKLSGTALIADLFILLGLVYVYV-- 479

Query: 196 PSLPAELKGSGIPSSSYV----ASPSLFRSLSIVSFA----LVCHHNTSFIFHSIRNKSL 247
                 +  +GI S + +    A  SLF   +I +F     L+       I  S+R+ + 
Sbjct: 480 -YSIYYISVNGIASDTMLMFNKADWSLFIGTAIFTFEGIGLLIP------IQESMRHPNH 532

Query: 248 TKFTKLTHLSVFISVIF--CMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFN 305
            +   L+ +   ++V+F  C ++ YA F       K  +L NFP N       ++ +   
Sbjct: 533 FR-PSLSAVMCIVAVVFISCGLLCYAAF---GADVKTVVLLNFPQNSSYTLTVQLLYALA 588

Query: 306 MLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMSVSLL 365
           +L + PL+LF      A+ +LEN   PS       P +    ++    I++  ++   + 
Sbjct: 589 ILLSTPLQLFP-----AIRILENWTFPSNASGKHNPKVKWLKNYFRCAIVLLTSILAWVG 643

Query: 366 TCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSK---IPHYFCILFGFTVM 422
             +L     LVG+     + YI PP    LL  +   +   S+   +     I FG  VM
Sbjct: 644 ANDLDKFVSLVGSFACVPLIYIYPP----LLHFKASSISGTSRGRLLLDLIVISFGVAVM 699

Query: 423 IVSSFQTI 430
           + +S+QTI
Sbjct: 700 VYTSWQTI 707

>Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W
           (REAL)
          Length = 680

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 100/432 (23%), Positives = 171/432 (39%), Gaps = 44/432 (10%)

Query: 17  SEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIV 76
           S  L+    + +  KS+   A + +  S +G G++  P A  N G   S +  +    + 
Sbjct: 270 STQLISREHERHPHKSSTVKAVLLLLKSFVGTGVLFLPKAFHNGGWGFSAICLLSCALVS 329

Query: 77  DWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPH 136
                 LIT         YGD      G K K+ IL    L  +                
Sbjct: 330 YGCFVSLITTKDKVGVDGYGDMGRILYGPKMKFAILLSIALSQIGFSAAYTVFTATN--- 386

Query: 137 VLRIFIHSHFVTRNSVI-----FFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXX 191
            L++F  + F  +   I      F+ + I  PLSL R+I+ LS T+ +A           
Sbjct: 387 -LQVFCENFFHLKPGSISLATYIFAQVLIFVPLSLTRNIAKLSGTALIADLFILLGLVYV 445

Query: 192 XXFGPSLPAELKGSGIPSSSYV----ASPSLFRSLSIVSFA----LVCHHNTSFIFHSIR 243
             +     A    +GI S + +    A  SLF   +I +F     L+       I  S++
Sbjct: 446 YVYSIYYIAV---NGIASDTMLMFNKADWSLFIGTAIFTFEGIGLLIP------IQESMK 496

Query: 244 NKSLTKFTKLTHLSVFISVIF--CMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVC 301
           + +  +   L+ +   ++V+F  C ++ YA F       K  +L NFP +       ++ 
Sbjct: 497 HPNHFR-PSLSAVMCIVAVVFISCGLLCYAAF---GSDVKTVVLLNFPQDTSYTLTVQLL 552

Query: 302 FGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMS 361
           +   +L + PL+LF      A+ +LEN   PS       P +    ++    I+V  ++ 
Sbjct: 553 YALAILLSTPLQLFP-----AIRILENWTFPSNASGKHNPKVKWLKNYFRCAIVVLTSVL 607

Query: 362 VSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSK---IPHYFCILFG 418
             +   +L     LVG+     + YI PP    LL  +   +   S+   +     I+FG
Sbjct: 608 AWVGANDLDKFVSLVGSFACIPLIYIYPP----LLHYKASSISGTSRARLLLDLIVIVFG 663

Query: 419 FTVMIVSSFQTI 430
             VM+ +S+QTI
Sbjct: 664 VAVMVYTSWQTI 675

>Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088C -
           Hypothetical ORF [contig 27] FULL
          Length = 471

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 67/308 (21%), Positives = 125/308 (40%), Gaps = 29/308 (9%)

Query: 25  IDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLL- 83
           ++ N   +  + + +N+  +I+GAG++  P A ++ G+   IV+ ++      + L +L 
Sbjct: 1   MNTNTGTATAFFSTINLVKTIVGAGMLAIPYAFRSDGVLVGIVLTLIAALTSGFGLFVLA 60

Query: 84  -----ITNITLSSKLTYGDTVEYTMGRKGKY-LILCCNGLFALXXXXXXXXXXXDTIPHV 137
                +TN   SS  T       ++     + + + C G+              D  P +
Sbjct: 61  KCSKTLTNPRASSFFTLCSITYPSLSLVFDFSMFIQCYGV-----GLSYLVLIGDLFPGI 115

Query: 138 LRIFIHSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXX-------XX 190
           +         +RN  I  S L I  PLSL++ + +L  +S L L                
Sbjct: 116 VG-------GSRNMWIMASALII-VPLSLVKKLDSLKYSSILGLFAIAYLVCLIVGAFLR 167

Query: 191 XXXFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKF 250
              F  +  A ++G  +          L  + +IV FA     N   I + +++ S+T  
Sbjct: 168 DVVFTDNYTA-IRGD-VSWIRVYDFKGLISTFTIVIFAYTGSMNMFSIINELKDNSMTNI 225

Query: 251 TKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTL 310
            K+   ++ IS    + +G  G+  F   T GNI+ N+ PN       ++C G  ++ + 
Sbjct: 226 NKVVSTTITISSFLFLAVGLCGYLTFGSNTLGNIMLNYDPNSAWTTTGKLCLGSMVILSF 285

Query: 311 PLELFVLR 318
           PL L   R
Sbjct: 286 PLLLHPCR 293

>SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]
           {ON} similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 510

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 61/302 (20%), Positives = 111/302 (36%), Gaps = 30/302 (9%)

Query: 37  AFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYG 96
             V + ++  GAGI+  P A K  GL    ++ ++ G              + +  L  G
Sbjct: 50  GIVTLLHTACGAGILAMPYAFKAYGLLPGFLVLVLCGVF------------STTGLLLQG 97

Query: 97  DTVEYTMGRKGKYLILC-------------CNGLFALXXXXXXXXXXXDTIPHVLRIFI- 142
              +Y   R+  +  L                 +  L           D +P +   F  
Sbjct: 98  QVSKYVPRRQASFFSLAQITYPQLSIIFDLAIAVKCLGVGVSYMVVIGDLLPQIFSNFTS 157

Query: 143 HSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXX---FGPSLP 199
           H   + RN  I    +FI  PL  ++ + +L   S +A+               F     
Sbjct: 158 HEILLERNFHITVVMIFIVAPLCFMKRLDSLRYASMIAISAVGYLCVLVVAHFLFPSQEI 217

Query: 200 AELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVF 259
            +LKG+           S+  S  I  FA  CHHNT  I + +++ S+    K+   ++ 
Sbjct: 218 KDLKGTVSLFRPKGLHTSMLSSFPIFVFAYTCHHNTFSIVNELKDNSVENVRKVVIGAMG 277

Query: 260 ISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRD 319
           ++V   + +G +G+  F     GNI+  + P+  +  + R+     ++   PL+    R 
Sbjct: 278 LAVCLYIAIGGSGYGTFGDNIGGNIIMLY-PHSTSTTVGRIAIVLLVMLAFPLQCHPARA 336

Query: 320 VI 321
            I
Sbjct: 337 SI 338

>TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {ON}
           Anc_2.295 YIL088C
          Length = 467

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 59/125 (47%), Gaps = 2/125 (1%)

Query: 217 SLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIF 276
            L  + SI+ FA     N   I + ++  S+   T + + S+ IS    + +G  G+  F
Sbjct: 189 GLLSTFSIIVFAYTGSMNLFSIINELKENSMANITSVINTSITISTAVFLAVGICGYLTF 248

Query: 277 TGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEE 336
              T GNI+ N+ P+   + + ++C G  ++ + PL     R  I  +++ +E     ++
Sbjct: 249 GSNTLGNIMLNYDPDSTWVYVGKLCLGSMVMLSFPLLFHPCRIAINNLVVWSEI--HFKK 306

Query: 337 KPGMP 341
            P MP
Sbjct: 307 DPIMP 311

>KLLA0E13795g Chr5 complement(1216938..1218659) [1722 bp, 573 aa]
           {ON} similar to uniprot|P36062 Saccharomyces cerevisiae
           YKL146W AVT3 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 573

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 92/396 (23%), Positives = 162/396 (40%), Gaps = 30/396 (7%)

Query: 44  SILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTM 103
           S +G G++  P A  N G   S +  +    +  +   LLI   T      YG+      
Sbjct: 196 SFVGTGVLFLPRAFHNGGWLFSTLCLLFCATVSFYCFILLIDTKTAVGVDGYGELGSRLF 255

Query: 104 GRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRIFIHSHFVTRNSVIFFSTLFISY- 162
           G K K+ +L       L            T  ++   F H  F    S+IF+  + +++ 
Sbjct: 256 GPKLKFTVLSS---IVLSQIGFAAAYTVFTATNLQAFFKHV-FSLEYSLIFWIMIQLAFY 311

Query: 163 -PLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPSLPAELKGSGIPSSSYVASPSLFRS 221
            PLSL R+I+ LS+T   AL                    +   GI S S V+      +
Sbjct: 312 LPLSLTRNIARLSAT---ALVADLFILLGLVYVYYYSSFYIWNHGIASDSMVSFNKSDWT 368

Query: 222 LSIVSFALVCHHNTSFIF--HSIRNKSLTKFTKLTHLSVFISVIF--CMIMGYAGFFIFT 277
           L I + A+  +     +   H    K       L ++ + +++IF  C ++ Y+ F    
Sbjct: 369 LFIGT-AIFTYEGIGLLIPIHESMEKPAHFKPALMYVILVVTIIFISCGLICYSAF---G 424

Query: 278 GKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVILLENE-WIPSIEE 336
            K +  IL NFP N +  N  ++ +   +L + PL+LF      A+ +LEN+ +  +   
Sbjct: 425 AKVETVILLNFPSNSIFTNAVQLIYALAILLSTPLQLFP-----AIKILENKIFHKNASG 479

Query: 337 KPGMPILTRKWHFIVTTIIVFLTMSVSLLTCN-LGALFELVGATTASVMAYILPPYVNLL 395
           K    +  RK +F     +V + + ++ +  N L     L+G+     + YI PP  +  
Sbjct: 480 KFDAKVKWRKNYF--RAFVVLIAVIIAWIGANDLDKFVSLIGSFACIPLIYIYPPLFHYK 537

Query: 396 LRQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQTIV 431
           + +  + L    +      ++FG  VM  +S+QTI 
Sbjct: 538 VFENNKKL----QAIDLAILIFGALVMSYTSWQTIA 569

>YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative
           transporter, member of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 459

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 68/322 (21%), Positives = 127/322 (39%), Gaps = 41/322 (12%)

Query: 143 HSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPSLPAEL 202
           H  F+ R   I    +F+  PL   R +++L   S +A+               +     
Sbjct: 128 HHMFLDRRLYITLIIVFVISPLCFKRSLNSLRYASMIAIVSVAYLSGLIIYHFVNRHQLE 187

Query: 203 KGS---GIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVF 259
           +G     +P      S S   +L I  FA  CHHN   + +   +KS     ++   ++ 
Sbjct: 188 RGQVYFMVPHGD-SQSHSPLTTLPIFVFAYTCHHNMFSVINEQVDKSFKVIRRIPIFAIV 246

Query: 260 ISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRD 319
           ++    +I+G  G+  F     GNIL  + PN ++  I R+     ++   PL+    R 
Sbjct: 247 LAYFLYIIIGGTGYMTFGENIVGNILTLY-PNSISTTIGRLAMLLLVMLAFPLQCHPCRS 305

Query: 320 VIA--VILLEN-----------EWIP---------------SIEEKPGMPILTRKWHFIV 351
            +   +I +EN            +IP                  E+P +   + +   I+
Sbjct: 306 SVKNIIIFIENFRKGKLYDNRASFIPLDNFNSEDPQEAPTQQNNEEPNLRSESLRHINII 365

Query: 352 TTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEK-----EPLPIK 406
           T  I+  +  +++   +L  +  +VGAT ++ +++ILP      L   +     E +P  
Sbjct: 366 TLCILLFSYLLAISITSLAKVLAIVGATGSTSISFILPGLFGYKLIGSEFTGTNERVPTS 425

Query: 407 SKIPHYFCI---LFGFTVMIVS 425
            KI  Y  +   ++G  VM+ S
Sbjct: 426 IKIFKYLSLSLFIWGIAVMVAS 447

>TPHA0B02980 Chr2 (679253..681502) [2250 bp, 749 aa] {ON} Anc_2.177
           YNL101W
          Length = 749

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 93/434 (21%), Positives = 174/434 (40%), Gaps = 35/434 (8%)

Query: 22  KEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLR 81
           K +I     K+    AF+ +  S +G GI+  P A    GL  SI + +  G    W   
Sbjct: 329 KPMIQTAKGKTPTTKAFLLLLKSFIGTGILFLPNAFSKGGLLFSIGMLLFFGLYSYWCYF 388

Query: 82  LLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTI-PHVLRI 140
           +LI +  ++   ++GD      GR  K +ILC   L  +             +   ++ +
Sbjct: 389 ILIRSKQITKVSSFGDIGLILYGRWMKTIILCSLVLTQIGFSAAYVIFCAKNLRAFIINV 448

Query: 141 FIHSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFG-PSLP 199
           F    F     +IF   +FI  PLS +R++S LS TS +A             F    L 
Sbjct: 449 FNFPDFNISYLMIFQLIVFI--PLSFVRNVSKLSLTSLMANFMIMGGLLIVLFFCIKHLF 506

Query: 200 AELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRN-KSLTKFTKLTHLSV 258
            +L+        Y  +P L+     +  A+        I     + K    F  +  L +
Sbjct: 507 IDLQMKPEAGVIYGFNPDLWSVF--IGTAIFAFEGIGLIIPVQDSMKHPEHFPFVLFLVI 564

Query: 259 FISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLR 318
             + +  +++G  G+  +    +  IL N   + V +N+ ++ +   +L + PL+LF   
Sbjct: 565 LTATVLFILIGTIGYLAYGKYIETVILMNLSQSNVFVNLVQLFYSVAILLSTPLQLFP-- 622

Query: 319 DVIAVILLENEWIPSIE----------EKPGMPILTRKWHF-IVTTIIVFLTMSVSLLTC 367
              A+ ++EN    S               G      KW    + +IIV   + ++ L  
Sbjct: 623 ---AIKIIENRMFTSFRSTDNGSSQFLSNSGKLNWRIKWRKNCLRSIIVSCVILIAYLGY 679

Query: 368 -NLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTV----- 421
            NL     L+G+     + Y+ PP ++L    +   +P   +    F ++F F++     
Sbjct: 680 NNLDKFVSLIGSFACIPLVYMYPPMLHL----KSYSIPSLKQHKFNFTVIFDFSLIVLGG 735

Query: 422 --MIVSSFQTIVEA 433
             M+ +S+++I+++
Sbjct: 736 ISMLYTSYRSIMDS 749

>YKL146W Chr11 (171783..173861) [2079 bp, 692 aa] {ON}  AVT3Vacuolar
           transporter, exports large neutral amino acids from the
           vacuole; member of a family of seven S. cerevisiae genes
           (AVT1-7) related to vesicular GABA-glycine transporters
          Length = 692

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 103/431 (23%), Positives = 168/431 (38%), Gaps = 42/431 (9%)

Query: 17  SEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIV 76
           S  LV      +  KS+   A + +  S +G G++  P A  N G   S +  +    I 
Sbjct: 282 STQLVSREHGRHPHKSSTVKAVLLLLKSFVGTGVLFLPKAFHNGGWGFSALCLLSCALIS 341

Query: 77  DWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPH 136
                 LIT         YGD      G K K+ IL    L  +                
Sbjct: 342 YGCFVSLITTKDKVGVDGYGDMGRILYGPKMKFAILSSIALSQIGFSAAYTVFTATN--- 398

Query: 137 VLRIFIHSHFVTRNSVI-----FFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXX 191
            L++F  + F  +   I      F+ + I  PLSL R+I+ LS T+ +A           
Sbjct: 399 -LQVFSENFFHLKPGSISLATYIFAQVLIFVPLSLTRNIAKLSGTALIADLFILLGLVYV 457

Query: 192 XXFGPSLPAELKGSGIPSSSYV----ASPSLFRSLSIVSF---ALVCHHNTSFIFHSIRN 244
             +     A    +G+ S + +    A  SLF   +I +F    L+       I  S+++
Sbjct: 458 YVYSIYYIAV---NGVASDTMLMFNKADWSLFIGTAIFTFEGIGLLIP-----IQESMKH 509

Query: 245 KSLTKFTKLTHLSVFISVIF--CMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCF 302
               +   L+ +   ++VIF  C ++ YA F       K  +L NFP +       ++ +
Sbjct: 510 PKHFR-PSLSAVMCIVAVIFISCGLLCYAAF---GSDVKTVVLLNFPQDTSYTLTVQLLY 565

Query: 303 GFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMSV 362
              +L + PL+LF      A+ +LEN   PS       P +    ++    I+V  ++  
Sbjct: 566 ALAILLSTPLQLFP-----AIRILENWTFPSNASGKYNPKVKWLKNYFRCAIVVLTSILA 620

Query: 363 SLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSK---IPHYFCILFGF 419
            +   +L     LVG+     + YI PP    LL  +   L   S+   +     I+FG 
Sbjct: 621 WVGANDLDKFVSLVGSFACIPLIYIYPP----LLHYKASILSGTSRARLLLDLIVIVFGV 676

Query: 420 TVMIVSSFQTI 430
            VM  +S+QTI
Sbjct: 677 AVMAYTSWQTI 687

>NCAS0F02310 Chr6 complement(458165..460171) [2007 bp, 668 aa] {ON}
           Anc_5.252 YKL146W
          Length = 668

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 103/430 (23%), Positives = 172/430 (40%), Gaps = 50/430 (11%)

Query: 27  ENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITN 86
           +N  KS+ + A + +  S +G G++  P A  N G   S +       I       LI  
Sbjct: 266 KNKHKSSTFRAILLLLKSFVGTGVLFLPKAFHNGGYGFSSLSLFFCALISYGCFLTLIQT 325

Query: 87  ITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRIFIHSHF 146
                   YGD  +   G+K K+ IL    L  +                 L++F  + F
Sbjct: 326 KDKVKVDGYGDMGQIIYGKKMKFAILWSIVLSQIGFSAAYTVFTATN----LQVFCENVF 381

Query: 147 VTRNSVIFFSTL--------FISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPSL 198
            + +S    S+L         +  PLSL R+I+ LS T+ +A             +  S 
Sbjct: 382 FSSSSPSSSSSLAPYILLQQLVFVPLSLTRNIAKLSGTALIADLFILLGLVYVYFYSTSY 441

Query: 199 PAELKGSGIPSSSYV----ASPSLFRSLSIVSFALV-----CHHNTSFIFHSIRNKSLTK 249
              +  +GI S + +    +  SLF   +I +F  +        + S   H         
Sbjct: 442 ---IIKNGISSKTMLWLNKSDWSLFIGTAIFTFEGIGLLIPIQESMSHPQH--------- 489

Query: 250 FTK-LTHLSVFISVIF--CMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNM 306
           F+K L+ +   ++VIF  C ++ Y+ F     K +  +L NFP +     + ++ +   +
Sbjct: 490 FSKCLSMVMCIVTVIFISCGLLCYSAF---GSKVETVVLLNFPHDSPYTLMVQLLYALAI 546

Query: 307 LTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKW-HFIVTTIIVFLTMSVSLL 365
           L + PL+LF      A+ +LEN   P        P +  KW       IIV LT  ++ +
Sbjct: 547 LLSTPLQLFP-----AIKILENWCFPISASGKNNPKV--KWLKNYFRCIIVLLTAFIAYV 599

Query: 366 TCN-LGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTVMIV 424
             N L     LVG+     + YI PP ++L     ++   I   +     ++FG  VM  
Sbjct: 600 GANDLDKFVSLVGSFACIPLIYIYPPLLHLKAYWGEQ--TILRMVLDSLVLIFGVAVMGY 657

Query: 425 SSFQTIVEAL 434
           +S+QTI   L
Sbjct: 658 TSWQTIAMWL 667

>Ecym_8249 Chr8 (510061..511944) [1884 bp, 627 aa] {ON} similar to
           Ashbya gossypii ACR051C
          Length = 627

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 99/446 (22%), Positives = 176/446 (39%), Gaps = 42/446 (9%)

Query: 10  EEFQLQDSEALVKEIIDENNK----------KSNIYMAFVNMANSILGAGIITQPLAVKN 59
           E   L D E  +   ++E +           K++++   + +  + +G G++  P   +N
Sbjct: 202 ESVLLSDEEEPLLGTVEERSSSATRSGGRKGKASVFKTVLLLLKAFVGTGVLFMPKGFQN 261

Query: 60  AGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFA 119
            G   S    I  G +  +   LLI   T +    YGD      G+  +  IL    L  
Sbjct: 262 GGWLFSCGCLIFFGVVSCFCFLLLIEAKTEACVNGYGDLGRVAYGKSMQRGILASIVLSQ 321

Query: 120 LXXXXXXXXXXXDTIPHVL-RIFIHSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSF 178
           +             +      +F  SH   R SV  F  L +  PL+L R IS LS T+ 
Sbjct: 322 IGFSAAYTIFTATNLQVFFGEVFGWSH---RLSVYIFLQLVVYLPLALTRRISRLSGTAL 378

Query: 179 LALXXXXXXXXXXXXFGPSLPAELKGSGIPSSSY----VASPSLFRSLSIVSF---ALVC 231
            A             +G S    L+  G+ S S         +LF   +I ++    L+ 
Sbjct: 379 AA--DVLILFGLVYVYGYSAVYVLR-YGVASQSMKMFNRQDWTLFVGTAIFTYEGIGLLV 435

Query: 232 HHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPN 291
               S +    R  S   +      S+FIS   C ++ Y+ F     + +  IL NFP +
Sbjct: 436 PIQES-MSRPGRFASCLVWVIAAVTSIFIS---CGLLCYSAF---GSRVETVILLNFPKD 488

Query: 292 GVAINIARVCFGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPIL--TRKWHF 349
            V  +  +  +   ++ + PL+LF      A+ +LE+  I S       P +   + W  
Sbjct: 489 SVLSSSVQFLYAMAIMLSTPLQLFP-----AIRILEHGIISSSVSGKHDPRVKWAKNWFR 543

Query: 350 IVTTIIVFLTMSVSLLTC-NLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSK 408
           +   ++VF+T+S++ +   +L     L+G+     + YI PP ++ +L +    +   + 
Sbjct: 544 V---LVVFVTVSIAWVGADDLDKFVSLIGSFACVPLIYIYPPLLHYMLFKGTGRVSNAAL 600

Query: 409 IPHYFCILFGFTVMIVSSFQTIVEAL 434
                 + FG   M  +S QT+ + L
Sbjct: 601 FLDQLVVWFGVIGMFYTSSQTVKQWL 626

>TPHA0B02530 Chr2 (580212..582002) [1791 bp, 596 aa] {ON} Anc_5.252
           YKL146W
          Length = 596

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 98/417 (23%), Positives = 170/417 (40%), Gaps = 33/417 (7%)

Query: 27  ENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLI-T 85
           +NNKK++ + A + +  S +G GI+  P    N G   S +  ++   +  +   LLI T
Sbjct: 195 DNNKKASTFKAILLLLKSFVGTGILFLPKGFSNGGYTFSTISLLVCSLLSYYCFILLIST 254

Query: 86  NITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRIFI--H 143
              +     YGD   +  G+  K  IL    L  +             +  + +     +
Sbjct: 255 KDQMKGINGYGDLGNHLYGKNMKLAILLSIVLSQIGFSAAYTVFVATNLKTLCQNLFSNN 314

Query: 144 SHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPSLPAELK 203
            HF     +IF + LFI  PLS  R+I+ L++T   AL                    + 
Sbjct: 315 QHFSIVLFIIFQTLLFI--PLSFTRNITKLTAT---ALVADLFIFIGVIYIYYYPITYII 369

Query: 204 GSGIPSSSYV----ASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTK----FTKLTH 255
            +GI + + V     + SLF   +I +F  +       +   I+ +S+ K    F  LT 
Sbjct: 370 KNGIATETIVPFNNKNWSLFIGTAIFTFEGIG------LLIPIQ-ESMAKPHQFFISLTL 422

Query: 256 LSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELF 315
           + V ++VIF  + G   +  F    +  +L NFP +       ++ +   +L + PL+LF
Sbjct: 423 VMVIVTVIFISV-GLLCYCAFGSSVETVVLLNFPQDSPYTLTVQLLYCLAILLSTPLQLF 481

Query: 316 VLRDVIAVILLENEWIPSIEEKPGMPILTRKW--HFIVTTIIVFLTMSVSLLTCNLGALF 373
                 A+ +LEN W+   ++  G      KW  ++  + I++  T        +L    
Sbjct: 482 P-----AIRILEN-WVFK-KKGSGKYNPKIKWAKNYFRSLIVIGTTCIAWSGANDLDKFV 534

Query: 374 ELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQTI 430
            LVG+     + YI PP ++    +      +         ILFG  +M  +SFQTI
Sbjct: 535 SLVGSFACIPLIYIYPPLLHYKACKINGSANLVQNYLDIILILFGVILMSYTSFQTI 591

>Smik_14.224 Chr14 (414661..416808) [2148 bp, 715 aa] {ON} YNL101W
           (REAL)
          Length = 715

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 92/421 (21%), Positives = 164/421 (38%), Gaps = 41/421 (9%)

Query: 38  FVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGD 97
           F+ +  S +G G++  P A  N GL  S+ +    G    W   +L+         ++GD
Sbjct: 305 FLILLKSFIGTGVLFLPNAFHNGGLFFSVSMLAFFGLYSYWCYYILVQAKASCGVSSFGD 364

Query: 98  TVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRIFIHSHFVTRNSVIFFST 157
                 G   + +IL    +  +             +   L    H+  +  + ++ F T
Sbjct: 365 IGLKLYGPWMRIIILFSLVITQVGFSGAYMIFTAKNLQAFLDNVFHAGVLPLSFLMIFQT 424

Query: 158 LFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXF-GPSLPAELKGSGIPSSSYVASP 216
           + I  PLS +R+IS LS  S LA             F    L  +LK S  P+   V   
Sbjct: 425 I-IFIPLSFIRNISKLSLPSLLANFFIMAGLVIVIIFTAKRLFFDLKAS--PAMGVVYGL 481

Query: 217 SLFRSLSIVSFALVCHHNTSFIF---HSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGF 273
           ++ R    +  A+        I     S+RN    KF  +  L +  + I  + +   G+
Sbjct: 482 NMDRWTLFIGTAIFAFEGIGLIIPVQDSMRNPE--KFPLVLALVILTATILFISIATLGY 539

Query: 274 FIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVILLENEWIPS 333
             +    +  IL N P + + +N+ ++ +   ++ + PL+LF      A+ ++EN++ P 
Sbjct: 540 LAYGSNVQTVILLNLPQSNIFVNLIQLFYSIAIMLSTPLQLFP-----AIKIIENKFFPK 594

Query: 334 --------------IEEKPGMPILTR--KW--HFIVTTIIVFLTMSVSLLTCNLGALFEL 375
                         +E +P    L    KW  +FI + I++ +       + NL     +
Sbjct: 595 FTKIYVKHDDLTTRVELRPNSGKLDWRVKWLKNFIRSIIVIIVVAIAYFGSDNLDKFVSV 654

Query: 376 VGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHY------FCILFGFTVMIVSSFQT 429
           +G+     + YI P    L LR    P   K K   +        I FG   M+ +S+Q+
Sbjct: 655 IGSLACIPLVYIYPSM--LHLRGNSLP-ETKGKFWRFKPMLDIILIFFGIASMLYTSYQS 711

Query: 430 I 430
           I
Sbjct: 712 I 712

>KAFR0H03660 Chr8 (698211..700151) [1941 bp, 646 aa] {ON} Anc_5.252
           YKL146W
          Length = 646

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 94/414 (22%), Positives = 167/414 (40%), Gaps = 35/414 (8%)

Query: 31  KSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLS 90
           K++ + A + +  S +G G++  P A  N G   S +  +M   +  +   LLI      
Sbjct: 252 KTSTFKAVLLLLKSFVGTGVLFLPKAFSNGGWGFSSLCLLMCAVLSYYCFILLIITKDKV 311

Query: 91  SKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRIFIHSHFVTRN 150
               YGD  E   G K K  IL    L  +                 L++F        +
Sbjct: 312 GVAGYGDMGEVLYGSKMKLAILASIALSQIGFSAAYTVFTATN----LQVFCQGALNLPD 367

Query: 151 S-------VIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPSLPAELK 203
                   ++  + +FI  PLSL R+I+ LS T+ LA             +     A+  
Sbjct: 368 GSLGLGIFIVLQALIFI--PLSLTRNIAKLSVTALLADLFILLGLIYVYYYAIYYVAK-- 423

Query: 204 GSGIPSSSYV----ASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKF-TKLTHLSV 258
            + I +++ V    +  SLF   +I +F  +       I  S+R+    KF + L  +  
Sbjct: 424 -NSIATATMVWFNNSDWSLFIGTAIFTFEGIGLLIP--IQESMRHPE--KFQSSLFGVMC 478

Query: 259 FISVIF--CMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFV 316
            +SV+F  C ++ Y+ F       +  +L NFP +     + ++ +   +L + PL+LF 
Sbjct: 479 IVSVVFISCGLLCYSAF---GSNVQTVVLLNFPQDSPYTLLVQLFYSMAILLSTPLQLFP 535

Query: 317 LRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMSVSLLTCNLGALFELV 376
                A+ +LE+   PS       P +  + ++    I+V  ++   +   NL     LV
Sbjct: 536 -----AIRILEHWTFPSNASGKYNPKIKWRKNYFRCIIVVLTSVLAWVGASNLDKFVSLV 590

Query: 377 GATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQTI 430
           G+     + YI PP ++    ++ +     S I     + FG  VM  +S QT+
Sbjct: 591 GSLACIPLIYIHPPLLHFKAFKDDQDTRYWSLICDILLLAFGVGVMTYTSVQTL 644

>AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER119C
           (AVT6) and YBL089W (AVT5)
          Length = 440

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 63/270 (23%), Positives = 113/270 (41%), Gaps = 33/270 (12%)

Query: 149 RNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFG--PSLPAE-LKGS 205
           RN  I F T  +  PL  +R + +L   S +A+                PS   E L+G 
Sbjct: 122 RNVQITFWTAAVIAPLCCMRHLHSLKYASMVAVAAVAYLGALVAARAAWPSPELERLRGP 181

Query: 206 ---GIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISV 262
              G+P  +  +  ++  S  I  FA  CHHN   I + +R+ SL    ++   ++ ++V
Sbjct: 182 VSLGLPPGT--SGGAMLSSFPIFVFAYTCHHNMFSIVNELRDNSLGACLRVVVAAIALAV 239

Query: 263 IFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVI- 321
                +G AG+  F     GNI+  +PP   A  + R      ++   PL+    R  I 
Sbjct: 240 ALYATIGGAGYLTFGDHITGNIIAQYPP-APATTLGRAAIAVLVMLAFPLQCHPARASIN 298

Query: 322 ----------------AVILLENEWIPS-IEEKPG-----MPILTRKWHFIVTTIIVFLT 359
                           A  L+     P+   E PG     +P+   ++   +T  ++  +
Sbjct: 299 HIWHYCIPSHTVAPSEASALIRGGSPPADAAEGPGNEPAAVPLGPPRF-AAITAALLIAS 357

Query: 360 MSVSLLTCNLGALFELVGATTASVMAYILP 389
            +V++   +L  +  +VGAT ++ +++ILP
Sbjct: 358 YAVAVSVTSLARVLAVVGATGSTAISFILP 387

>CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119c or uniprot|P38176 Saccharomyces cerevisiae
           YBL089w or uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 460

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 116/295 (39%), Gaps = 56/295 (18%)

Query: 146 FVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPSLPA---EL 202
            + R+  I    +F+  PL L + +++L  TS LA+               S      ++
Sbjct: 120 LLNRDFHITLVMIFVVTPLCLKKRLNSLRHTSSLAIMSVAYLCVLVIIHLVSSDGDIEQM 179

Query: 203 KGS---GIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVF 259
           KG    G+P       PS   +L I  FA  CHHN   + +  ++        +  +S  
Sbjct: 180 KGHVSIGLPHHG----PSPLTTLPIFVFAYTCHHNMFSVINEQKDNRFKTTKYIPLISTS 235

Query: 260 ISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRD 319
           ++ I  +++G  G+  F  K  GNI+  + P+ V+  I R+     +    PL+    R 
Sbjct: 236 LACILYILIGGCGYMTFGDKIVGNIITLY-PHSVSSIIGRIAIALLVTLAFPLQCHPARS 294

Query: 320 VIAVI-----------------------------LLENEWIP------SIE-----EKPG 339
            I  I                             LL  E  P      SIE     E+ G
Sbjct: 295 SIHNILAFFYPSLNPDLKNTQEPTANADTMSSSQLLATERTPLVRSISSIEDNELAEEQG 354

Query: 340 ----MPI-LTRKWHFIVTTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILP 389
               +PI + RK    +T  I+  +  V++   +L  +  +VGAT ++ +++ILP
Sbjct: 355 SIKDVPIEMERKLFLAITAAILIPSYLVAMSVHSLDKVLAIVGATGSTSISFILP 409

>NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420
          Length = 495

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 79/176 (44%), Gaps = 17/176 (9%)

Query: 159 FISYPLSLLRDISALSSTSFLALXXXX---XXXXXXXXFGPSLPAELKGS---GIPSSSY 212
           F++ PL LL+++++L   S +A+               F      +LKG      P +  
Sbjct: 136 FVAGPLCLLKNLNSLRYASMVAISAVAYLCILVLVHFIFPSQEIKDLKGDFAVWFPHNE- 194

Query: 213 VASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSV---FISVIFCMIMG 269
             SP    +L I  FA  CHHN   +F  I  +  T+F  +  +++    ++++  +++G
Sbjct: 195 -GSP--LSTLPIFVFAYTCHHN---VFAVINEQKKTRFAHVKVIAIIAMLLALVLYVLIG 248

Query: 270 YAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVIL 325
            AG+F F     GNI+  + P+ +   I RV   F +    PL+    R  I  I+
Sbjct: 249 GAGYFTFGNHIVGNIITLY-PHSITSTIGRVAIVFLVTLAFPLQCHPARASIHHII 303

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 46/90 (51%), Gaps = 11/90 (12%)

Query: 333 SIEEKP-----GMPILTRKWHFIVTTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYI 387
           +IEE P       P+  + +  I+T I++    +V++   +L  +  +VGAT ++ +++I
Sbjct: 380 NIEEHPIFNPENTPLEGKTFK-IITLILIACAYTVAISVTSLAHVLAIVGATGSTSISFI 438

Query: 388 LPPYVNLLL-----RQEKEPLPIKSKIPHY 412
           LP      L      +  E +P+K+KI  Y
Sbjct: 439 LPGLFGFTLIGSEYTEADEEIPLKTKIFKY 468

>NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {ON}
           Anc_5.252
          Length = 721

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 93/415 (22%), Positives = 162/415 (39%), Gaps = 32/415 (7%)

Query: 31  KSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLS 90
           KS+ + A + +  S +G G++  P A  N G   S +  ++   I  W    LI      
Sbjct: 319 KSSTFKAILLLLKSFVGTGVLFLPKAFHNGGWAFSSLCLLLCAIISYWCFLTLIVTKDKI 378

Query: 91  SKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRIFIHSHFV--- 147
               YGD  E   G   K  IL    L  +                 L++F+ +  V   
Sbjct: 379 HVDGYGDMGERLYGHPMKLAILWSIVLSQIGFSAAYTVFTATN----LKVFVENVLVRTA 434

Query: 148 ----TRNSVIFFSTL--FISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPSLPAE 201
               T  +++++  L   I  PLSL R I+ LS T+ +A                     
Sbjct: 435 TMNPTGYNLVWYIILQQLIFIPLSLTRKIAKLSGTALIADLFILLGLIYVYY---YSSYY 491

Query: 202 LKGSGIPSSSYV----ASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLS 257
           +  +GI S S +    A  SLF   +I +F  +       I  S++N  +  F K   L 
Sbjct: 492 ILSNGIASESMLWLNKADWSLFIGTAIFTFEGIGLLIP--IQESMQNPQV--FPKCLSLV 547

Query: 258 VFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVL 317
           + I  I  +  G   +  F  K +  +L NFP +     + ++ +   +L + PL+LF  
Sbjct: 548 MCIVTIIFISCGLICYSAFGEKVETVVLLNFPQDSAFTLMVQLLYSLAILLSTPLQLFP- 606

Query: 318 RDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMSVSLLTCNLGALFELVG 377
               A+ +LEN   P          +  K ++    +++F  M   +   +L     LVG
Sbjct: 607 ----AIKILENWTFPIHASGKHNSRIKWKKNYFRCIMVIFTAMVAWVGANDLDKFVSLVG 662

Query: 378 ATTASVMAYILPPYVNL--LLRQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQTI 430
           +     + YI PP ++    L    + +  +  +      +FG  +M+ +S++TI
Sbjct: 663 SFACIPLIYIYPPLLHFKAFLNDTSKTMRFRLGL-DMLVFVFGIIIMVYTSWETI 716

>NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295
          Length = 496

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 48/102 (47%)

Query: 217 SLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIF 276
            L  + SI+ FA     N   +   + + S+     + + S+ IS    +++G +G+  F
Sbjct: 191 GLLSTFSIIIFAYTGAMNLFSMIRELEDISMQNIKNVINGSIIISTGLFLLVGISGYLTF 250

Query: 277 TGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLR 318
               +GNI+ N+ PN   I I + C G  ++ + PL    LR
Sbjct: 251 GSNVEGNIILNYNPNSNWIYIGKFCLGTMLILSFPLLFHPLR 292

>Suva_14.238 Chr14 (431876..434026) [2151 bp, 716 aa] {ON} YNL101W
           (REAL)
          Length = 716

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 94/433 (21%), Positives = 167/433 (38%), Gaps = 65/433 (15%)

Query: 38  FVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGD 97
           F+ +  S +G G++  P A  N GL  S+ +    G    W   +L+   +     ++GD
Sbjct: 306 FLILLKSFIGTGVLFLPNAFHNGGLFFSVSMLTFFGIYSYWCYYILVQAKSSCGVSSFGD 365

Query: 98  T-----------------VEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRI 140
                             V   +G  G Y+I     L A            + + HV  +
Sbjct: 366 IGLKLYGPWMKIIILFSLVITQVGFSGAYMIFTAKNLQAFL----------ENVFHVGAL 415

Query: 141 FIHSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXF-GPSLP 199
            + S+ +   +VIF        PLS +R+IS LS  S LA             F    L 
Sbjct: 416 PL-SYLMAFQTVIFI-------PLSFIRNISKLSLPSLLANFFIMAGLIIVIIFTAKRLF 467

Query: 200 AELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRN-KSLTKFTKLTHLSV 258
            +LK   +P+   V   +  R    +  A+        I     + K   KF  +  L +
Sbjct: 468 FDLKA--VPAMGVVYGLNSDRWTLFIGTAIFAFEGIGLIIPVQDSMKHPEKFPLVLGLVI 525

Query: 259 FISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLR 318
             + +  + +   G+  +    K  IL N P + + +N+ ++ +   ++ + PL+LF   
Sbjct: 526 LTATVLFISIATLGYLAYGSDVKTAILLNLPQSNIFVNLIQLFYSIAIMLSTPLQLFP-- 583

Query: 319 DVIAVILLENEWIPS--------------IEEKPGMPILTR--KW--HFIVTTIIVFLTM 360
              A+ ++EN++ P               +E +P    L    KW  +FI + I++ +  
Sbjct: 584 ---AIKIIENKFFPKFTKIYVKHDDLTTRVELRPNSGKLDWKVKWLKNFIRSIIVIIVVS 640

Query: 361 SVSLLTCNLGALFELVGATTASVMAYILPPYVNLL---LRQEKEPLPIKSKIPHYFCILF 417
                + NL     ++G+     + YI P  ++L    L + K        I     ILF
Sbjct: 641 IAYFGSDNLDKFVSVIGSLACIPLVYIYPSMLHLRGNSLPETKGEFWKFKPILDTILILF 700

Query: 418 GFTVMIVSSFQTI 430
           G T M+ +S+Q+I
Sbjct: 701 GITSMLYTSYQSI 713

>Skud_14.229 Chr14 (425174..427315) [2142 bp, 713 aa] {ON} YNL101W
           (REAL)
          Length = 713

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 90/435 (20%), Positives = 167/435 (38%), Gaps = 69/435 (15%)

Query: 38  FVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGD 97
           F+ +  S +G G++  P A  N GL  S+ +    G    W   +L+   +     ++GD
Sbjct: 303 FLILLKSFIGTGVLFLPNAFHNGGLFFSVSMLAFFGVYSYWCYYILVQAKSSCGVSSFGD 362

Query: 98  T-----------------VEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRI 140
                             V   +G  G Y+I     L A            D + HV  +
Sbjct: 363 IGLKLYGPWMRIIILFSLVITQVGFSGAYMIFTAKNLQAFL----------DNVFHV-GV 411

Query: 141 FIHSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXF-GPSLP 199
              S+ +   +++F        PLS +R+IS LS  S LA             F    L 
Sbjct: 412 LPLSYLMVFQTIVFI-------PLSFIRNISKLSLPSLLANFFIMAGLVIVIIFTAKRLF 464

Query: 200 AELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIF---HSIRNKSLTKFTKLTHL 256
            +LK +  P++  +   +  R    +  A+        I     S+RN    KF  +  L
Sbjct: 465 FDLKAT--PAAGVIYGLNTDRWTLFIGTAIFAFEGIGLIIPVQDSMRNPE--KFPLVLGL 520

Query: 257 SVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFV 316
            +  + +  + +   G+  +    +  IL N P + + +N+ ++ +   ++ + PL+LF 
Sbjct: 521 VILTATLLFISIATLGYLAYGSSVRTVILLNLPQSNIFVNLIQLFYSIAIMLSTPLQLFP 580

Query: 317 LRDVIAVILLENEWIPS--------------IEEKPGMPILTR--KW--HFIVTTIIVFL 358
                A+ ++EN++ P               +E +P    L    KW  +FI + I++ +
Sbjct: 581 -----AIKIIENKFFPKFTKIYVKHNDLTTRVELRPNSGKLNWKIKWLKNFIRSIIVIIV 635

Query: 359 TMSVSLLTCNLGALFELVGATTASVMAYILPPYVNLL---LRQEKEPLPIKSKIPHYFCI 415
                  + NL     ++G+     + YI P  ++L    L + K        +     I
Sbjct: 636 VAIAYFGSDNLDKFVSVIGSLACIPLVYIYPSMLHLRGNSLPETKGEFWRFKPVLDSILI 695

Query: 416 LFGFTVMIVSSFQTI 430
            FG   M+ +S+Q+I
Sbjct: 696 FFGIASMLYTSYQSI 710

>TPHA0F01700 Chr6 complement(387868..389202) [1335 bp, 444 aa] {ON}
           Anc_2.177 YNL101W
          Length = 444

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 93/199 (46%), Gaps = 32/199 (16%)

Query: 260 ISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVL-- 317
           +S+IF +I G  G+  +  K K  IL +F P G+ +NI  VCF   +L + PL+LF L  
Sbjct: 250 MSIIFILI-GTCGYLSYGEKIKVIILQSFAP-GIFVNIIIVCFTIGILLSTPLQLFSLTS 307

Query: 318 --------RDVIAV------ILLENEWIPS---IEEKPGMPILTRKWHFIVTTIIVFLTM 360
                   +  IAV      +L E++ + S    E +    I  R +  I+  +IV    
Sbjct: 308 LLEDFLFTKKKIAVADEDLKVLEESDILCSESDTEAQGTKHINLRVYKIILRFLIVTTVC 367

Query: 361 SVSLLTCN-LGALFELVGATTASVMAYILPPYVNL-------LLRQEKEPLPIKSKIPHY 412
            +  +T + L  L  +VG+     + YI PP +NL       +++     LP    +   
Sbjct: 368 LIGYITSDKLNKLVAIVGSLACIPLVYIYPPLLNLYECSLPGIIKNNWSILPF---VFDL 424

Query: 413 FCILFGFTVMIVSSFQTIV 431
           F I+ G   M+ +S+++++
Sbjct: 425 FLIISGLCGMMYTSYRSVI 443

>ZYRO0A10538g Chr1 (852296..854122) [1827 bp, 608 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 608

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 100/440 (22%), Positives = 170/440 (38%), Gaps = 50/440 (11%)

Query: 15  QDSEALVKEII-----DENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIY 69
           +D E+++ E +      +  +K+  + A + +  S +G G++  P A  N G   S    
Sbjct: 192 EDEESVLLERVPTRDSKKQQRKATTFKAILLLLKSFVGTGVLFLPRAFHNGGWAFSTGCL 251

Query: 70  IMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXX 129
           +           LLI          YGD  +   G K ++ IL    L  L         
Sbjct: 252 LFCAIASSLAFVLLIKTKDKVGVSGYGDLGKALYGPKVEFSILFSIALSQLGFSAAYTVF 311

Query: 130 XXDTIPHVLRIFIHSHF------VTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXX 183
                   L++F  + F      V  ++ I    L I  PLSL R+I+ LS T+ +A   
Sbjct: 312 TATN----LKVFFENAFNFPADSVPLSAYIILQAL-IFIPLSLTRNITKLSGTALIA-DL 365

Query: 184 XXXXXXXXXXFGPSLPAELKGSGIPSSSYV----ASPSLFRSLSIVSFALVCHHNTSFIF 239
                     + P+L   +   GI + S +    +  SLF   +I +F  +       + 
Sbjct: 366 FILLGLLYVYYYPAL--YIAKHGIATDSVLFFNRSDWSLFIGTAIFTFEGIG------LL 417

Query: 240 HSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAG---FFIFTGKTKGNILNNFPPNGVAIN 296
             I+ +S+ K         F+  I   I   +G   +  F  K +  +L NFP + +A  
Sbjct: 418 IPIQ-ESMKKPEHFYPSLGFVMSIVTFIFVSSGLLCYLAFGAKVETVVLLNFPQDSIATI 476

Query: 297 IARVCFGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKW--HFIVTTI 354
             ++ +   +L + PL+LF      A+ + E    PS     G      KW  ++  T +
Sbjct: 477 SVQLIYSLAILLSTPLQLFP-----AIRIFETWTFPS--NASGKHNHRVKWLKNYFRTGV 529

Query: 355 IVFLTMSVSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSK---IPH 411
           ++F  +   +   +L     LVG+     + YI PP ++L     K      SK   +  
Sbjct: 530 VIFTALLAWVGANDLDKFVSLVGSFACIPLIYIYPPLLHL-----KSSDTQTSKFIILGD 584

Query: 412 YFCILFGFTVMIVSSFQTIV 431
                FG  VM  +S+Q IV
Sbjct: 585 LLIFFFGVGVMAYTSYQNIV 604

>ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL088C
          Length = 468

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 44/92 (47%)

Query: 221 SLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKT 280
           + SI+ FA     N   I + + + S+    ++ + S+  S    +++G AG+  F    
Sbjct: 192 TFSIIVFAFTGSMNMFSIINELGDNSMRNIQRIVYYSIAASTALFILVGMAGYLTFGSNV 251

Query: 281 KGNILNNFPPNGVAINIARVCFGFNMLTTLPL 312
             N++ NF P+ V+  +  +  G  +L + PL
Sbjct: 252 AQNVILNFDPDAVSTQVGSLALGLMVLLSFPL 283

>KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7
          Length = 468

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 71/179 (39%), Gaps = 12/179 (6%)

Query: 148 TRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPSLP-------- 199
           TR   I  STL  + PLSL++ +  L  +S L L             G  L         
Sbjct: 116 TRRGWIIGSTL-ATVPLSLIKRLDGLKYSSILGLFAVAYLVCLI--LGSFLKDVVLSENY 172

Query: 200 AELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVF 259
            E +G  +          L  + +I+ FA     N   I + +++ S+    K+   S+ 
Sbjct: 173 REFRGD-VSWIGVYDKKGLVSTFTIIVFAFTASMNLFSIINELKDNSMQNINKVITSSIS 231

Query: 260 ISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLR 318
            S    + +G  G+  F     GNI+ N+ P  +   I ++C G  ++ + PL L   R
Sbjct: 232 TSAALFLSVGVCGYLTFGSNVVGNIMLNYDPESIWTTIGKLCLGTMVILSFPLLLHPCR 290

>Suva_11.79 Chr11 (157798..159957) [2160 bp, 719 aa] {ON} YKL146W
           (REAL)
          Length = 719

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 103/427 (24%), Positives = 164/427 (38%), Gaps = 34/427 (7%)

Query: 17  SEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIV 76
           S  LV    D    KS+   A + +  S +G G++  P A  N G   S V  ++   + 
Sbjct: 309 STQLVSRERDRRPHKSSTAKAVLLLLKSFVGTGVLFLPKAFHNGGWGFSGVSLLLCAIVS 368

Query: 77  DWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPH 136
                 LIT         YGD      G K K  IL    L  +             +  
Sbjct: 369 YGCFVSLITTKDKVGVDGYGDMGRVLYGPKMKLAILLSIALSQIGFSAAYTVFTATNLQV 428

Query: 137 VLRIFIHSHFVTRNSVIF-FSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFG 195
               F H    + N   + F+ + I  PLSL R+I+ LS T+ +A             + 
Sbjct: 429 FCEHFFHLKPGSINLATYIFAQVLIFVPLSLTRNIAKLSGTALIADVFILLGLVYVYYYS 488

Query: 196 PSLPAELKGSGIPSSSYV----ASPSLFRSLSIVSF---ALVCHHNTSFIFHSIRNKSLT 248
                 +  +GI S + +    A  SLF   +I +F    L+     S    +    SL+
Sbjct: 489 ---IYHIAVNGIASDTMLMFNKADWSLFIGTAIFTFEGIGLLIPIQESMKHPNHFQPSLS 545

Query: 249 KFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLT 308
               +  + VFIS   C ++ YA    F    K  +L NFP +       ++ +   +L 
Sbjct: 546 AVMCIVAV-VFIS---CGLLCYAA---FGADVKTVVLLNFPQDSSYTLTVQLLYALAILL 598

Query: 309 TLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKW--HFIVTTIIVFLTMSVSLLT 366
           + PL+LF      A+ +LEN   PS       P +  KW  ++    I++  ++   +  
Sbjct: 599 STPLQLFP-----AIRILENWTFPSNASGKHNPKV--KWLKNYFRCAIVLLTSVLAWVGA 651

Query: 367 CNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSK---IPHYFCILFGFTVMI 423
            +L     LVG+     + YI PP    +L  +   L   S+   +     + FG  VM 
Sbjct: 652 NDLDKFVSLVGSFACIPLIYIYPP----MLHYKAFSLSGISRARLLLDLVVLSFGVVVMA 707

Query: 424 VSSFQTI 430
            +S+QTI
Sbjct: 708 YTSWQTI 714

>SAKL0G11462g Chr7 (980180..982030) [1851 bp, 616 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 616

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 92/415 (22%), Positives = 154/415 (37%), Gaps = 29/415 (6%)

Query: 26  DENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLIT 85
           +    K+ ++   + +  S +G G++  P    N G   S V  +    +  W   LLI 
Sbjct: 218 ERPQHKATVFKTIILLIKSFVGTGVLFLPKGFHNGGWGFSSVALLFCSVVSYWCFMLLIN 277

Query: 86  NITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRIFIHSH 145
                    YGD      GRK K+ IL    L  +             +        H  
Sbjct: 278 TKNKIRVNGYGDLGGQLYGRKMKFAILSSIVLSQIGFAAAYTVFTATNLQAFFANIFHWD 337

Query: 146 FVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPSLPAELKGS 205
           +     ++    ++I  PLSL R I+ LS T  +A                     +   
Sbjct: 338 YPLAIYILLQMVVYI--PLSLTRSIAKLSGTVLIADFFILVGLLYLYY---YCAYYVSVH 392

Query: 206 GIPSSSYVASPSLFRSLSIVSF---ALVCHHNTSFIFHSIRN-KSLTKFTK-LTHLSVFI 260
           GI S S V    LF S +   F   A+  +     +     + K   KF + L  + + I
Sbjct: 393 GIASDSMV----LFNSSNWTLFIGTAIFTYEGIGLLIPIQESMKQPEKFPRCLFGVMLGI 448

Query: 261 SVIF--CMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLR 318
           +VIF  C  + Y+    F    K  IL NFP + +     +  +   +L + PL+LF   
Sbjct: 449 TVIFISCGCLCYSA---FGADVKTVILLNFPQDSIFTGGVQFSYALAILLSTPLQLFP-- 503

Query: 319 DVIAVILLENEWIPSIEEKPGMPILTRKW-HFIVTTIIVFLTMSVSLLTCN-LGALFELV 376
              A+ +LEN   PS       P +  KW        +V  +++++ +  N L     LV
Sbjct: 504 ---AIRILENAVFPSHASGKHNPKV--KWLKNYFRCFVVIASVAIAWVGANDLDKFVSLV 558

Query: 377 GATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQTIV 431
           G+     + YI PP ++    +    +     +     + FG  +M+  S QT++
Sbjct: 559 GSLACIPLIYIYPPMLHYKAFRGTN-ISRHDLVLDQVVLWFGIAIMVYISLQTVL 612

>TDEL0F01320 Chr6 (235988..238135) [2148 bp, 715 aa] {ON} Anc_2.177
           YNL101W
          Length = 715

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 95/426 (22%), Positives = 168/426 (39%), Gaps = 49/426 (11%)

Query: 37  AFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYG 96
           AF  +  S +G G++  P A  N GL  SIV+    G    W   +LI    ++   ++G
Sbjct: 304 AFFLLLKSFIGTGVLFLPNAFSNGGLSFSIVMLSFFGAYSYWCYFILIRAKKITGVTSFG 363

Query: 97  DTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRIFIHSHFVTRN---SVI 153
           D      G   K++IL    L  +           +     L+ F  + F+  +   S  
Sbjct: 364 DIGLRLFGPWMKFVILFSLVLTQIGFSGAYVIFTAEN----LKAFTKNVFLVSDVPISYF 419

Query: 154 FFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPS-LPAEL---KGSGIPS 209
               L +  PLS +R++S LS  S LA             F    L  +L      G+  
Sbjct: 420 MIIQLIVFIPLSFIRNVSKLSLPSLLANFFVMAGLAIVLFFSTKHLVIDLGMRAADGVIV 479

Query: 210 SSYVASPSLFRSLSIVSF---ALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCM 266
               +  S+F   +I +F    L+       +  S+R+    KF  +  L +  S +  +
Sbjct: 480 GFNQSRWSMFVGTAIFAFEGIGLIIP-----VQDSMRHPE--KFPMVLALVIGSSTVLFI 532

Query: 267 IMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVILL 326
            +   G+  +    +  IL N P   V +N+ +  +   ++ + PL+LF      A+ ++
Sbjct: 533 TIASIGYLAYGSAIETVILLNLPQKNVFVNLIQFFYSLAIMLSTPLQLFP-----AIKII 587

Query: 327 ENEWIP--------------SIEEKPGMPILTRKWHFI---VTTIIVFLTMSVSLLTCN- 368
           EN+  P               I+ +P    L  K  ++   V  IIV L + ++    + 
Sbjct: 588 ENKVFPKFTKIYVKKDDDTTDIQLRPNSGKLNWKVKWLKNSVRAIIVALVILMAYYGADK 647

Query: 369 LGALFELVGATTASVMAYILPPYVNLLL----RQEKEPLPIKSKIPHYFCILFGFTVMIV 424
           L     ++G+     + Y+ PP ++L      R   +  P +S I     I+FG   M  
Sbjct: 648 LDKFVSIIGSFACIPLVYMYPPMLHLQSYSRPRSAGQKFPWRS-IVDCVLIVFGGVSMCY 706

Query: 425 SSFQTI 430
           +S+Q+I
Sbjct: 707 TSYQSI 712

>KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2.295
           YIL088C
          Length = 479

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 66/138 (47%), Gaps = 7/138 (5%)

Query: 217 SLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIF 276
            L  + SI+ FA     N   I + ++N S+   + + + S+ IS I  + +G AG+  F
Sbjct: 189 GLLSTFSIIIFAYTGAMNLFSIINELKNNSMENVSSIINHSISISTILFLTVGIAGYLTF 248

Query: 277 TGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEE 336
              T GNIL N+  + V ++IA+ C    ++ + PL    LR  IAV    N  +  +E 
Sbjct: 249 GCNTLGNILLNYDADSVWVSIAKFCLAIMLVLSFPLLFHPLR--IAV----NNLVVWLEI 302

Query: 337 KPGMPILTRKWHFIVTTI 354
             G P   R  H+  T +
Sbjct: 303 NYGTP-QQRSQHYSQTAV 319

>YNL101W Chr14 (434999..437140) [2142 bp, 713 aa] {ON}  AVT4Vacuolar
           transporter, exports large neutral amino acids from the
           vacuole; member of a family of seven S. cerevisiae genes
           (AVT1-7) related to vesicular GABA-glycine transporters
          Length = 713

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 93/435 (21%), Positives = 166/435 (38%), Gaps = 69/435 (15%)

Query: 38  FVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGD 97
           F+ +  S +G G++  P A  N GL  S+ +    G    W   +L+   +     ++GD
Sbjct: 303 FLILLKSFIGTGVLFLPNAFHNGGLFFSVSMLAFFGIYSYWCYYILVQAKSSCGVSSFGD 362

Query: 98  T-----------------VEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRI 140
                             V   +G  G Y+I     L A            D + HV  +
Sbjct: 363 IGLKLYGPWMRIIILFSLVITQVGFSGAYMIFTAKNLQAFL----------DNVFHV-GV 411

Query: 141 FIHSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXF-GPSLP 199
              S+ +   ++IF        PLS +R+IS LS  S LA             F    L 
Sbjct: 412 LPLSYLMVFQTIIFI-------PLSFIRNISKLSLPSLLANFFIMAGLVIVIIFTAKRLF 464

Query: 200 AELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIF---HSIRNKSLTKFTKLTHL 256
            +L G+  P+   V   +  R    +  A+        I     S+RN    KF  +  L
Sbjct: 465 FDLMGT--PAMGVVYGLNADRWTLFIGTAIFAFEGIGLIIPVQDSMRNPE--KFPLVLAL 520

Query: 257 SVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFV 316
            +  + I  + +   G+  +    +  IL N P + + +N+ ++ +   ++ + PL+LF 
Sbjct: 521 VILTATILFISIATLGYLAYGSNVQTVILLNLPQSNIFVNLIQLFYSIAIMLSTPLQLFP 580

Query: 317 LRDVIAVILLENEWIPS--------------IEEKPGMPILTR--KW--HFIVTTIIVFL 358
                A+ ++EN++ P               +E +P    L    KW  +FI + I++ +
Sbjct: 581 -----AIKIIENKFFPKFTKIYVKHDDLTTRVELRPNSGKLNWKIKWLKNFIRSIIVIIV 635

Query: 359 TMSVSLLTCNLGALFELVGATTASVMAYILPPYVNLL---LRQEKEPLPIKSKIPHYFCI 415
                  + NL     ++G+     + YI P  ++L    L + K        +     I
Sbjct: 636 VSIAYFGSDNLDKFVSVIGSLACIPLVYIYPSMLHLRGNSLPETKGEFWRFKPMLDTILI 695

Query: 416 LFGFTVMIVSSFQTI 430
            FG   M+ +S+Q+I
Sbjct: 696 FFGIASMLYTSYQSI 710

>KNAG0I01970 Chr9 complement(379931..382141) [2211 bp, 736 aa] {ON}
           Anc_2.177 YNL101W
          Length = 736

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 99/463 (21%), Positives = 176/463 (38%), Gaps = 79/463 (17%)

Query: 19  ALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDW 78
           A VK ++ E    ++    F+ +  S +G G++  P    N GL  SI + +  G    W
Sbjct: 305 ASVKALVSEVRGTASTGKVFLLLLKSFIGTGVLFLPSGFANGGLLFSIAMLVFFGVYSYW 364

Query: 79  TLRLLITNITLSSKLTYGD-----------------TVEYTMGRKGKYLILCCNGLFALX 121
              +LI +   +   ++GD                  V   +G  G Y+I     L A  
Sbjct: 365 CYYILIESKIATKVKSFGDIGLKLYGPWLKFVILFAIVSTQVGFSGAYMIFTAKNLSAF- 423

Query: 122 XXXXXXXXXXDTIPHVLRIFIHSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLAL 181
                     + + HV  I +         +I    L +  PLS +R+IS LS  S +A 
Sbjct: 424 ---------VENVFHVSDINL--------PMIMLFQLVVYVPLSFVRNISKLSLPSLVAN 466

Query: 182 XXXXXXXXXXXXFGPS---LPAELK-GSGIPSSSYVASPSLFRSLSIVSFA----LVCHH 233
                       F      + + +K   GI         SLF   +I +F     ++   
Sbjct: 467 FFIMAGLVIVLFFTAKQLFIDSGMKVAEGIIFGVNHERWSLFIGTAIFAFEGIGLIIPVQ 526

Query: 234 NTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGV 293
           +T  + H  +   + K   LT   +FISV         G+  +    +  IL N P   V
Sbjct: 527 DT--MRHPEKFPLVLKLVILTATCLFISV------ATIGYLAYGSSVQTVILLNLPQGNV 578

Query: 294 AINIARVCFGFNMLTTLPLELFVLRDVIAVILLENEWIPS---IEEKPGMPILTR----- 345
            + + ++ +   ++ + PL+L+      A+ ++EN+  P    I E+      TR     
Sbjct: 579 FVLLIQLFYSMAIMLSTPLQLYP-----AIKIIENKVFPQFIKIYERDSQAQTTRVRYRP 633

Query: 346 ---------KW-HFIVTTIIVFLTMSVSLLTCN-LGALFELVGATTASVMAYILPPYVNL 394
                    KW   +V + IVFL +  +    + L  +  ++G+     + Y++PP ++L
Sbjct: 634 NSGKLSWRVKWLKNLVRSAIVFLVVLFAYCGIDYLDKVVAVIGSLCCLPLVYVIPPMLHL 693

Query: 395 LLRQEKEPLPIKSKIP----HYFCILFGFTVMIVSSFQTIVEA 433
                    P  S +         I+FG    + +S+Q+IV +
Sbjct: 694 KCCTRGSTKPQGSMMLLATFDKLLIVFGTLATVYTSYQSIVAS 736

>NCAS0G02630 Chr7 (473803..475920) [2118 bp, 705 aa] {ON} Anc_2.177
          Length = 705

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 93/456 (20%), Positives = 173/456 (37%), Gaps = 52/456 (11%)

Query: 9   DEEFQLQDSEA-LVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIV 67
           DE   L  S++ L ++ I      ++    F+ +  S +G G++  P A  N GL  SI 
Sbjct: 265 DERTSLLPSQSRLSRKAIASARGTASDSKTFLLLLKSFIGTGVLFLPGAFHNGGLTFSIC 324

Query: 68  IYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLIL----CCNGLFALXXX 123
           + +  G    W   +L     ++   ++GD      G   K +IL         F+    
Sbjct: 325 MLLFFGIYSYWCYIILTKAKVVTGVSSFGDIGLKLYGPWMKAIILFSLVVTQIGFSAAYM 384

Query: 124 XXXXXXXXDTIPHVLRI--FIHSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLAL 181
                     + + LRI     ++ +    ++F        PLS +R +S LS  S LA 
Sbjct: 385 IFTAKNLSPFVENFLRIPDLDLAYLMGLQLLVFI-------PLSFVRKVSKLSFPSLLAN 437

Query: 182 XXXXXXXXXXXXF-GPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIF- 239
                       F    L  +L     P+   +   +  R    V  A+        I  
Sbjct: 438 SFIMFGLLIVLFFVNKHLFIDLGMR--PADGVILGVNYERWTLFVGTAIFSFEGIGLIIP 495

Query: 240 --HSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINI 297
              S++N    KF  +  L +  + I  + +   G+  +       IL N P + + +N+
Sbjct: 496 IQDSMKNPE--KFPLVLGLVLITATILFISIATIGYLSYGSSIDVVILLNLPQSNIFVNL 553

Query: 298 ARVCFGFNMLTTLPLELFVLRDVIAVILLENEWIPSI-------EEKPGMPILTR----- 345
            ++ +   ++ + PL++F      A+ ++E++  P            PG   L+      
Sbjct: 554 IQLFYSLAIMLSTPLQMFP-----AIKIIESKLFPKFIKVYAKDGNSPGSYELSLNSGKL 608

Query: 346 ----KW--HFIVTTIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQE 399
               KW  +F+ + I+  + +   L   NL  +  ++G+     + YI PP ++  LR  
Sbjct: 609 NWKVKWLKNFVRSIIVTLVVLIAYLEVENLDKVVSIIGSLACIPLVYIYPPLLH--LRSH 666

Query: 400 KEPLPIKSKIP-----HYFCILFGFTVMIVSSFQTI 430
             P  +  K+       Y  + FG   M  +S+Q+I
Sbjct: 667 SIPFSVNQKVKWRVLFDYLLVGFGTVSMFYTSYQSI 702

>TBLA0F03230 Chr6 (785400..787085) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 84/193 (43%), Gaps = 28/193 (14%)

Query: 266 MIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELF-VLRDVIAVI 324
           M++G  G+  F       IL++F      ++IA++C+   +L + P++LF V + V   I
Sbjct: 366 MLIGTLGYLTFGKDITPVILSSFNQKNKFVSIAQLCYSIAILLSTPIQLFPVYKMVEEAI 425

Query: 325 LLENEWIPSIEEKPGMP----------ILTR------------KW--HFIVTTIIVFLTM 360
             +N+   +I      P          +LT             KW  +   TTI++ +T+
Sbjct: 426 FKKNKNNTAISSTSSEPQDNDNEENKAMLTEKIILSGRDSNKIKWLKNLSRTTIVLLVTI 485

Query: 361 SVSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSK---IPHYFCILF 417
                + +L     +VG+     + YI PP+ +L        L +K K   I     ++F
Sbjct: 486 ISYFGSQDLSKFVAIVGSVACIPLIYIYPPFFHLKTHSLPNSLNLKFKWRVIIDITLLIF 545

Query: 418 GFTVMIVSSFQTI 430
           G   ++ +S+Q+I
Sbjct: 546 GLLAVLYTSYQSI 558

>KNAG0H02330 Chr8 (425024..426955) [1932 bp, 643 aa] {ON} Anc_5.252
           YKL146W
          Length = 643

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 95/434 (21%), Positives = 164/434 (37%), Gaps = 43/434 (9%)

Query: 15  QDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGF 74
            +   LV         K+    A + +  S +G G++  P A  N G   S +  +    
Sbjct: 229 NEGTPLVATRSTSERHKTTTVKAVLLLLKSFVGTGVLFLPKAFSNGGWGFSSLCLLFCAI 288

Query: 75  IVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTI 134
           +  +   LLI          YG+      G K K  IL    L  +              
Sbjct: 289 LSYYCFVLLIITKDKVGVKGYGEIGMKLYGGKMKLAILLSVALSQIGFAAAYTVFTATN- 347

Query: 135 PHVLRIFIHSHFVTRNSVIFF-------STLFISYPLSLLRDISALSSTSFLALXXXXXX 187
              L++F+ + F     V+         + +FI  PLSL R+I+ LS T   AL      
Sbjct: 348 ---LKLFMDNVFNLSEDVLGLGWFIWLQAAIFI--PLSLTRNIAKLSGT---ALVADLFI 399

Query: 188 XXXXXXFGPSLPAELKGSGIPSSSYV----ASPSLFRSLSIVSF---ALVCHHNTSFIFH 240
                         +  +G+ +S+ V    +  +LF   +I +F    L+     S    
Sbjct: 400 LLGLIYVYYYATYYVISNGVATSTMVWFNKSDWTLFIGTAIFTFEGIGLLIPIQESMKHP 459

Query: 241 SIRNKSLTKFTKLTHLSVFISVIF--CMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIA 298
            +  KSL+       + V ++VIF  C ++ Y+ F          +L NFP +     I 
Sbjct: 460 EVFRKSLSG------VMVIVTVIFISCGLLCYSAFGSHVDTV---VLVNFPQDSYTTAIV 510

Query: 299 RVCFGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKW--HFIVTTIIV 356
           ++ +   +L + PL+LF      A+ +LE     S       P +  KW  ++    +++
Sbjct: 511 QLLYALAILLSTPLQLFP-----AIRILEQWTFNSNASGKHNPRV--KWLKNYFRCGVVI 563

Query: 357 FLTMSVSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCIL 416
           F T+   +   +L     LVG+     + YI PP ++    +          I      +
Sbjct: 564 FTTVLAWVGASDLDKFVSLVGSLACIPLIYIHPPLLHHRASRSDGTSSRGILILDLLICI 623

Query: 417 FGFTVMIVSSFQTI 430
           FGF+VM+ +S+Q I
Sbjct: 624 FGFSVMVYTSWQAI 637

>CAGL0B04455g Chr2 (435437..437254) [1818 bp, 605 aa] {ON} some
           similarities with uniprot|P50944 Saccharomyces
           cerevisiae YNL101w or uniprot|P36062 Saccharomyces
           cerevisiae YKL146w
          Length = 605

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 68/147 (46%), Gaps = 3/147 (2%)

Query: 35  YMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLT 94
           + A++ +  S +G G++  P A KN G+  SI+++I +G    W   +L + + +S+KL+
Sbjct: 154 FKAYILLLKSFVGTGVLLLPNAFKNGGMLFSIILFIFIGIYSFWCYYIL-SVVKVSTKLS 212

Query: 95  -YGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRIFIHSHFVTRNSVI 153
            +G+  +   G   K +IL    L  L           + +   L    H   +    +I
Sbjct: 213 CFGEIGKRIYGTPMKVVILFSLILTQLGFASTGIIFVANNMKPSLEALFHWKDIKYFYLI 272

Query: 154 FFSTLFISYPLSLLRDISALSSTSFLA 180
            F  L +  PL L+ DI   S T+ ++
Sbjct: 273 -FCQLILYIPLGLITDIKKFSITTMVS 298

>KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.177
           YNL101W
          Length = 714

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 78/389 (20%), Positives = 146/389 (37%), Gaps = 48/389 (12%)

Query: 37  AFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYG 96
           AF+ +  S +G G++  P A  N GL  SI++  ++G    W   +L+         ++G
Sbjct: 304 AFLLLLKSFVGTGVLFLPDAFHNGGLAFSIIVLTLVGLYSYWCYYILVQTKVKVKACSFG 363

Query: 97  DTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRIFIHSHFVTRNSVIFFS 156
           D      G+  K +IL    +  L             +   L+   H        ++   
Sbjct: 364 DIGSQLYGKWMKSVILVAIFVSQLGFSAAYMIFTAKNLGAFLQNIFHLKDFNLGYIMIIQ 423

Query: 157 TLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPS--------LPAELKGSGIP 208
            +F   PLS +R+IS LS  S +A             F            PA     GI 
Sbjct: 424 LIFF-VPLSFIRNISKLSLPSLIANVFIMLGLLIILIFASKHLFLDLGVHPAAGVEYGID 482

Query: 209 SSSYVASPSLFRSLSIVSF---ALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFC 265
              +    +LF   +I SF    L+     S        K   KF+ +  L +  + I  
Sbjct: 483 PRRW----TLFVGTAIFSFEGIGLIIPVQDSM-------KRPEKFSLVLKLVMITTTIIF 531

Query: 266 MIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVIL 325
           + +   G+  +  + +  +L N P   + +N+ +  +   ++ + PL+LF      A+ +
Sbjct: 532 ITIATVGYLAYGSEIQTVVLLNLPQGNLFVNLIQFLYSLAIMLSTPLQLFP-----AIKI 586

Query: 326 LENEWIPSIEEK------------------PGMPILTRKW--HFIVTTIIVFLTMSVSLL 365
           LE +      +K                   G   +  KW  + + +TI+V   +   L 
Sbjct: 587 LEGKVFYRYNKKVSRQLSGEANESTKGGSYSGKSNMKIKWLKNLLRSTIVVGAILIAYLG 646

Query: 366 TCNLGALFELVGATTASVMAYILPPYVNL 394
             +L  +  ++G+     + +ILPP +++
Sbjct: 647 MDSLDKVVSIIGSFCCLPLVFILPPLLHM 675

>KLTH0B02970g Chr2 complement(232632..234431) [1800 bp, 599 aa] {ON}
           similar to uniprot|P47082 Saccharomyces cerevisiae
           YJR001W AVT1 Vacuolar transporter imports large neutral
           amino acids into the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 599

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 51/114 (44%), Gaps = 7/114 (6%)

Query: 2   NYTIVPTDEEFQLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAG 61
           N  I P  E   L+  E    +I+     +S       N  N ++G G+   PL +K AG
Sbjct: 175 NNAIDPDTESIMLKQVERKDGKIVTLLAGQSTGPQTIFNSVNVLIGIGLFALPLGMKYAG 234

Query: 62  LCA-SIVIYIMLGFI---VDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLI 111
             A +I++++  G      +   R L T+ T+   ++YGD      G KG+ L+
Sbjct: 235 FVAGAILLFVFAGATFCSAELLSRCLDTDPTM---ISYGDLGAAAFGPKGRALV 285

>CAGL0G06622g Chr7 complement(631859..634060) [2202 bp, 733 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101w
          Length = 733

 Score = 38.1 bits (87), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 89/417 (21%), Positives = 161/417 (38%), Gaps = 43/417 (10%)

Query: 43  NSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYT 102
            S +G G++  P A  N GL  SI +    G        LLI++   +   ++G      
Sbjct: 327 KSFIGTGVLFLPNAFNNGGLFFSIFMLAFFGLYSYLCYYLLISSKIAAQVRSFGGIGLKL 386

Query: 103 MGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRIFIHSHFVTRNSVIFF--STLFI 160
            G   KYLIL       +            T  ++  I  H   +   S+ F   S L +
Sbjct: 387 YGPTMKYLILFS---LVITQLGFSSVYVIFTARNLKAIGEHVFKLPNVSITFLMISQLLL 443

Query: 161 SYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFG-PSLPAELKGS-------GIPSSSY 212
             PLS +R IS LS  S  A             F    L  +L GS       GI +S +
Sbjct: 444 FIPLSFVRKISKLSLPSLFANVFILVGLVIVVFFSMKHLFYDLSGSPADGVIFGINNSRW 503

Query: 213 VASPSLFRSLSIVSF---ALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMG 269
               +LF   +I SF    LV     S        +   KF  +  L +  + +  +I+ 
Sbjct: 504 ----TLFIGTAIFSFEGIGLVIPVQDSM-------RKPEKFPLVLGLVIICTTVVFIIVA 552

Query: 270 YAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVILLE-- 327
             G+  +  +    IL N P   + +++ ++ +   ++ + PL++F    +I   L +  
Sbjct: 553 TIGYLAYGSEVDTVILLNLPQKNILVSLIQLLYSIAIMLSTPLQMFPAIRIIESGLFKQY 612

Query: 328 NEWIPSIEEK---------PGMPILTRKW--HFIVTTIIVFLTMSVSLLTCNLGALFELV 376
           + W+   + +          G      KW  + + ++I++ +     +   NL     ++
Sbjct: 613 DRWVNRSDREGHATEHNTSSGKSSWKVKWMKNAVRSSIVILVVAIACVGADNLDKFLSII 672

Query: 377 GATTASVMAYILPPYVNLL---LRQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQTI 430
           G+     + Y+ PP ++L    L +    +  +  I     I+FG   M+ +S+Q+I
Sbjct: 673 GSFACIPLVYMYPPMLHLKSTSLPRSNGKIMSRRVIIDIVLIIFGGISMVYTSYQSI 729

>Ecym_5408 Chr5 complement(838376..840523) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AER380C
          Length = 715

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 51/120 (42%), Gaps = 19/120 (15%)

Query: 9   DEEFQLQDSEALVKEIIDENNK----------------KSNIYMAFVNMANSILGAGIIT 52
           DEEF L  + +   ++IDE                   K++ + AF+ +  S +G G++ 
Sbjct: 262 DEEFDLVQTYS---KVIDETTPLLSGDTERLHPITVRVKTSTFKAFLLLIKSFVGTGVLF 318

Query: 53  QPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLIL 112
            P A  N GL  SI++  +      W   +L+     +   ++GD      G   KY+IL
Sbjct: 319 LPNAFSNGGLAFSIIMLFIFSGYSYWCYYILVRTKVSTGVSSFGDIGAMLYGPWMKYIIL 378

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 81/188 (43%), Gaps = 32/188 (17%)

Query: 266 MIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVIL 325
           +++G  G+  +    +  IL N P   +++N+ +  +   +L + PL+LF      A+ +
Sbjct: 531 VLVGSLGYLAYGKYIQSVILLNLPQKSLSVNLIQFFYSMAILLSTPLQLFP-----AIAI 585

Query: 326 LENEWIP---SIEEKP-GMPILTR-----------KW--HFIVTTIIVFLTMSVSLLTCN 368
           +EN+  P    I  KP G+P  +            KW  + + + I++F+     +   +
Sbjct: 586 IENKIFPKFTKINVKPQGLPSYSLIPYSGRLNWKIKWTKNLVRSIIVIFIITLAYVGADD 645

Query: 369 LGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSK--------IPHYFCILFGFT 420
           L     ++G      + Y+ PP ++  LR   +P  I +         I  YF I FG  
Sbjct: 646 LDLFVSVIGCFACIPLVYMYPPLLH--LRSCSKPQHIANPTYRTLFAVILDYFLIFFGGV 703

Query: 421 VMIVSSFQ 428
               +++Q
Sbjct: 704 SACYTTYQ 711

>KLTH0G07502g Chr7 (608628..610433) [1806 bp, 601 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 601

 Score = 37.7 bits (86), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 91/393 (23%), Positives = 150/393 (38%), Gaps = 33/393 (8%)

Query: 9   DEEFQLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVI 68
           DEE  L    A    I      KS+ + A + +  S +G G++  P A  N G   S   
Sbjct: 187 DEETALVGRRAR-HRISHRQPHKSSTFKAVLLLLKSFVGTGVLFLPRAFHNGGWAFSTTC 245

Query: 69  YIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXX 128
            +  G I  +   LLI      +   YGD      GR  +  IL   G   L        
Sbjct: 246 LLACGVISYYCFVLLINTKLKKNVNGYGDLGAAVYGRNMELAIL---GSIVLSQIGFVAA 302

Query: 129 XXXDTIPHVLRIFIHSHFVTRNSVIFFSTL--FISYPLSLLRDISALSSTSFLALXXXXX 186
               T  + L++F  S F    S++F+  +   +  PLSL R+I+ LS T+ LA      
Sbjct: 303 YAVFTATN-LQVFFSSVFHWEASMVFWLAVQLLLYLPLSLTRNIAKLSGTALLADLFIMF 361

Query: 187 XXXXXXXFGPSLPAELKGSGIPSSSYVA----SPSLFRSLSIVSFALVCHHNTSFIFHSI 242
                  +     A    +G+ S S +       +LF   +I ++  +       +   I
Sbjct: 362 GLLYVYYYCSRYVAH---NGVASDSMLVFNKNDWTLFIGTAIFTYEGIG------LLIPI 412

Query: 243 RN--KSLTKFTKL---THLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINI 297
           +   K   KF K      +SV I+ I C ++ Y+    F    +  IL NFP        
Sbjct: 413 QESMKHPEKFNKCLLGVMVSVSIAFILCGLLCYSA---FGSSVETVILLNFPRKSAMTAS 469

Query: 298 ARVCFGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVF 357
            ++ +   ++ + PL+LF +     + +LE    P        P +    ++    I++ 
Sbjct: 470 VQLLYALAIMLSTPLQLFPI-----IRILETSIFPKNASGKYNPRVKWMKNYFRIGIVLA 524

Query: 358 LTMSVSLLTCNLGALFELVGATTASVMAYILPP 390
            T+   L   +L     +VG+     + YI PP
Sbjct: 525 NTLIAWLGANDLDKFVSIVGSFACIPLIYIYPP 557

>TBLA0B07210 Chr2 (1705801..1707294) [1494 bp, 497 aa] {ON}
           Anc_2.295 YIL088C
          Length = 497

 Score = 37.4 bits (85), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 69/312 (22%), Positives = 123/312 (39%), Gaps = 47/312 (15%)

Query: 32  SNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSS 91
           ++I+ + +N+  +I+GAG++  P A +N G+   I+                   +TL +
Sbjct: 6   ASIHSSIINLTKTIVGAGMLAIPFAFRNDGILVGIL-------------------LTLLA 46

Query: 92  KLTYGDTVEYTMGRKGKYLILCCN-GLFALXXXXXXXXXXXDTIPHVLRIF--------- 141
            +T G  + + + +  K LI   N   F L             I  +++ F         
Sbjct: 47  AITSGFGL-FVLAKCSKTLINPRNSSFFQLTMIAFPNLSPLSDISMIVQCFGVGLSYIVL 105

Query: 142 -------IHSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXX-- 192
                  I +++ +RN  I  ST+ I  PL LL+ +  L  +S + L             
Sbjct: 106 IGDLFPTIFNNYGSRNFYILTSTIVI-VPLCLLKRLDHLKYSSIVGLFALSYLSFLIVFV 164

Query: 193 -----XFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSL 247
                    +LP   +GS I   S      L  + +I+ FA     N   I + +    +
Sbjct: 165 FIKDIILTNNLPPFERGS-INWVSIYDFNGLLSTFTIIIFAYTGSMNLFTIINELNYNDI 223

Query: 248 TKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFP-PNGVAINIARVCFGFNM 306
                + + S+ IS I  +I+   G+  F   T GNI+ N+   N + I + ++  G  +
Sbjct: 224 DSIKIVINHSIAISTIIFLIISIFGYLTFGTLTLGNIMLNYNYSNSLYIILGKLALGIMV 283

Query: 307 LTTLPLELFVLR 318
           + T PL    LR
Sbjct: 284 ILTFPLLFHPLR 295

>NDAI0F02660 Chr6 complement(649723..651855) [2133 bp, 710 aa] {ON}
           Anc_2.177
          Length = 710

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 48/112 (42%), Gaps = 1/112 (0%)

Query: 2   NYTIVPTDEEFQLQDSEA-LVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNA 60
           N  ++ T E   L  S++ L K  I      ++    F+ +  S +G GI+  P A  N 
Sbjct: 262 NEYLLSTTERTPLLPSQSRLSKAAIHSARGTTSTAKTFLLLLKSFMGTGILFLPAAFHNG 321

Query: 61  GLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLIL 112
           GL  SI++    G    W   +L      + + ++GD      G   K++IL
Sbjct: 322 GLLFSIIMLFFFGIYSYWCYYILTKAKVATGQSSFGDIGLKLYGPSMKFIIL 373

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 41/197 (20%), Positives = 82/197 (41%), Gaps = 30/197 (15%)

Query: 258 VFISVIFCMI-MGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFV 316
           V I+  F  I +   G+  +   T+  IL N P + + +   ++ +   ++ + PL++F 
Sbjct: 517 VLIAATFLFITIASIGYLSYGSSTEVVILLNLPQDSIFVISIQLFYSLAIMLSTPLQMFP 576

Query: 317 LRDVIAVILLENEWIPSIEE----------------KPGMPILTRKW--HFIVTTIIVFL 358
                A+ ++EN+  P   +                  G      KW  +F+ + I+ F+
Sbjct: 577 -----AIKIIENKVFPRFTKIYVEGDGDRCDVEFRLNSGKANWKVKWLKNFVRSIIVSFV 631

Query: 359 TMSVSLLTCNLGALFELVGATTASVMAYILPPYVNL-----LLRQEKEPLPIKSKIPHYF 413
            +       NL  +  L+G+     + YI PP ++L           +P   K  + H  
Sbjct: 632 IIFAYYEVDNLDKVVSLIGSFACIPLVYIYPPLLHLRSRSRSQSPSGDPSKWKLVLDH-I 690

Query: 414 CILFGFTVMIVSSFQTI 430
            ++FG   MI +S+Q++
Sbjct: 691 LVVFGGISMIYTSYQSM 707

>ZYRO0B10032g Chr2 complement(783526..785355) [1830 bp, 609 aa] {ON}
           similar to uniprot|P47082 Saccharomyces cerevisiae
           YJR001W AVT1 Vacuolar transporter imports large neutral
           amino acids into the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 609

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 72/180 (40%), Gaps = 9/180 (5%)

Query: 2   NYTIVPTDEEFQLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAG 61
           N      +E   L+  E    E++     KS       N  N ++G G++  PL +KNAG
Sbjct: 185 NIGTAADNELITLRKVEGKDGEVVTVLAGKSTGPQTIFNSVNILIGIGLLALPLGLKNAG 244

Query: 62  LCASIVIYIMLGFI----VDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGL 117
               + +  +L        +   R L T+ TL   ++Y D      G KG+ LI C   L
Sbjct: 245 WIPGLCLLCILALATFCSAELLSRCLDTDPTL---MSYADLGYAAYGSKGRILISCLFTL 301

Query: 118 FALXXXXXXXXXXXDTIPHVLRIFIHSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTS 177
             L           D++  ++  +  + F           +FI  PLS+L +IS L  TS
Sbjct: 302 DLLGSGVSLIILFGDSLNALIPKYSSNFFKVLGFFAVTPGVFI--PLSILSNISLLGITS 359

>KLLA0D09779g Chr4 complement(824518..826404) [1887 bp, 628 aa] {ON}
           similar to uniprot|P47082 Saccharomyces cerevisiae
           YJR001W AVT1 Vacuolar transporter imports large neutral
           amino acids into the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 628

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 45/109 (41%), Gaps = 1/109 (0%)

Query: 4   TIVPTDEEFQLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLC 63
            + P  +   L+  E    ++I     +S       N  N ++G G++  PL ++ AG  
Sbjct: 206 AVGPEADAIILKQVETKAGKVITVIAGQSTAPQTIFNSINVLIGIGLLALPLGLRYAGWV 265

Query: 64  ASIVIYIMLGFIVDWTLRLLITNITLSSKL-TYGDTVEYTMGRKGKYLI 111
             + I  +  F    + +L+   +     + TYGD      G KG+ LI
Sbjct: 266 LGVPILFIFAFATFCSAQLISRCLDADPSISTYGDLAYAAFGPKGRALI 314

>NDAI0I02030 Chr9 (472696..474546) [1851 bp, 616 aa] {ON} Anc_5.220
           YJR001W
          Length = 616

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 50/116 (43%), Gaps = 7/116 (6%)

Query: 2   NYTIVPTDEEFQLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAG 61
           + +I+   +   L+  E    +I+     +S       N  N ++G G++  PL +K AG
Sbjct: 192 DTSIINDTDSITLKRVEGKDGKIVTLIAGQSTGPQTIFNSINVLIGIGLLALPLGLKYAG 251

Query: 62  LCASIVIYIMLGF----IVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILC 113
               +++ +   F      +   R L T+ TL   ++Y D      G KG+ LI C
Sbjct: 252 WVIGLILLMTFAFGTFCTAELLSRCLDTDPTL---MSYADLGYAAFGTKGRALISC 304

>KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.420
           YER119C
          Length = 545

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 83/231 (35%), Gaps = 56/231 (24%)

Query: 214 ASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSL--TKFTKLTHLSVFISV-IFCMIMGY 270
            +P L   L ++ F   CH N     +  R + L  T    LT+L+ + +V + C I GY
Sbjct: 186 GAPRLL-GLPLLMFMFTCHQNIFPTLNCARERGLKHTLRVPLTYLAAYAAVCLICGITGY 244

Query: 271 AGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVILL---- 326
             F   T     N+L  +P   +   + RV    ++  + PL     R  +  I      
Sbjct: 245 LTFHKSTRTIPSNVLLLYPQGSILGTLCRVTTLLSVTLSFPLLCHPTRAALNHIWAHWGR 304

Query: 327 ------------------ENEWIP--SIEEK-------------PGMPILTRKW------ 347
                             E EW P  SIE +               +P+           
Sbjct: 305 GQDSQASQPRYKTDATVDETEWTPLISIEGRRVSVDEMVEEGYTKSLPLRNNPCSTDSAC 364

Query: 348 ------HFIVTTII---VFLTMSVSLLTCNLGALFELVGATTASVMAYILP 389
                  FI  TI+   V   +SV + +  LGA+  LVG T +  + Y+LP
Sbjct: 365 TGGTTASFIAITILLVAVPTCLSVFIDSATLGAVLGLVGITASVTVGYVLP 415

>TDEL0E03740 Chr5 (707081..708922) [1842 bp, 613 aa] {ON} Anc_5.252
           YKL146W
          Length = 613

 Score = 34.3 bits (77), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 91/421 (21%), Positives = 157/421 (37%), Gaps = 38/421 (9%)

Query: 26  DENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLIT 85
           +    K++ + A + +  S +G G++  P A  N G   S+V   +      +    LI+
Sbjct: 212 EHERHKASTFKAVLLLLKSFIGTGVLFLPKAFDNGGWAFSVVCLFVCAVASFFCFISLIS 271

Query: 86  NITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRIFIHS- 144
                    YGD      G K K+ IL    L  +                 L++F  + 
Sbjct: 272 TKEKVGVNGYGDLGLRLFGPKMKFSILLSIALSQIGFSAAYIVFTATN----LKVFCENV 327

Query: 145 ------HFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPSL 198
                  F     +I  + +FI  PLS  R+I+ LS T+ +A                  
Sbjct: 328 LGVKPDSFGLATYIILQTLIFI--PLSFTRNITKLSGTTLVADLFILLGLLYVYY---YP 382

Query: 199 PAELKGSGIPSSSYV----ASPSLFRSLSIVSF---ALVCHHNTSFIFHSIRNKSLTKFT 251
              +   GI +SS      +  SLF   +I +F    L+     S       NK L    
Sbjct: 383 SYYIIKHGIATSSMKLFNKSDWSLFVGTAIFTFEGIGLLIPIQESMEKPQHFNKCL---- 438

Query: 252 KLTHLSVFISVIFCMIM-GYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTL 310
               L V   V F  I  G   +  F  K +  +L NFP +      A++ +   +L + 
Sbjct: 439 ----LGVMSGVAFVFITSGLICYSAFGSKVETVVLLNFPQDSPFTKSAQLLYVLAILLST 494

Query: 311 PLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMSVSLLTCNLG 370
           PL+LF      A+ +LEN   P        P +    ++  + I++  ++       +L 
Sbjct: 495 PLQLFP-----AIRILENWTFPVDASGKHNPHIKWLKNYFRSAIVIATSLIAWGGANDLD 549

Query: 371 ALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQTI 430
               LVG+     + YI PP ++    ++K    I S +        G  +M+ +++Q+I
Sbjct: 550 KFVSLVGSFACVPLIYIYPPALHFKAFKDKNASKI-SLVTDVVIASVGVIIMLYNTYQSI 608

Query: 431 V 431
           +
Sbjct: 609 L 609

>Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}
           similar to Ashbya gossypii ADL205C
          Length = 474

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 60/296 (20%), Positives = 112/296 (37%), Gaps = 31/296 (10%)

Query: 32  SNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNIT--L 89
           + +Y + VN+  +I+GAG++  P A +  G+  +I++             LL   IT   
Sbjct: 5   ATVYSSTVNLVKTIVGAGLLAIPYAFRADGVTVAIIL-------------LLFAAITSGF 51

Query: 90  SSKLTYGDTVEYTMGRKGKYLILCC------NGLFALXXXXXXXXXXXDTIPHVLRIFIH 143
              L    +      R+  +  LC       + LF               +  V  +F  
Sbjct: 52  GLYLLSLSSKALLNPRQSSFFTLCSVTYPKLSFLFDFAMFIQCYGVGLSYLVLVGDLFSS 111

Query: 144 SHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALXXXXXXXXXXXXFGPSLPAELK 203
                RN  I  ST+ +  PL+ LR + +L  +S + L             G  L   + 
Sbjct: 112 LLGGRRNWWILGSTIIV-VPLAHLRQLDSLKYSSLVGLLSITYLVLLVT--GTFLQGVMF 168

Query: 204 GS------GIPSSSYVAS-PSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHL 256
           G+      G  S  ++ S   L  + SI+  A     N   + + +++ S     ++ + 
Sbjct: 169 GNKYVEHRGDVSWLHIHSVGELVSTFSIIILAYTGSMNMFSVINELKDNSTANAKRVVYY 228

Query: 257 SVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTLPL 312
           SV IS +  + +G  G+  F      N++ N+  + +   I     G  ++ + PL
Sbjct: 229 SVGISTLIFLSVGLGGYLTFGNNVLTNVILNYDESAITTRIGTFSLGTMVILSFPL 284

>ACR030W Chr3 (413856..415655) [1800 bp, 599 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJR001W
          Length = 599

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 46/112 (41%), Gaps = 1/112 (0%)

Query: 1   MNYTIVPTDEEFQLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNA 60
           +N    P  +   L+  E    +++     +S       N  N ++G G++  PL ++ A
Sbjct: 174 VNNAAGPDADSIMLKRVETKTGKVVTVLAGQSTAPQTIFNSVNVLIGIGLLALPLGLRYA 233

Query: 61  GLCASIVIYIMLGFIVDWTLRLLITNITLS-SKLTYGDTVEYTMGRKGKYLI 111
           G    I + ++       +  LL   I    S ++YGD      G KG+ LI
Sbjct: 234 GWALGIPMLLVFAAGTFCSAELLSRCIDADPSMISYGDLGYAAFGSKGRALI 285

>TDEL0E04090 Chr5 complement(761896..763797) [1902 bp, 633 aa] {ON}
           Anc_5.220 YJR001W
          Length = 633

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 47/121 (38%), Gaps = 22/121 (18%)

Query: 5   IVPTD-EEFQLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGL- 62
           I P D E F ++  E     ++     +S       N  N ++G G+   PL +K AG  
Sbjct: 179 IAPPDAESFMVKQIEGKDGAVVTVLAGQSTAPQTIFNSINVLIGIGLFALPLGLKYAGWV 238

Query: 63  ----------CASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLIL 112
                     C +     +L        R L T+ T+   ++Y D      GR+G+ LI 
Sbjct: 239 FGLLLLLVLACGTFCTAELLS-------RCLDTDPTM---MSYADLGYAAYGRRGRALIS 288

Query: 113 C 113
           C
Sbjct: 289 C 289

>Kwal_33.15212 s33 (1013106..1014914) [1809 bp, 602 aa] {ON} YJR001W
           - Hypothetical ORF [contig 94] FULL
          Length = 602

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/111 (20%), Positives = 46/111 (41%), Gaps = 1/111 (0%)

Query: 2   NYTIVPTDEEFQLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAG 61
           N  + P      L+  E    +++     +S       N  N ++G G+   PL ++ AG
Sbjct: 178 NNAVDPDTHSIMLKQVERKDGKVVTLLAGQSTAPQTIFNSVNVLIGIGLFALPLGLRYAG 237

Query: 62  LCASIVIYIMLGFIVDWTLRLLITNI-TLSSKLTYGDTVEYTMGRKGKYLI 111
               +++ ++       +  LL   + T  + ++YGD      G KG+ L+
Sbjct: 238 CILGVILLLVFASTTFCSAELLSRCLDTDPTMISYGDLGAAAFGPKGRALV 288

>TBLA0D03110 Chr4 (753778..755712) [1935 bp, 644 aa] {ON} Anc_5.220
           YJR001W
          Length = 644

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 73/176 (41%), Gaps = 5/176 (2%)

Query: 1   MNYTIVPTD--EEFQLQDSEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVK 58
           +N++  P D  +   +Q  E     +I   + KS       N  N ++G G++  PL +K
Sbjct: 217 INHSNEPLDSADSIVIQRVEKKDGTVITIVSGKSTAPQTIFNSINVLIGMGLLALPLGLK 276

Query: 59  NAGLCASIVIYIMLGFIVDWTLRLLITNI-TLSSKLTYGDTVEYTMGRKGKYLILCCNGL 117
            AG    +++  +  F    T  LL   + T  + L+Y D      G KG+ L+     L
Sbjct: 277 YAGWALGLIMLSIFAFSTFCTAELLSRCLDTDPNLLSYADLGYAAFGAKGRALVSVIFTL 336

Query: 118 FALXXXXXXXXXXXDTIPHVLRIFIHSHFVTRNSVIFFSTLFISYPLSLLRDISAL 173
             L           D++  ++  +    F   +  I    +FI  PLS+L +IS L
Sbjct: 337 DLLCVGVSLIILFGDSLNALIPSYSSDFFKIMSFFIVTPGVFI--PLSILSNISLL 390

>NCAS0D02870 Chr4 complement(545123..546952) [1830 bp, 609 aa] {ON}
           Anc_5.220 YJR001W
          Length = 609

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 7/78 (8%)

Query: 40  NMANSILGAGIITQPLAVKNAGLCASIVIYIMLGF----IVDWTLRLLITNITLSSKLTY 95
           N  N ++G G++  PL +K AG    + + +   F      +   R L T+ TL   ++Y
Sbjct: 223 NSINVLIGIGLLALPLGLKYAGWVIGLPLLMTFAFGTFCTAELLSRCLDTDPTL---MSY 279

Query: 96  GDTVEYTMGRKGKYLILC 113
            D      G KG+ LI C
Sbjct: 280 ADLGYAAFGSKGRALISC 297

>SAKL0G12452g Chr7 complement(1058250..1060058) [1809 bp, 602 aa]
           {ON} similar to uniprot|P47082 Saccharomyces cerevisiae
           YJR001W AVT1 Vacuolar transporter imports large neutral
           amino acids into the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 602

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 46/110 (41%), Gaps = 14/110 (12%)

Query: 13  QLQDSEALVKEIIDENNK-------KSNIYMAFVNMANSILGAGIITQPLAVKNAGLCAS 65
            L     +VK++  ++ K       +S       N  N ++G G++  PL +K AG    
Sbjct: 183 DLDTHSIIVKQVETKDGKTVTVLAGQSTAPQTIFNSINVLIGIGLLALPLGMKYAGWVLG 242

Query: 66  IVIYIMLGFI----VDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLI 111
           + + +   F      +   R L T+ TL   ++YGD      G KG+  I
Sbjct: 243 VPMLLTFAFATFCSAELLSRCLDTDPTL---ISYGDLGYAAFGPKGRAFI 289

>TBLA0C05630 Chr3 (1364052..1366280) [2229 bp, 742 aa] {ON}
           Anc_2.177 YNL101W
          Length = 742

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 69/160 (43%), Gaps = 3/160 (1%)

Query: 22  KEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLR 81
           ++I++    K++   AF  +  S +G GI+  P A    GL  S V+ I+ GF   +   
Sbjct: 343 EQILNRAKGKTSTKKAFFLLLKSFIGTGILFLPNAFSKGGLIFSNVLIIIFGFYSYYCYM 402

Query: 82  LLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALXXXXXXXXXXXDTIPHVLRIF 141
           LLI     S   ++G+      G   + +IL    +  +             + +  + +
Sbjct: 403 LLIKCKRYSQVSSFGEMGNKLYGPLMQKIILFSIMISQIGFSCAYIIFTSTNLNYFFQQY 462

Query: 142 IHSHFVTRNSVIFFS-TLFISYPLSLLRDISALSSTSFLA 180
             +  +  N  + F   LFI  PLS +R+IS LS  S +A
Sbjct: 463 PLTEKLDFNFFLIFQLILFI--PLSFVRNISKLSVPSLVA 500

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.141    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,709,785
Number of extensions: 1650939
Number of successful extensions: 6051
Number of sequences better than 10.0: 131
Number of HSP's gapped: 6032
Number of HSP's successfully gapped: 177
Length of query: 444
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 331
Effective length of database: 40,524,141
Effective search space: 13413490671
Effective search space used: 13413490671
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 67 (30.4 bits)