Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0H016005.527ON84284240790.0
NCAS0F010905.527ON78787119810.0
CAGL0F03047g5.527ON74483110051e-124
TDEL0A039105.527ON7493859061e-109
Smik_4.6975.527ON8173748841e-105
Skud_4.6965.527ON8113698801e-105
YDR422C (SIP1)5.527ON8153768721e-103
ZYRO0D12562g5.527ON8183908601e-102
Suva_2.5995.527ON8273718561e-101
SAKL0G04928g5.527ON8923888581e-101
ADR194C5.527ON6373667585e-89
KLTH0G03762g5.527ON7093767452e-86
TBLA0D016505.527ON10163587307e-82
Kwal_47.186425.527ON3093266677e-80
Ecym_40655.527ON7213816953e-79
KNAG0C032305.527ON5613766512e-74
KAFR0E033005.527ON4663546047e-69
Kpol_1004.215.527ON7553855727e-62
Kpol_1023.985.527ON6673794911e-51
TPHA0K005305.527ON6463663421e-32
Ecym_12103.517ON4502931922e-14
Skud_5.1363.517ON4182931894e-14
KLLA0B00583g3.517ON486421476e-09
CAGL0A03696g3.517ON415421441e-08
SAKL0F02002g3.517ON503421413e-08
TBLA0I032703.517ON433411403e-08
Kwal_47.190403.517ON429411404e-08
KAFR0F041403.517ON348581376e-08
TPHA0A058103.517ON424421387e-08
KAFR0I023803.517ON409411378e-08
Smik_5.1503.517ON417401342e-07
Suva_5.1233.517ON423401342e-07
YER027C (GAL83)3.517ON417401342e-07
AER361C3.517ON475551342e-07
KNAG0E015903.517ON423411323e-07
NDAI0B060103.517ON503401333e-07
NCAS0F037303.517ON432401324e-07
KNAG0B006003.517ON389521314e-07
Kpol_195.23.517ON435411315e-07
KLTH0G01848g3.517ON416421305e-07
Skud_7.603.517ON441821306e-07
YGL208W (SIP2)3.517ON415821306e-07
TDEL0D058503.517ON404411297e-07
Smik_7.553.517ON415401298e-07
KNAG0B036905.527ON3261131261e-06
Suva_7.533.517ON414401271e-06
NCAS0E006203.517ON500401244e-06
ZYRO0E08404g3.517ON348431224e-06
CAGL0K09350g3.517ON432401217e-06
NDAI0I028903.517ON582401218e-06
Kwal_47.18638singletonOFF377281000.002
Smik_10.3191.473ON14071770.49
YJR044C (VPS55)1.473ON14071770.49
KLTH0F02068g1.69ON126987810.58
Suva_12.1271.473ON14071731.4
ZYRO0C17270g3.401ON228752771.7
Skud_8.2694.381ON601113762.2
CAGL0B05049g1.389ON147085752.9
Skud_10.2621.473ON14071713.0
TBLA0D005007.408ON1115102734.6
KNAG0D014307.463ON132484735.5
TBLA0H008508.401ON89373719.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0H01600
         (842 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {O...  1575   0.0  
NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {O...   767   0.0  
CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {...   391   e-124
TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {O...   353   e-109
Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {...   345   e-105
Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {...   343   e-105
YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}...   340   e-103
ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]...   335   e-102
Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {...   334   e-101
SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {...   335   e-101
ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}...   296   5e-89
KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {...   291   2e-86
TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5....   285   7e-82
Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C...   261   7e-80
Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar t...   272   3e-79
KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.5...   255   2e-74
KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.5...   237   7e-69
Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {O...   224   7e-62
Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON} (2298...   193   1e-51
TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5....   136   1e-32
Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar t...    79   2e-14
Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON...    77   4e-14
KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON...    61   6e-09
CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} simila...    60   1e-08
SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} simila...    59   3e-08
TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {O...    59   3e-08
Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]...    59   4e-08
KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {O...    57   6e-08
TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa] ...    58   7e-08
KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.5...    57   8e-08
Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON...    56   2e-07
Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON...    56   2e-07
YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}  ...    56   2e-07
AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}...    56   2e-07
KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {O...    55   3e-07
NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa] ...    56   3e-07
NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {O...    55   4e-07
KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517...    55   4e-07
Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON} co...    55   5e-07
KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} simila...    55   5e-07
Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W (...    55   6e-07
YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of t...    55   6e-07
TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa] ...    54   7e-07
Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)    54   8e-07
KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.52...    53   1e-06
Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)    54   1e-06
NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517     52   4e-06
ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {...    52   4e-06
CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa] ...    51   7e-06
NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {O...    51   8e-06
Kwal_47.18638 s47 (907369..908499) [1131 bp, 377 aa] {OFF} [cont...    43   0.002
Smik_10.319 Chr10 complement(504885..505307) [423 bp, 140 aa] {O...    34   0.49 
YJR044C Chr10 complement(518763..519185) [423 bp, 140 aa] {ON}  ...    34   0.49 
KLTH0F02068g Chr6 complement(165601..169410) [3810 bp, 1269 aa] ...    36   0.58 
Suva_12.127 Chr12 complement(192544..192966) [423 bp, 140 aa] {O...    33   1.4  
ZYRO0C17270g Chr3 (1345022..1351885) [6864 bp, 2287 aa] {ON} sim...    34   1.7  
Skud_8.269 Chr8 (471255..473060) [1806 bp, 601 aa] {ON} YHR202W ...    34   2.2  
CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some ...    33   2.9  
Skud_10.262 Chr10 complement(475043..475465) [423 bp, 140 aa] {O...    32   3.0  
TBLA0D00500 Chr4 (131830..135177) [3348 bp, 1115 aa] {ON} Anc_7....    33   4.6  
KNAG0D01430 Chr4 complement(238537..242511) [3975 bp, 1324 aa] {...    33   5.5  
TBLA0H00850 Chr8 (188637..191318) [2682 bp, 893 aa] {ON} Anc_8.4...    32   9.3  

>NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {ON}
           Anc_5.527 YDR422C
          Length = 842

 Score = 1575 bits (4079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 782/842 (92%), Positives = 782/842 (92%)

Query: 1   MGNNPSTTDSENTAADLQEKKAGFHNKHLTRIQKQESPKERKGSITSHLFSSKGSSKRHA 60
           MGNNPSTTDSENTAADLQEKKAGFHNKHLTRIQKQESPKERKGSITSHLFSSKGSSKRHA
Sbjct: 1   MGNNPSTTDSENTAADLQEKKAGFHNKHLTRIQKQESPKERKGSITSHLFSSKGSSKRHA 60

Query: 61  LMPKPIEAQGNIKSHNVFKKDYSMDEPLTNKGGIKNNDFNDENIHETMASLSLVTSSDNE 120
           LMPKPIEAQGNIKSHNVFKKDYSMDEPLTNKGGIKNNDFNDENIHETMASLSLVTSSDNE
Sbjct: 61  LMPKPIEAQGNIKSHNVFKKDYSMDEPLTNKGGIKNNDFNDENIHETMASLSLVTSSDNE 120

Query: 121 RKKSMSFARPGPSTPTVQPTKHDITSLEGSTDVNTGIDNMNVAGDLNSHRPSIVALKNTL 180
           RKKSMSFARPGPSTPTVQPTKHDITSLEGSTDVNTGIDNMNVAGDLNSHRPSIVALKNTL
Sbjct: 121 RKKSMSFARPGPSTPTVQPTKHDITSLEGSTDVNTGIDNMNVAGDLNSHRPSIVALKNTL 180

Query: 181 AESSIHPPSDLSKTVSTSSNCQSFSTESSSSALHKTESIDIPRRHSQGFNENYNETMLKH 240
           AESSIHPPSDLSKTVSTSSNCQSFSTESSSSALHKTESIDIPRRHSQGFNENYNETMLKH
Sbjct: 181 AESSIHPPSDLSKTVSTSSNCQSFSTESSSSALHKTESIDIPRRHSQGFNENYNETMLKH 240

Query: 241 PTVHSYQYQYFNNENTNNDGGLHKHKENFNDMQLSTSNDDEESGVLQSADIVVNQSTLQN 300
           PTVHSYQYQYFNNENTNNDGGLHKHKENFNDMQLSTSNDDEESGVLQSADIVVNQSTLQN
Sbjct: 241 PTVHSYQYQYFNNENTNNDGGLHKHKENFNDMQLSTSNDDEESGVLQSADIVVNQSTLQN 300

Query: 301 ALKRDMKRKRTDTISTNKSGAPTSDALKAKDEPEAKTKTEKPAMSATAAMMLKLYGDTTL 360
           ALKRDMKRKRTDTISTNKSGAPTSDALKAKDEPEAKTKTEKPAMSATAAMMLKLYGDTTL
Sbjct: 301 ALKRDMKRKRTDTISTNKSGAPTSDALKAKDEPEAKTKTEKPAMSATAAMMLKLYGDTTL 360

Query: 361 KEKETFKNNTISGTIRYDDFYKRSESSVNLPENKKLKSFDNNTKNGNGYVSVSGNPXXXX 420
           KEKETFKNNTISGTIRYDDFYKRSESSVNLPENKKLKSFDNNTKNGNGYVSVSGNP    
Sbjct: 361 KEKETFKNNTISGTIRYDDFYKRSESSVNLPENKKLKSFDNNTKNGNGYVSVSGNPNSGL 420

Query: 421 XXXXXXXXXXXXXXXPRDIKIQHIDDVKTHLPXXXXXXXXXXXXXXXXXAGLINDNVHVV 480
                          PRDIKIQHIDDVKTHLP                 AGLINDNVHVV
Sbjct: 421 SNTYNSNSNLSFSSSPRDIKIQHIDDVKTHLPSSFSSSTSSTSSSLGSSAGLINDNVHVV 480

Query: 481 LKWRDQIDNPKKCKIAIISDDIVNALEXXXXXXXXXXXXXXXXXLPMVFNPMIKEWYMPN 540
           LKWRDQIDNPKKCKIAIISDDIVNALE                 LPMVFNPMIKEWYMPN
Sbjct: 481 LKWRDQIDNPKKCKIAIISDDIVNALESSSSKRKSNTNNNDNNTLPMVFNPMIKEWYMPN 540

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRDEIIETTFH 600
           LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRDEIIETTFH
Sbjct: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRDEIIETTFH 600

Query: 601 TAPSQGTLSVHDLTMIXXXXXXXFVSAKSDLSSFTPYSDYAGISRSSSSVGTATKKASLV 660
           TAPSQGTLSVHDLTMI       FVSAKSDLSSFTPYSDYAGISRSSSSVGTATKKASLV
Sbjct: 601 TAPSQGTLSVHDLTMIRSRRSSSFVSAKSDLSSFTPYSDYAGISRSSSSVGTATKKASLV 660

Query: 661 SLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSEDTNKMEIDDDGSSPFERPSFTHKVI 720
           SLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSEDTNKMEIDDDGSSPFERPSFTHKVI
Sbjct: 661 SLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSEDTNKMEIDDDGSSPFERPSFTHKVI 720

Query: 721 DCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLNSTYLNKIFTQFQKQHNDPTL 780
           DCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLNSTYLNKIFTQFQKQHNDPTL
Sbjct: 721 DCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLNSTYLNKIFTQFQKQHNDPTL 780

Query: 781 PASSSIGLTHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAPCNYSSQENKA 840
           PASSSIGLTHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAPCNYSSQENKA
Sbjct: 781 PASSSIGLTHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAPCNYSSQENKA 840

Query: 841 IS 842
           IS
Sbjct: 841 IS 842

>NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {ON}
           Anc_5.527 YDR422C
          Length = 787

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/871 (53%), Positives = 567/871 (65%), Gaps = 118/871 (13%)

Query: 1   MGNNPSTTDSENTAADLQEKKAG--------FHNKHLTRIQKQESPKERKGSITSHLFSS 52
           MGNNPS+  SE+T  D +E++           HNKHL  +Q      ERKGSI+S+LF++
Sbjct: 3   MGNNPSS--SEHTQKDKEEEEEEEAIKDTIILHNKHLDHLQD-----ERKGSISSNLFTN 55

Query: 53  KGSSKRHALMPKPIEAQGNIKSHNV--------FKKDYSMDEPLTNKGGIKNND---FND 101
           K SSKRHA     I +Q  + + N+        FKK YS+   + +   IK       + 
Sbjct: 56  KNSSKRHAT---SIMSQSKVTNDNIQNPPETVFFKKGYSISRSMQDDSDIKTEGQATVDS 112

Query: 102 ENIHETMASLSLVTSSDN-ERKKSMSFARPGPSTPTVQPTKHDITSLEGSTDVNTGIDNM 160
           ENIHE MASLSL TS +N E +KS SF  PGP+ PTV+ TKHD+T+ E S +        
Sbjct: 113 ENIHEPMASLSLKTSMENDENRKSFSFMSPGPANPTVEQTKHDVTNKENSFE-------- 164

Query: 161 NVAGDLNSHRPSIVALKNTLAESSIHPPSD---LSKTVSTSSNCQSFSTESSSSALHKTE 217
                   HRPSIV LK TL+ + +   ++   L+KT+S+SSN QS ST SSSS  ++T 
Sbjct: 165 --------HRPSIVTLKQTLSGTKVTNDNNIDKLNKTISSSSNSQSVSTASSSSIANRTG 216

Query: 218 SIDIPRRHSQGFNENYNETMLKHPTVHSYQYQYF--NNENTNNDGGLHKHKENFNDMQLS 275
           SIDIP+ +   F +   +T+ K  +VH+YQ+ YF  N+EN  N            D +LS
Sbjct: 217 SIDIPKENRYNFKDAM-DTIPKQHSVHAYQHDYFTINDENARNGS----------DGRLS 265

Query: 276 TSNDDEESGVLQSADIVVNQSTLQNALKRDMKRKRTDTISTNKSGAPTSDALKAKDEPEA 335
           TS D+ E GVLQ+ DIV+NQS L++A+KRDMKRKRTDT      GA T     A  + E 
Sbjct: 266 TSGDNSEPGVLQNVDIVLNQSFLKDAMKRDMKRKRTDT------GAST-----ATPDIEK 314

Query: 336 KTKTEKPAMSATAAMMLKLYGDTTLKEKETFKNNTISGTIRYDDFYKRSESSVNLPENKK 395
            T+ +KP +SATAAMMLKLYGD    EKE  K+   SG+  Y D Y+ S S +NL E KK
Sbjct: 315 PTEKKKP-ISATAAMMLKLYGDKNQMEKEEKKS---SGSYSYADQYEHSTSQINLREVKK 370

Query: 396 LKSFDNNTKNGNGYVSVSGNPXXXXXXXXXXXXXXXXXXXPRDIKIQHIDDVKTHLPXXX 455
           +K  +N+    N  +S                        P++IKIQHIDDVK   P   
Sbjct: 371 IKHIENDFVEDNFGIS-----------------------SPKEIKIQHIDDVKNAPPSSL 407

Query: 456 XXXXXXXXXXXXXXAGLINDNVHVVLKWRDQIDNPKKCKIAIISDDIVNALEXXXXXXXX 515
                             NDNV VVLKWRDQIDNPK CKI+I+SDDI +A+         
Sbjct: 408 SSSMSSSSFGPSSDEQ-TNDNVQVVLKWRDQIDNPKHCKISIVSDDISSAIPAKATKAGK 466

Query: 516 XXXXXXXXXLPMVFNPMIKEWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIV 575
                    LPM+FNPMIKEWY+PNL LPPGIYRLKFSIN D+THSNFLPTATDSMGNIV
Sbjct: 467 ---------LPMLFNPMIKEWYVPNLLLPPGIYRLKFSINGDLTHSNFLPTATDSMGNIV 517

Query: 576 NWFEVLPGYDAVEPYRDEIIETTFHTAPSQGTLSVHDLTMIXXXXXXXFVSAKSDLSSFT 635
           NWFEVLPGYD VEPYRDEIIETTFHT  SQGTL  ++ T I       FVSA  DL+S T
Sbjct: 518 NWFEVLPGYDTVEPYRDEIIETTFHTNGSQGTLRDNNPTTIRSRRSSSFVSANGDLASMT 577

Query: 636 PYSDYAGISRSSSSVGTATKKASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSE 695
           PYSDY GISRS+S++   +K+ SLVSLRG  KLDLFTP+EPKKI YS EIPELFKI+NS 
Sbjct: 578 PYSDYTGISRSNSALN--SKRTSLVSLRGVGKLDLFTPMEPKKIEYSNEIPELFKISNSI 635

Query: 696 DTNKMEIDDDGS----SPFERPSFTHKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYP 751
           +    +  D G     SPFE PSFT++V+DCNQDKLF+DLQ++GNIDAETAE LFLN+Y 
Sbjct: 636 EDEDDDEGDYGHNETLSPFEEPSFTNRVVDCNQDKLFSDLQKNGNIDAETAEMLFLNKYQ 695

Query: 752 IPDLPIYLNSTYLNKIFTQFQKQHNDPTLPA--SSSIGLTHIIPHVNLNHLLTSSIRDEI 809
           +PDLPIYLNS+YLNKIF QFQKQHNDPT  A  +S+IG+THIIPHVNLNHLLTSSIRDEI
Sbjct: 696 VPDLPIYLNSSYLNKIFLQFQKQHNDPTPSANTASTIGITHIIPHVNLNHLLTSSIRDEI 755

Query: 810 ISVACTTRYQGKFITQVMYAPCNYSSQENKA 840
           ISVACTTRYQGKFITQVMYAPCNY + E K+
Sbjct: 756 ISVACTTRYQGKFITQVMYAPCNYGNPEIKS 786

>CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422c SIP1 multicopy suppressor of SNF1
          Length = 744

 Score =  391 bits (1005), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 284/831 (34%), Positives = 408/831 (49%), Gaps = 155/831 (18%)

Query: 75  HNVFKKDYSMDEPLTNKGGIKNNDFNDENIHETMASLSLVTSSDNERKKSMSFARPGPST 134
           H++FK+DYS+ +  +           DE+I   MA LSL +S  +    ++  + PGPS 
Sbjct: 2   HSLFKEDYSVTKEASEPEA-------DESIDVNMAGLSLTSSMGD--GSALHISSPGPSN 52

Query: 135 PTVQPTKHDITSLEGSTDVNTGIDNMNVAGDLNSHRPSIVALKNTLAE------------ 182
            TVQ  K ++T  + S   ++   N   +  ++ HRPSIVALK +L E            
Sbjct: 53  ATVQTIKREVTHGDESPQGDSDDINAQHSRAMSEHRPSIVALKMSLKEVAEAAAAKRKNL 112

Query: 183 --SSIHPPSDLSKTVSTSSNCQSFSTESSSSALHKTESIDIPRRHSQGFNENYNETMLKH 240
              +I+   D  ++  +SS  + F   S S  + +T SIDIPR  S+    + N  +   
Sbjct: 113 PFRTINNVMDSQRSSISSSRDEIFVDASPSPVVTRTASIDIPR--SEDGRRSSNRLVNSK 170

Query: 241 PTVHSYQYQYFNNENTNNDGGLHKHKENFNDMQLSTSNDDEESGVLQSADIVVNQSTLQN 300
           P +++Y+                                D + G+LQ  D+V+NQ  L+ 
Sbjct: 171 PYLYNYEPS-------------------------GVPVGDPDGGMLQGTDVVLNQELLEQ 205

Query: 301 ALKRDMKRKRTDT-----------ISTNKSGAPTSDALKAKDEPEAKTKTEKPAMSATAA 349
           ALKRDMKRKR DT           + TN S       +  K+ PE    T     SATAA
Sbjct: 206 ALKRDMKRKRADTMQSSTVELNKKVDTNTSKNSNHTEI-MKNPPETAEPT-----SATAA 259

Query: 350 MMLKLYGDTTLKEKETFKNNTISGTIRYDDFYKRSESSVNLPENKKLKSFDNNTKNGNGY 409
           MM++LYGD TL  ++  K        + +D  K S +  N    KKLK F    +     
Sbjct: 260 MMMRLYGDRTLLNQQITK--------QKEDENKYSHTITNAAY-KKLKPFSGVKR----- 305

Query: 410 VSVSGNPXXXXXXXXXXXXXXXXXXXPRDIKIQHIDDVKTHLPXXXXXXXXXXXXXXXXX 469
             +  NP                     ++ +Q ++ ++ + P                 
Sbjct: 306 -KILSNP---------------------NLNLQPLEPIRPNEPPTSGQRTPNNSAHVHSE 343

Query: 470 AGLINDNVHVVLKWRDQID--NPKKCKIAIISDDIVNALEXX----XXXXXXXXXXXXXX 523
           +    D  +V+LKWRD  +  N K+ K+ ++S++I  +L+                    
Sbjct: 344 SPSP-DRTNVILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFN 402

Query: 524 XLPMVFNPMIKEWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPG 583
            +P+ ++    EWY+P+L LP GIYRL+F +N ++ HS+FLPTATD  GNI+NWFEVL G
Sbjct: 403 KIPLSYDSHNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRG 462

Query: 584 YDAVEPYRDE---------IIETTFHTAPSQG--------------------TLSVHDLT 614
           YD +EPYRDE          ++TT     + G                     L     +
Sbjct: 463 YDRIEPYRDESEIQSDYTSSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPS 522

Query: 615 MIXXXXXXXFVSAKSDLSSFTPYSDYAGISRSSSSVGTATKKASLVSLRGTNKLDLFTPI 674
                    + SAKS   S T +SDY G+SR++S V +A    +  + R  N L+ F PI
Sbjct: 523 KAQASRNSSYYSAKSFEKSITQFSDYTGVSRTNSMV-SAVSPINNANTRD-NDLEFFPPI 580

Query: 675 EPKKIAYSKEIPELFKIANSEDTNKMEIDDDGSSP------FERPSFTHKVIDCNQDKLF 728
           +PK   YS  IP LF+I+     +  ++DDD  +       ++RPSFT++V+DCNQD LF
Sbjct: 581 KPKVYEYSNNIPALFRIS----CDMEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDALF 636

Query: 729 ADLQRDGNIDAETAEALFLNRYPIPDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGL 788
            DLQ+ G +DAE AE LFL +Y +PDLP+YLNSTYLNKIF +F +       P++    +
Sbjct: 637 GDLQKGGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAG----PSTQDSSI 692

Query: 789 THIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAPCNYSSQENK 839
            HIIPHVNL HLLTSSIRD I+SVACTTRY GKFITQV+YAPC     E+K
Sbjct: 693 NHIIPHVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPCGNDQLESK 743

>TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {ON}
           Anc_5.527 YDR422C
          Length = 749

 Score =  353 bits (906), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 191/385 (49%), Positives = 244/385 (63%), Gaps = 39/385 (10%)

Query: 475 DNVHVVLKWRDQIDNPKKCKIAIISDDIVNALEXXXXXXXXXXXXXXXXXLPMVFNPMIK 534
           + VHV+LKWRDQI++P KCKI IIS DI +AL                    M ++    
Sbjct: 372 EKVHVILKWRDQIEDPSKCKITIISTDIASALNFDPSDKSFHGT------FSMKYDEKEN 425

Query: 535 EWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRDEI 594
            +Y+PNL+LPPGIY+ +F IN +I HSN LP+ATDS+GNIVNWFEV+PGY++VEP+R+EI
Sbjct: 426 NFYVPNLSLPPGIYKFQFVINGEIRHSNLLPSATDSVGNIVNWFEVIPGYESVEPFRNEI 485

Query: 595 -IETTFHTAPSQGTLSV-----HD-----LTMIXXXXXXXFVSAKSDLS-------SFTP 636
                    P Q   S      HD     + ++        ++A+   S       S TP
Sbjct: 486 DYHENMGIDPPQSDSSTSTGKHHDESPGKVPLVQPVPGRPPLAARHTSSYSNKQERSGTP 545

Query: 637 YSDYAGISRSSSSVGTATKKASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKIAN--- 693
           YSDY G+SR +S+V    +K+ L+  +  + +DL T ++PKK  YS EIPELFK  N   
Sbjct: 546 YSDYTGVSRCNSAV----RKSPLIH-QTLSSIDLVTALQPKKYEYSNEIPELFKAGNVLG 600

Query: 694 SEDTNKM---EIDDDGSSPFERPSFTHKVIDCNQDKLFADLQRDGNIDAETAEALFLNRY 750
             D N+             +++PSF   V+DCNQD LF  LQ+ G +DAETAE LFL +Y
Sbjct: 601 QSDENQFPTPPPPPMNPPSYDQPSFLENVVDCNQDNLFVSLQQGGLLDAETAEQLFLEKY 660

Query: 751 PIPDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEII 810
            +PDLP+YLNSTYLNKIF +FQK HN      S+S GL HIIPHVNLNHLLTSSIRDE+I
Sbjct: 661 TVPDLPVYLNSTYLNKIFNEFQK-HNS---LGSNSSGLNHIIPHVNLNHLLTSSIRDEMI 716

Query: 811 SVACTTRYQGKFITQVMYAPCNYSS 835
           SV CTTRY+GKFITQV+YAPC Y+S
Sbjct: 717 SVGCTTRYEGKFITQVVYAPCYYAS 741

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 102/322 (31%), Positives = 143/322 (44%), Gaps = 74/322 (22%)

Query: 1   MGNNPSTTDSENTAADLQEKKAGFHNKHLTRIQKQESPKERKGSITSHLFSSKGSSKRHA 60
           MGN+PS  + +     + +    F    L      E    R+ SITS LF S+ +  RH 
Sbjct: 1   MGNSPSVQEHQQQPHGVLDANHPFRRAQL----GNEMNSGRQQSITSQLFPSRNT--RH- 53

Query: 61  LMPKPIEAQGNIKSH----NVFKKDYSM----DEPLTNKGGIKNNDFNDENIHETMASLS 112
           + P  + A+ N   H    ++FK DYS+    +E   N G         ENI + MA LS
Sbjct: 54  VGPHSMNAKRNRHPHPQPPSLFKSDYSLRSTAEETPANTGST-------ENIRDNMAGLS 106

Query: 113 LVTSSDNERKKSMSFARPGPSTPTVQPTKHDITSLEGSTDVNTGIDN-MNVAGDLNSHR- 170
           L +S  NE  +  SF  PG STPTVQPT+        + D+   + N +N   +++SHR 
Sbjct: 107 LKSS--NENAQVPSFLTPGHSTPTVQPTRQAAVP---AADLKNKLQNGLNQQKEISSHRF 161

Query: 171 --PSIVALKNTLAESSIHPPSDLSKTVSTSSNCQSFSTESSSSALHKTESIDIPRRHSQG 228
             PS+VALK TL +                    S S+ S+S  +  + S+DI       
Sbjct: 162 QRPSVVALKKTLLDDG---------------ELHSTSSRSTSGDVVSSASLDI------- 199

Query: 229 FNENYNETMLKHPTVHSYQYQYFNNENTNNDGGLHKHKENFNDMQLSTSNDDEESGVLQS 288
                              Y   N ++    G   K K+   D   S  +D  + G LQS
Sbjct: 200 -------------------YSALNLDSPTQSGS--KAKDTDADPDTSDFDDISDDGYLQS 238

Query: 289 ADIVVNQSTLQNALKRDMKRKR 310
            D+V+NQS LQN L+RDMKRKR
Sbjct: 239 EDVVLNQSLLQNVLRRDMKRKR 260

>Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {ON}
           YDR422C (REAL)
          Length = 817

 Score =  345 bits (884), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 188/374 (50%), Positives = 241/374 (64%), Gaps = 26/374 (6%)

Query: 479 VVLKWRDQIDNPKKCKIAIISDDIVNALEXXXXXXXXXXXXXXXX-----XLPMVFNPMI 533
           V+LKW++  +     +++I+S+DI +AL+                      + MV++ + 
Sbjct: 454 VILKWKNYSNMAVTTEVSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYDNVH 513

Query: 534 KEWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRDE 593
           KEW+ P+L LPPGIYRL+FSIN  +THSN+LPTATDS GN VNWFEVLPGY  +EP+R+E
Sbjct: 514 KEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNE 573

Query: 594 I-----IETTFHT-APSQGTLSVHDLTMIXXXXXXXFVSAKSDLSSFTPYSDYAGISRSS 647
                 +E      +P +  L               + SAK      TP+SDY G+SRSS
Sbjct: 574 ADLGSQVEPVLEEESPIRPELK----RFSSSSRKSSYYSAKGVERPSTPFSDYRGLSRSS 629

Query: 648 SSVGTATKKASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSEDTNKMEIDDDGS 707
           S       + S V L+ ++ LDL   I+P+K+ YS EIP LF IA+   T+ +    D S
Sbjct: 630 S----VNMRDSFVRLKASS-LDLMAEIKPEKLEYSNEIPNLFNIADGGTTSVIRESRD-S 683

Query: 708 SPFERPSFTHKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLNSTYLNKI 767
           SP E+PSFT+KV+DCNQD LFA LQ+ GNIDAETAE +FL+RYPIPDLPIYLNS+YLNKI
Sbjct: 684 SPQEQPSFTYKVVDCNQDDLFATLQQGGNIDAETAETVFLSRYPIPDLPIYLNSSYLNKI 743

Query: 768 FTQFQKQHNDPTLPASSSIG-LTHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFITQV 826
                 Q N  + P     G + HIIPHVNLNHLLTSSIRDEIISVACTTRY+GKFITQV
Sbjct: 744 LN----QSNPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQV 799

Query: 827 MYAPCNYSSQENKA 840
           +YAPC Y +Q+ + 
Sbjct: 800 IYAPCYYKTQKARG 813

 Score =  136 bits (343), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 146/456 (32%), Positives = 212/456 (46%), Gaps = 125/456 (27%)

Query: 1   MGNNPSTTDSENTAADLQEKKAGFHNKHLTRIQKQESPKERKGSITSHLFSSKGS-SKRH 59
           MGN+PST D  ++     +K+ G+H             K+R+GSITS LF+++ S  KRH
Sbjct: 1   MGNSPSTQDPSHST----KKEHGYHFHETFN-------KDRQGSITSQLFNNRKSIHKRH 49

Query: 60  --------ALMPKPIEAQGNIKSHN---------------------VFKKDYSMDEPLTN 90
                     +P  ++    + SH+                     +FKKDYS++     
Sbjct: 50  VSHTSGHNGTIPSRMQL---LASHDSVTDCDDSVNDDTTIDKEPSLLFKKDYSLN----- 101

Query: 91  KGGIKNNDFNDENIHETMASLSLVTSSD----NERKKSMSFARPGPSTPTVQPTKHDITS 146
                  D ND     T+A+LSL+   D     E+ KS SF  PGPS  TV+ TK D+ +
Sbjct: 102 ----NTADGND----TTLANLSLIDDHDVGAPEEQVKSPSFLSPGPSMATVKQTKSDLEN 153

Query: 147 LEGSTDVNTGIDNMNVAGDLN-----SHRPSIVALKNTLAESSIHPPSDLSKTVSTSSNC 201
           L  ST   T +D     G  N      HR SI+ALK TL E+        S T S S   
Sbjct: 154 L--STSNYTTVDEATEDGRTNHPRHERHRSSIIALKKTLLEN--------SATASPSPTR 203

Query: 202 QSFSTESSSSALHKTESIDIPRRHSQGFNENYNETMLKHPTVHSYQYQYFNNENT---NN 258
            S    +S   L K +SID P + +            K P++H+YQYQY + + T   N+
Sbjct: 204 SSSVHSASMPPLTKMDSIDTPLKPAYS----------KKPSIHAYQYQYLSPDPTFSGNS 253

Query: 259 DGGLHKHKENFNDMQLSTSNDDEESGVLQSADIVVNQSTLQNALKRDMKR-------KRT 311
             G  K+ +N           D E+GVLQS D+V+NQS LQNALK+DM+R         T
Sbjct: 254 QAGKEKNSDNI----------DAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRANSSNST 303

Query: 312 DTI---STNKSGAPTSDALKAKDEPEAKTKTEKPAMSATAAMMLKLYGDTTLKEKETFKN 368
            TI   + N + + + + ++ K++  +        +SATA MM+KLYGD TL E++  K+
Sbjct: 304 CTIENSNNNNNYSSSENNIRNKEDSGSFNDNSNVPISATAKMMMKLYGDKTLMERDLNKH 363

Query: 369 NTISGTIRYDDFYKRSESSVNLPENKKLKSFDNNTK 404
            T +  +                +NKKLKS  N+ +
Sbjct: 364 QTKTKKV----------------QNKKLKSVSNSRR 383

>Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {ON}
           YDR422C (REAL)
          Length = 811

 Score =  343 bits (880), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 181/369 (49%), Positives = 238/369 (64%), Gaps = 15/369 (4%)

Query: 475 DNVHVVLKWRDQIDNPKKCKIAIISDDIVNALEXXXXX-----XXXXXXXXXXXXLPMVF 529
           +N  VVLKW+   +     +++I+S+DI +AL+                      + M++
Sbjct: 447 ENTLVVLKWKSDTNMTATTEVSIVSNDIASALKEQREVNLDDDASLDSEKPLNSRIRMIY 506

Query: 530 NPMIKEWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEP 589
           + + +EW++P+L LP GIYRL+FSIN  +THSNFLPTATDS GN VNWFEVLPGY  +EP
Sbjct: 507 DSVHREWFVPDLFLPAGIYRLQFSINGLLTHSNFLPTATDSEGNFVNWFEVLPGYHTIEP 566

Query: 590 YRDEI-IETTFHTAPSQGTLSVHDLTMIXXXXXXXFVSAKSDLSSFTPYSDYAGISRSSS 648
           +RDE  ++    +   +      +   +       + SAK      TP+SDY G+SRS+S
Sbjct: 567 FRDEADMDFQMRSTLDEEAPIRPEPKRLSSSRKSSYYSAKDGERPGTPFSDYRGLSRSNS 626

Query: 649 SVGTATKKASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSEDTNKMEIDDDGSS 708
                  + S V L+ ++ LDL   I+P+K+ YS EIP LF I  +  T   +   +  S
Sbjct: 627 ----VFLRGSFVRLKASS-LDLMAEIKPEKLEYSNEIPNLFNIGEASTTTSKD-HFERLS 680

Query: 709 PFERPSFTHKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLNSTYLNKIF 768
           P +RPSFTHKV+DCNQD LFA LQ+ GNIDAETAEA+FL+RYPIPDLPIYLNS+YLN+I 
Sbjct: 681 PQDRPSFTHKVVDCNQDDLFATLQQGGNIDAETAEAVFLSRYPIPDLPIYLNSSYLNRIL 740

Query: 769 TQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMY 828
            Q    + +         G+ HIIPHVNLNHLLTSSIRDEIISVACTTRY+GKFITQV+Y
Sbjct: 741 NQ---SNPNSEFHDGDEGGINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIY 797

Query: 829 APCNYSSQE 837
           APC Y +Q+
Sbjct: 798 APCYYKTQK 806

 Score =  135 bits (341), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 143/412 (34%), Positives = 200/412 (48%), Gaps = 96/412 (23%)

Query: 1   MGNNPSTTDSENTAADLQEKKAGFHNKHLTRIQKQESPKERKGSITSHLFSSKGS-SKRH 59
           MGN+PST D  +++    ++  G+H         +   K+R+GSITS LF++K S  KRH
Sbjct: 1   MGNSPSTQDPSHSS----KRNHGYH-------LHEAFNKDRQGSITSQLFNNKKSVHKRH 49

Query: 60  --------ALMPKPIEAQGNIKSHNV---------------------FKKDYSMDEPLTN 90
                   A +P  ++    + SH+V                     FKKDYS    L N
Sbjct: 50  TSHASSHKAAIPHRMQL---LASHDVASDCDSSVNNDTIIDKEPSPLFKKDYS----LAN 102

Query: 91  KGGIKNNDFNDENIHETMASLSLVTSSDN----ERKKSMSFARPGPSTPTVQPTKHDITS 146
                     DEN   T+A+LSL    D     E+ KS SF  PGPS  TV+ TK D+  
Sbjct: 103 AA--------DEN-DTTLANLSLNDDHDGSAPEEQVKSPSFLSPGPSMATVKQTKSDLDD 153

Query: 147 LE--GSTDVNTGIDNMNVAGDLNS-HRPSIVALKNTLAESSIHPPSDLSKTVSTSSNCQS 203
           L     T V+  ++N       +  HR SI+ALK TL E+S         T S S    S
Sbjct: 154 LSTVNCTVVDETMENERSGHPHHERHRSSIIALKKTLMENS--------ATASPSPTRSS 205

Query: 204 FSTESSSSALHKTESIDIPRRHSQGFNENYNETMLKHPTVHSYQYQYFNNENTNNDGGLH 263
               +S   L KT SIDIP +          +T  K P+VH+YQYQY + + T + G  H
Sbjct: 206 SVHSASLPPLTKTGSIDIPVK----------QTYSKKPSVHAYQYQYLSPDPTFS-GNSH 254

Query: 264 KHKENFNDMQLSTSNDDEESGVLQSADIVVNQSTLQNALKRDMKR-KRTDTISTNKSGAP 322
             KE   D      N D E+GVLQS D+V+NQS LQNALK+DM+R  R ++ ++  +   
Sbjct: 255 TGKEANGD------NIDAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRANSSNSTYTMGR 308

Query: 323 TSDALKAKDEPEAKTKTEKPA------MSATAAMMLKLYGDTTLKEKETFKN 368
            +    ++   + K  +  P+      +SATA MM+KLYGD TL E++  K+
Sbjct: 309 ENRINNSESNIDGKENSIDPSDDSTVPISATAKMMMKLYGDKTLMERDLNKH 360

>YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}
           SIP1Alternate beta-subunit of the Snf1p kinase complex,
           may confer substrate specificity; vacuolar protein
           containing KIS (Kinase-Interacting Sequence) and ASC
           (Association with Snf1 kinase Complex) domains involved
           in protein interactions
          Length = 815

 Score =  340 bits (872), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/376 (49%), Positives = 240/376 (63%), Gaps = 24/376 (6%)

Query: 475 DNVHVVLKWRDQIDNPKKCKIAIISDDIVNALEXXXXXXXXXXXXXXXX-----XLPMVF 529
           +N  VVLKW+D        ++ I+S DI +AL+                      + MV+
Sbjct: 450 ENTLVVLKWKDDGTVAATTEVFIVSTDIASALKEQRELTLDENASLDSEKQLNPRIRMVY 509

Query: 530 NPMIKEWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEP 589
           + + KEW++P+L LP GIYRL+FSIN  +THSNFLPTATDS GN VNWFEVLPGY  +EP
Sbjct: 510 DDVHKEWFVPDLFLPAGIYRLQFSINGILTHSNFLPTATDSEGNFVNWFEVLPGYHTIEP 569

Query: 590 YRDEI-----IETTF-HTAPSQGTLSVHDLTMIXXXXXXXFVSAKSDLSSFTPYSDYAGI 643
           +R+E      +E T     P +  L               + SAK      TP+SDY G+
Sbjct: 570 FRNEADIDSQVEPTLDEELPKRPELK----RFPSSSRKSSYYSAKGVERPSTPFSDYRGL 625

Query: 644 SRSSSSVGTATKKASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSEDTNKMEID 703
           SRSSS       + S V L+ ++ LDL   ++P+++ YS EIP LF I +   T  ++ D
Sbjct: 626 SRSSS----INMRDSFVRLKASS-LDLMAEVKPERLVYSNEIPNLFNIGDGS-TISVKGD 679

Query: 704 DDGSSPFERPSFTHKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLNSTY 763
            D   P E PSFTH+V+DCNQD LFA LQ+ GNIDAETAEA+FL+RYP+PDLPIYLNS+Y
Sbjct: 680 SDDVHPQEPPSFTHRVVDCNQDDLFATLQQGGNIDAETAEAVFLSRYPVPDLPIYLNSSY 739

Query: 764 LNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFI 823
           LN+I  Q   Q+++       +I   HIIPHVNLNHLLTSSIRDEIISVACTTRY+GKFI
Sbjct: 740 LNRILNQ-SNQNSESHERDEGAIN--HIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFI 796

Query: 824 TQVMYAPCNYSSQENK 839
           TQV+YAPC Y +Q+++
Sbjct: 797 TQVVYAPCYYKTQKSQ 812

 Score =  132 bits (331), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 135/413 (32%), Positives = 192/413 (46%), Gaps = 93/413 (22%)

Query: 1   MGNNPSTTDSENTAADLQEKKAGFHNKHLTRIQKQESPKERKGSITSHLFSSKGSSKRH- 59
           MGN+PST D  ++    +E    FH+            K+R+GSITS LF+++ S+ +  
Sbjct: 1   MGNSPSTQDPSHSTK--KEHGHHFHDAF---------NKDRQGSITSQLFNNRKSTHKRR 49

Query: 60  ---------ALMPK---------PIEAQGNIKS--------HNVFKKDYSMDEPLTNKGG 93
                    A+ P+           +  G + S         ++FKKDYS+         
Sbjct: 50  ASHTSEHNGAIPPRMQLLASHDPSTDCDGRMSSDTTIDKGPSHLFKKDYSLSSAA----- 104

Query: 94  IKNNDFNDENIHETMASLSLVTSSD----NERKKSMSFARPGPSTPTVQPTKHDITSLE- 148
               D ND     T+A+L+L    D     E+ KS SF  PGPS  TV+ TK D+  L  
Sbjct: 105 ----DVNDT----TLANLTLSDDHDVGAPEEQVKSPSFLSPGPSMATVKRTKSDLDDLST 156

Query: 149 -GSTDVNTGIDN-MNVAGDLNSHRPSIVALKNTLAESSIHPPSDLSKTVSTSSNCQSFST 206
              T V+   +N  N       HR SI+ALK  L ESS         T S S    S   
Sbjct: 157 LNYTMVDETTENERNDKPHHERHRSSIIALKKNLLESS--------ATASPSPTRSSSVH 208

Query: 207 ESSSSALHKTESIDIPRRHSQGFNENYNETMLKHPTVHSYQYQYFNNENTNNDGGLHKHK 266
            +S  AL KT+SIDIP R          +   K P++H+YQYQY NN+ T ++      +
Sbjct: 209 SASLPALTKTDSIDIPVR----------QPYSKKPSIHAYQYQYLNNDETFSENSQMDKE 258

Query: 267 ENFNDMQLSTSNDDEESGVLQSADIVVNQSTLQNALKRDMKR-KRTDTISTNKSGAPTSD 325
            N + +       D E+GVLQS D+V+NQS LQNALK+DM+R  R ++ ++  +    S 
Sbjct: 259 GNSDSV-------DAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRVNSSNSMYTAERISH 311

Query: 326 AL---------KAKDEPEAKTKTEKPAMSATAAMMLKLYGDTTLKEKETFKNN 369
           A          + K             +SATA MM+KLYGD TL E++  K++
Sbjct: 312 ANNNGNIENNTRNKGNAGGSNDDFTAPISATAKMMMKLYGDKTLMERDLNKHH 364

>ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]
           {ON} some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 818

 Score =  335 bits (860), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 179/390 (45%), Positives = 235/390 (60%), Gaps = 48/390 (12%)

Query: 476 NVHVVLKWRDQIDNPKKCKIAIISDDIVNALEXXXXXXXXXXXXXXXXXLPMVFNPMIKE 535
           +VHV +KWRD +      +++++S+DI + L                   PM +    KE
Sbjct: 438 DVHVAIKWRDHLPVDGTNRMSMVSEDIASTL------SFERQKHGARNTFPMRYEEETKE 491

Query: 536 WYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRDEI- 594
           W +P+L LP G+YRL+F IN ++THSN+LPTATDS+GN VNWFEV+PGY+ VEPYRDE+ 
Sbjct: 492 WVVPDLVLPVGVYRLQFLINGELTHSNYLPTATDSVGNFVNWFEVIPGYEKVEPYRDEVE 551

Query: 595 ----------------IETTFHTAPSQGTLSVHDL---TMIXXXXXXXFVSAKSDLSSFT 635
                              +     S+GT+ +  +     +         S+   + S T
Sbjct: 552 LDSGQPLNAGNNGIAGSVLSLENQGSEGTVLMEPVPGKVNVRPPLASMHHSSNRVIRSNT 611

Query: 636 PYSDYAGISRSSSSVGTATKKASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFK---IA 692
           PYSDY GISRSSS++  +    +      T+ LDL T ++PKK  YS EIPELFK   I 
Sbjct: 612 PYSDYTGISRSSSALRKSPINCT------TSSLDLHTALQPKKYKYSNEIPELFKTAPIT 665

Query: 693 NSEDTNK------ME---IDDDGSSPFERPSFTHKVIDCNQDKLFADLQRDGNIDAETAE 743
            + D N+      ME    D     P     F ++V+DCNQD+LF +LQ+ G +DAETAE
Sbjct: 666 KANDENEDFTFGHMEPPTYDWARGHPSSNAGFGNQVVDCNQDELFTELQQGGLLDAETAE 725

Query: 744 ALFLNRYPIPDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTS 803
            LFL +YP+PDLPIYLNS YLN+I ++FQK +     P   S G+ HIIPHVNLNHLLTS
Sbjct: 726 QLFLEKYPVPDLPIYLNSYYLNRIISEFQKNN----YPGGGSGGINHIIPHVNLNHLLTS 781

Query: 804 SIRDEIISVACTTRYQGKFITQVMYAPCNY 833
           SIRDE+ISV CTTRY+GKFITQV+YAPC Y
Sbjct: 782 SIRDEMISVGCTTRYEGKFITQVIYAPCYY 811

 Score = 70.9 bits (172), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 96/307 (31%), Positives = 132/307 (42%), Gaps = 88/307 (28%)

Query: 36  ESPKERKGSITSHLFSSKGSSKRHALMPKPIEAQGNIK--SHNV-------FKKDYSMDE 86
           E  K R+ SITS LF S+ +  RHA         GN+K  + NV       FKK+YS++E
Sbjct: 37  EVDKGRQSSITSQLFPSRKT--RHA-----PSGLGNLKRKTQNVVPHPPSLFKKNYSLEE 89

Query: 87  PLTNKGGIKN-----------------NDFND-----ENIHETMASLSLVTSSDNERKKS 124
                 G  N                  DFND     E++ E MA LS+ +S++      
Sbjct: 90  ASAGAQGPNNNNNDNHNVTLMAADDDPRDFNDTKTSTESVRENMAGLSIKSSNET----G 145

Query: 125 MSFARPGPSTPTVQPTKHD-ITSLEGSTDVNTGIDNMNVAGDLNSHRPSIVALKNTLAES 183
             F  PGP+TPTVQPTK + I  ++         DNM     +  +R S+VALK  L ES
Sbjct: 146 PMFFSPGPATPTVQPTKEEAIPPMD---------DNM-----IFHNRQSVVALKKNLEES 191

Query: 184 SIHPPSDLSKTVSTSSNCQSFSTESSSSALHKTESIDIPRRHSQGFNENYNETMLKHPTV 243
               PS  S    +S+N ++ +T   +  L       +PR+           T    P  
Sbjct: 192 --EQPSSRS---GSSANMETRTTPIDNRRLKP-----LPRQAVAAAITATATTAPATP-- 239

Query: 244 HSYQYQYFNNENTNNDGGLHKHKENFNDMQLSTSNDDEESGVLQSADIVVNQSTLQNALK 303
                    N   + D           D + S  ++  + G L S DIV+NQS L N +K
Sbjct: 240 ---------NGRPSID----------TDPESSDIDNISDDGYLHSKDIVLNQSLLHNVIK 280

Query: 304 RDMKRKR 310
           RDMKRKR
Sbjct: 281 RDMKRKR 287

>Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {ON}
           YDR422C (REAL)
          Length = 827

 Score =  334 bits (856), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 186/371 (50%), Positives = 233/371 (62%), Gaps = 29/371 (7%)

Query: 479 VVLKWRDQIDNPKKCKIAIISDDIVNALEXXXXX-----XXXXXXXXXXXXLPMVFNPMI 533
           V+LKW++  + P   +++IIS DI + L+                      + M+++ + 
Sbjct: 469 VILKWKNNSNMPATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVH 528

Query: 534 KEWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRDE 593
           KEW++P L LPPGIYRL+FSIN  +THSNFLPTATDS G  VNWFEVLPGY  +EP+RDE
Sbjct: 529 KEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDE 588

Query: 594 I-IETTF-HTAPSQGTLSVHDLTMIXXXXXXXFVSAKSDLSSFTPYSDYAGISRSSSSVG 651
              E+    T   +  +      +        + SAK      TP+SDY G+SRS+S   
Sbjct: 589 ADTESQVGSTIDVEAPIRPEPKRLSSSSRKSSYYSAKGVERPSTPFSDYRGLSRSNS--- 645

Query: 652 TATKKASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSEDTNKMEIDDDGSSPFE 711
            A  + S V L+ ++ LDL   I+P+ + YS EIP LF I N   T    I +D  S  +
Sbjct: 646 -ANLRDSFVRLKASS-LDLMAQIKPEILEYSNEIPSLFTIGNGSAT---PIQEDLPSQ-D 699

Query: 712 RPSFTHKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLNSTYLNKIFTQF 771
            PSFTHKV+DCNQD LFA LQ+ GNIDAETAE +FL+RYPIPDLPIYLNS+YLNKI  Q 
Sbjct: 700 LPSFTHKVVDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQG 759

Query: 772 QKQHNDPTLPASSS-----IGLTHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFITQV 826
                    P S S       + HIIPHVNLNHLLTSSIRDEIISVACTTRY+GKFITQV
Sbjct: 760 N--------PNSESGDKDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQV 811

Query: 827 MYAPCNYSSQE 837
           +YAPC Y +Q+
Sbjct: 812 IYAPCYYKTQK 822

 Score =  117 bits (294), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 135/427 (31%), Positives = 197/427 (46%), Gaps = 109/427 (25%)

Query: 1   MGNNPSTTDSENTAADLQEKKAGFHNKHLTRIQKQESPKERKGSITSHLFSSKGS-SKRH 59
           MGN+PST D  ++A     KK   H+ H      +   K+R+GSITS LF+++ S  KRH
Sbjct: 1   MGNSPSTQDPSHSA-----KKDHSHHLH------EAFNKDRQGSITSQLFNNRKSIHKRH 49

Query: 60  --------ALMPKPIEAQGNIKSHN---------------------VFKKDYSMDEPLTN 90
                   A +P  ++   +  S +                     +FKKDYS+      
Sbjct: 50  SSHANYDNAAIPPRMQLLASQPSTSSTSDCDDSTNNDVSAASEPSPLFKKDYSV------ 103

Query: 91  KGGIKNNDFNDENIHETMASLSLV----TSSDNERKKSMSFARPGPSTPTVQPTKH---D 143
               K  D N+     T+A+LSL      S+  E+ KS +F  PGPS  TV+ TK+   D
Sbjct: 104 ---AKAADDNET----TLANLSLYDRHDASAPEEQVKSPTFLSPGPSMATVKQTKNYPDD 156

Query: 144 ITSLEGSTDVNTGIDNMNVAGDLNSHRPSIVALKNTLAESSIHPPSDLSKTVSTSSNCQS 203
           ++++  +    T  D          HR SI+ALK TL E+S         T S S    S
Sbjct: 157 LSTVNNTIVDETIGDERKDHPHHERHRSSIIALKKTLLENS--------ATASPSPTRSS 208

Query: 204 FSTESSSSALHKTESIDIPRRHSQGFNENYNETMLKHPTVHSYQYQYFNNENT-NNDGGL 262
               +S   L K  SIDIP +          +T  K P+VH+YQYQY + + T ++D  L
Sbjct: 209 SIHSTSLLPLSKAGSIDIPIK----------QTYSKKPSVHAYQYQYLDPDPTLSDDSQL 258

Query: 263 HKHKENFNDMQLSTSNDDEESGVLQSADIVVNQSTLQNALKRDMKR-------KRTDTIS 315
                   D +  + N D E+GVLQS D+V+NQS LQNALK+D++R         T TI 
Sbjct: 259 --------DKESKSDNIDAEAGVLQSEDMVLNQSLLQNALKKDIQRLSRVNSSNSTYTID 310

Query: 316 T--------------NKSGAPTSDALKAKDEPEAKTKTEKPAMSATAAMMLKLYGDTTLK 361
           +              + + + + + +  K+            +SATA MM+KLYGD TL 
Sbjct: 311 SATHNNNNNNNNNSNSNNSSNSENNIGYKENSSDSNDDSGAPISATAKMMMKLYGDKTLM 370

Query: 362 EKETFKN 368
           E++  K+
Sbjct: 371 ERDLNKH 377

>SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {ON}
           some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 892

 Score =  335 bits (858), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 179/388 (46%), Positives = 235/388 (60%), Gaps = 44/388 (11%)

Query: 474 NDNVHVVLKWRDQIDNPKKCKIAIISDDIVNALEXXXXXXXXXXXXXXXXXLPMVFNPMI 533
           +D V+VVLKWRD I +PK CKI++IS DI   L                  +PM +    
Sbjct: 523 DDLVNVVLKWRDCIVDPKTCKISVISSDISAVL-----------ALQSSKKIPMEYETTE 571

Query: 534 KEWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRDE 593
           K W++PNL LPPG+Y+L+F IN ++ HSNFLPTATDS GN VNWFEVLPGY  +EP RD 
Sbjct: 572 KSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLRDV 631

Query: 594 IIETT-----FHTAPSQGTLSVHDLT---------MIXXXXXXXFVSAKSDLSSFTPYSD 639
            +++         +  +      D T         ++       + S+K    S TPYSD
Sbjct: 632 PVDSMNYGSDLGVSMKESVNGGSDFTITAPIPRPPLLSQATSSSYRSSKYIERSTTPYSD 691

Query: 640 YAGI-SRSSSSVGTATKKASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSEDTN 698
           Y GI SRS+S+         L++ + ++  D+F P+ PKK  YS +IPELFK+ + ED +
Sbjct: 692 YTGILSRSNSA-------RPLLNQKKSSSYDVFAPLPPKKYEYSTDIPELFKVNDEEDHD 744

Query: 699 KMEIDDDGS-------SPFERPSFTHKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYP 751
               +D  S       S  E+PSF  +V DCNQD+LF+DLQ+   IDA+ AE  FL +YP
Sbjct: 745 HDIPEDPPSYSSLLKGSEAEQPSFHCRVQDCNQDRLFSDLQQHDRIDAQAAEEFFLQKYP 804

Query: 752 IPDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIIS 811
           +PDLPIYLNS+YLNK+F Q QK +N       +   +  +IPHVNLNHLLTSSIR+EIIS
Sbjct: 805 VPDLPIYLNSSYLNKVFNQLQKDNN----AGETKAVVNPVIPHVNLNHLLTSSIREEIIS 860

Query: 812 VACTTRYQGKFITQVMYAPCNYSSQENK 839
           V CTTRY+GKFIT V+YAPC Y +   K
Sbjct: 861 VGCTTRYEGKFITHVVYAPCYYENTNRK 888

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 93/206 (45%), Gaps = 44/206 (21%)

Query: 130 PGPSTPTVQPTKHDITSLEGSTDVNTGIDNMNVAGDLNS--HRPSIVALKNTLAE----S 183
           PGP++PTV+PT+H+   L   ++V+   +N        S  HRPSIVALK +L E    S
Sbjct: 204 PGPASPTVEPTRHEAELLPTRSEVDGEAENDRYRDQFPSYLHRPSIVALKRSLVEGRIGS 263

Query: 184 SIHPPSDLSKTV----STSSNCQSFSTESSSSAL-------------HKTESIDIPRRHS 226
            +H  +    T     ST+ + +++  + ++  L              +T+SIDIP R  
Sbjct: 264 KLHVQTSNGDTTNASSSTAGSLKNYILDDNNRILLPSQLIDDDRQDSGRTDSIDIPGRG- 322

Query: 227 QGFNENYNETMLKHPTVHSYQYQYFNNENTNNDGGLHKHKENFNDMQLSTSNDDEESGVL 286
                            H+      +N +T     L   ++         S  D   G L
Sbjct: 323 -----------------HAATATIGSNRDTT---ALSDDQDTSLSPGSPVSQLDLSEGFL 362

Query: 287 QSADIVVNQSTLQNALKRDMKRKRTD 312
           +  D+++N + L++A+++DMKRKR +
Sbjct: 363 EDNDVLLNNAVLESAIRKDMKRKRQE 388

>ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR422C
           (SIP1)
          Length = 637

 Score =  296 bits (758), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 167/366 (45%), Positives = 217/366 (59%), Gaps = 44/366 (12%)

Query: 477 VHVVLKWRDQIDNPKKCKIAIISDDIVNALEXXXXXXXXXXXXXXXXXLPMVFNPMIKEW 536
           V V++KWRD + +P++ K++I+S DI + +                  + MVF+   + W
Sbjct: 306 VEVIIKWRDCLLDPQRTKLSIVSPDIASVIHKNSKRK-----------VAMVFSKDEQFW 354

Query: 537 YMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRD---- 592
             P+L LPPGIY+L+F IN  + HSNFLPTATDS  NIVNWFEV+P YD  EPYRD    
Sbjct: 355 VAPDLRLPPGIYKLQFLINGALRHSNFLPTATDSHSNIVNWFEVVPWYDRAEPYRDPAPE 414

Query: 593 EII---ETTFHTAPSQGTLSVHDLTMIXXXXXXXFVSAKSDLSSFTPYSDYAGISRSSSS 649
           E+    E+   TAP+ G   +  L           V  +S+    TP SDY GISRS S+
Sbjct: 415 EVAMPPESPQLTAPAAGRPPL--LKRGTSSSSRARVVERSN----TPISDYTGISRSGSA 468

Query: 650 VGTATKKASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSEDTNKMEIDDDGSSP 709
                 +  L   +  N ++L +PI    + YS EIPELFK             D  ++P
Sbjct: 469 ------RPLLAHHKSANSIEL-SPIPRCVLQYSTEIPELFKPEGCP-------PDPNTAP 514

Query: 710 FERPSFTHKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLNSTYLNKIFT 769
               SF   + DCNQD+LF  LQ D  + A+ AE + + +YP+PDLP+YLNS+YLN+IFT
Sbjct: 515 G---SFNENIQDCNQDELFRFLQEDWKMSAQEAEEVLVEKYPVPDLPVYLNSSYLNEIFT 571

Query: 770 QFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYA 829
           + Q+      +  SS    THIIPHVNLNHLLTSSIRDEIISV CTTRY+GKFITQ+MYA
Sbjct: 572 KLQRSSVTGDVKRSS---FTHIIPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIMYA 628

Query: 830 PCNYSS 835
           PC Y S
Sbjct: 629 PCYYES 634

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 77/343 (22%), Positives = 136/343 (39%), Gaps = 75/343 (21%)

Query: 1   MGNNPSTTDSENTAADLQEKKAGF-HNKHLTRIQKQESPKERKGSITSHLFS----SKGS 55
           MGN  S+T+      D    +AG       ++ +   + + R+ SITS LFS    ++  
Sbjct: 1   MGNTVSSTEGSKRRGD---GRAGTPAASGASQWETDSTDRGRQQSITSQLFSGRHHARSK 57

Query: 56  SKRHALMPKPIEAQGNIKSHNVFKKDYSMDEPLTNKGGIKNNDFNDENIHETMASLSLVT 115
            K          + G I S  +FK DY+++    +   I +           +A L L  
Sbjct: 58  WKFQGAGDSATGSSGGIAS--MFKCDYTLN---ADARSISSEQGETCQGMPNLAGLVLDA 112

Query: 116 SSDNERKKSMSFARPGPSTPTVQPTKHDITSLEGSTDVNTGIDNMNVAGDLNSHRPSIVA 175
            +   R        PGPST TV+   H  T+LE S         M+      +HRPSI A
Sbjct: 113 CTQGIRS-------PGPSTATVE---H--TNLEAS---------MSPELASQTHRPSISA 151

Query: 176 LKNTLAESSIHPPSDLSKTVSTSSNCQSFSTESSSSALHKTESIDIPRRHSQGFNENYNE 235
           LK +L +            V   +N +  + +  ++    + +IDIP             
Sbjct: 152 LKQSLIQ------------VQGQTNSRHRAEDIDTAQYVPSATIDIP------------- 186

Query: 236 TMLKHPTVHSYQYQYFNNENTNNDGGLHKHKENFNDMQLSTSNDDEESGVLQSADIVVNQ 295
                           +N +TN     H+  ++     L +    +    ++++++V+N+
Sbjct: 187 ---------------CSNPSTNTASVTHRADDSSTRSSLLSLFTQDVEEYIEASEVVLNE 231

Query: 296 STLQNALKRDMKRKRTDTISTNKSGAPTSDALKAKDEPEAKTK 338
           S + + +++D++RKR        + A    A  AK +P+AK K
Sbjct: 232 SLVDSVVRKDLRRKRQLQQQCGATRAAEQAAETAK-QPDAKKK 273

>KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422C SIP1 Alternate beta-subunit of the Snf1p kinase
           complex may confer substrate specificity vacuolar
           protein containing KIS (Kinase-Interacting Sequence) and
           ASC (Association with Snf1 kinase Complex) domains
           involved in protein interactions
          Length = 709

 Score =  291 bits (745), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 159/376 (42%), Positives = 214/376 (56%), Gaps = 47/376 (12%)

Query: 478 HVVLKWRDQIDNPKKCKIAIISDDIVNALEXXXXXXXXXXXXXXXXXLPMVFNPMIKEWY 537
           HV+L W+D I +PK CK++I+S DI + L                  +PMVF+     W 
Sbjct: 362 HVILNWKDNIVDPKTCKMSIVSKDISSTLNPHKKFSK----------IPMVFDMERNCWT 411

Query: 538 MPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRDEIIET 597
             +L LP G+Y+ +F IN ++ HS++LPTATDS GN VNWFEV+ G+D++EP RD I   
Sbjct: 412 AHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDVISSE 471

Query: 598 TF----------HTAPSQGTLSVHDLTMIXXXXXXXFVSAKSDLSSFTPYSDYAGISRSS 647
                         AP +  L     +          V       S TP+SDY G+   S
Sbjct: 472 DVKLSKDQIAVEQPAPERPALGSDGSSSSNWKGSSRHVE-----RSGTPFSDYTGLCSRS 526

Query: 648 SSVGTATKKASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSEDT------NKME 701
                  +         T+  DL  P+   K  Y+ EIPELFK AN + +       + E
Sbjct: 527 ELTKPELRH------NNTSSYDLLAPVPRPKYEYTDEIPELFK-ANFDGSLVPPPYEERE 579

Query: 702 IDDDGSSPFERPSFTHKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLNS 761
           +  DGS   + PSF H+V DCNQD LFADLQ++G ID++ AE  FL +YP PDLP+YL+S
Sbjct: 580 LTKDGSQ--KPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDS 637

Query: 762 TYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISVACTTRYQGK 821
           ++LN +F+ FQ +         S   + HI+PHVNLNHLLTSSIRDEIISV CTTRY+GK
Sbjct: 638 SFLNAVFSGFQDK-------TDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGK 690

Query: 822 FITQVMYAPCNYSSQE 837
           FITQ++Y PC YS+++
Sbjct: 691 FITQIIYTPCYYSNKD 706

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 108/468 (23%), Positives = 163/468 (34%), Gaps = 168/468 (35%)

Query: 1   MGNNPSTTDSENTAADLQEKKAGFHNKHLTRIQKQESPKERKGSITSHLFSSK--GSSKR 58
           MGNNPST              A   NK ++++ ++  P+ R+ SITS LF S+  G +  
Sbjct: 1   MGNNPST--------------ANMQNKRVSQLAQE--PRGRQDSITSQLFPSRTSGRNPE 44

Query: 59  HALMPKPIEAQGNIKS---------HNVFKKDYSMD-----EPLTNKGGIKNN------- 97
             +  K     GN  S          + F+K+Y+++      P   K  I  N       
Sbjct: 45  SKVGWKSRVLHGNRPSASPASTPPVQSPFRKNYTLEVTTESAPYNLKKSISGNPAPPMCT 104

Query: 98  -------DFNDENIHETMASLSLVTS-SDNERKKSMSFA----------RPGPSTPTVQP 139
                  + +  ++ + +A LSL  S S   RK S               PGPSTP V+ 
Sbjct: 105 TTHASADESSSSSLRDHLAELSLQNSESQPNRKTSPGLGPAPAPAPVLRSPGPSTPVVKY 164

Query: 140 TKHDITSLEGSTDVNTGIDNMNVAGDLNSHRPSIVALKNTLAES----SIHPPSDLSKTV 195
           TKHD  S + S                     SI +LK  L E     +IHPP       
Sbjct: 165 TKHDAISDQIS---------------------SITSLKKMLVEGRVGDNIHPP------- 196

Query: 196 STSSNCQSFSTESSSSALHKTESIDIPRRHSQGFNENYNETMLKHPTVHSYQYQYFNNEN 255
                                 SIDIPRR S   ++ Y                      
Sbjct: 197 --------------------PTSIDIPRRPSAALSDAY---------------------- 214

Query: 256 TNNDGGLHKHKENFNDMQLSTSNDDEESGVLQSADIVVNQSTLQNALKRDMKRKRTDTIS 315
                              S   DDEES +  + D+V+N S L+NA+KR    K+   + 
Sbjct: 215 ------------------FSDDGDDEESLLQGTNDVVINNSVLENAMKRKRGTKKNKGVG 256

Query: 316 TN------------KSGAPTSDALKAKDEPEAKTKTEKPA---MSATAAMMLKLYGDTTL 360
            +            K   P       +D P  +    +P+   +   +A + +L  D +L
Sbjct: 257 ASSESHEHISYPGLKKLKPLEHGGDKRDLPHFRAMHPRPSEDNVGPDSAAIPRLITD-SL 315

Query: 361 KEKETFKNNTISGTIRYDDFYKRSESSVNLPENKKLKSFDNNTKNGNG 408
              ++F+  T+     Y+   +   SS NL  +    S D +   G G
Sbjct: 316 NRIDSFEKGTVE---HYEGANESGFSSQNLTSSDMRDSDDADEDRGPG 360

>TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5.527
            YDR422C
          Length = 1016

 Score =  285 bits (730), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 154/358 (43%), Positives = 219/358 (61%), Gaps = 18/358 (5%)

Query: 478  HVVLKWRDQIDNPK--KCKIAIISDDIVNALEXXXXXXXXXXXXXXXXXLPMVFNPMIKE 535
            +V++K+RD ++  +  + KI +IS DI   L                  + +V+N   K 
Sbjct: 663  NVIIKYRDPMEESEIPETKIQLISKDINTTLHYDTTDLLTENNK-----MELVYNKDEKA 717

Query: 536  WYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRDEII 595
            W +PNL LPPGIY+++F +N+D+ HS+FLPTATD  GNIVNWFEVL GYD +EP+RDE I
Sbjct: 718  WILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFRDENI 777

Query: 596  ETTFHTAPSQGTLSVHDLTMIXXXXXXXFVSAKSDLSSFTPYSDYAGISRSSSSVGTATK 655
             +  +   S GTL  + +           ++      S TP S+Y G+SRS+S   +++ 
Sbjct: 778  SSADN---SDGTLMQNIIPEKLKTISMTKMAGNGSKGS-TPRSNYTGVSRSNSLSASSSS 833

Query: 656  KASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSEDTNKMEIDDDGSSPFERPSF 715
                        ++LFTP+EP K+ YS EIPE+FK  N+ + N            +RP  
Sbjct: 834  SVWKSV-----NVNLFTPLEPNKVEYSTEIPEIFK--NTTENNTSNAPMQYHPERKRPGL 886

Query: 716  THKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLNSTYLNKIFTQFQKQH 775
             H V+DC+Q++LF DL  DG +D ETAE +FL++YP+P+LPIYLNS Y+ +I  +  +  
Sbjct: 887  LHNVVDCSQEELFGDLLADGLMDTETAEQMFLDKYPVPELPIYLNSKYMTQIVGEINQPS 946

Query: 776  NDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAPCNY 833
                  + ++  L HIIPHVNL HLLTSSIR+E+ISVACTTRY+GKF+TQ++Y PC Y
Sbjct: 947  GSGPPSSLNNNDLNHIIPHVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPCFY 1004

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 82/291 (28%), Positives = 128/291 (43%), Gaps = 58/291 (19%)

Query: 1   MGNNPSTTDSENTAADLQEKKAGFHNKHLTRIQKQESPKERKGSITSHLFSSKGSSKRHA 60
           MGNNPS  DSE      +      +N             ER  SITS LF S+ SS R  
Sbjct: 1   MGNNPSILDSETN----ESTNRNINNNSNNNNNSSTLIIERNDSITSTLFPSRSSSSRQK 56

Query: 61  LMPKPIEAQG-NIKSHNVFKKDYSMDE----------PLTNKGGIKNNDFNDENIHETMA 109
            + K    QG N  + ++FK++YS+ +          PL++     N  +N+   + + A
Sbjct: 57  YLTK---NQGENPNNVSLFKQNYSLTQNNETYEPILKPLSSPENDTNITYNNSTFNNSRA 113

Query: 110 SLSL---VTSSDNE----RKKSMSFARPGPSTPTVQPTKHDITSLEGSTDVNTGID---- 158
           S +    +  +DN+    +++ +    PGPS PTV+ +K      E       GI     
Sbjct: 114 SKNSDQDIIRNDNDPINNQQQPLLILSPGPSHPTVEQSKQQANYNEDQEMFKNGITQTKN 173

Query: 159 -------------------NMNVAGDLNSHRPSIVALKNTLAESSIHPPSDLSKTVSTSS 199
                              NMN     +SHRPS+VALK +L E+     +D  +  S+ S
Sbjct: 174 SSSYRNTSPNIPSNTNNIINMNSHNYASSHRPSVVALKKSLEETLDFTTNDPRQIYSSRS 233

Query: 200 NCQSFSTESSSSALHKTESIDIPRRH------SQGFNENYNETMLKHPTVH 244
           +  SFST S++    ++ SIDIP R+      SQ F+ ++N    ++  +H
Sbjct: 234 SQSSFSTMSNT----RSASIDIPTRNSASRVGSQYFDADFNVPRFENDFLH 280

>Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C
           (SIP1) - SNF1 protein kinase substrate [contig 191]
           PARTIAL
          Length = 309

 Score =  261 bits (667), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 144/326 (44%), Positives = 196/326 (60%), Gaps = 35/326 (10%)

Query: 527 MVFNPMIKEWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDA 586
           MVF+     W  P+L LP G+Y+ +F IN ++ HS FLPTATDS GN VNWFEV+ G+  
Sbjct: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60

Query: 587 VEPYRDEIIETTFHTAPSQGTLSVHDLTMIXXXXXXXFVSAKSDLSSF-----------T 635
           +EP RD +I   F    +Q  +S +D +          +S  S  S++           T
Sbjct: 61  IEPSRD-VISNDF--TENQVAISANDPSA---SPRPPILSGSSSFSNWKNSAKHIERSGT 114

Query: 636 PYSDYAGISRSSSSVGTATKKASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSE 695
           PYSDY G+   +       +       + T+  DL  P+      YS EIPELFK AN E
Sbjct: 115 PYSDYTGLCSRTDLAKPELRH------KNTSSYDLLAPVPRPVYEYSNEIPELFK-ANFE 167

Query: 696 DTN---KMEIDDDGSSPFE-RPSFTHKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYP 751
            ++     +      +P + +PSF H+V DCNQD LFADLQ++G ID++ AE  FL +YP
Sbjct: 168 GSSTPPPYQESVPSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYP 227

Query: 752 IPDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIIS 811
            PDLP+YL+S++LN +F  FQ++++       +   L HI+PHVNLNHLLTSSIRDEIIS
Sbjct: 228 TPDLPVYLDSSFLNAVFRGFQEKND-------TKSKLNHIVPHVNLNHLLTSSIRDEIIS 280

Query: 812 VACTTRYQGKFITQVMYAPCNYSSQE 837
           V CTTRY+GKFITQ++Y PC Y ++E
Sbjct: 281 VGCTTRYEGKFITQIIYTPCYYGNKE 306

>Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar to
           Ashbya gossypii ADR194C
          Length = 721

 Score =  272 bits (695), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 164/381 (43%), Positives = 227/381 (59%), Gaps = 37/381 (9%)

Query: 475 DNVHVVLKWRDQIDNPKKCKIAIISDDIVNALEXXXXXXXXXXXXXXXXXLPMVFNPMIK 534
           + V V++KWRD   +P+  KI+IIS DI + ++                 +PMV+    +
Sbjct: 360 ERVQVIIKWRDTNVDPRTSKISIISSDIASVVQPTRKRKK----------IPMVYLEQEQ 409

Query: 535 EWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRDEI 594
            W   +L LP GIY+L F IN  + HSN+LPTATDS+ NIVNWFEV+PGYD +EPYRD  
Sbjct: 410 CWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVVPGYDQIEPYRDAA 469

Query: 595 IETTFH--TAPSQGTLSVHDLTMIXXXXXXXFVSAKSDLSSF--------TPYSDYAGI- 643
           IE + +   A ++ +L + + T          ++  +  SS         TP SDY G+ 
Sbjct: 470 IERSPNELAAYNETSLLLTNETPSPANIRPPLINRGTSSSSRARVIERTNTPISDYTGVL 529

Query: 644 SRSSSSVGTATKKASLVSLRGTNKLDL-FTPIEPKKIAYSKEIPELFKIANS------ED 696
           +R+S S        ++   +  N  D+   P +P  I YS ++PELFK+ N+      + 
Sbjct: 530 ARNSCS------NPAIYRHKSNNSTDVDILPKQPTLI-YSSDVPELFKVGNASTGGSQQG 582

Query: 697 TNKMEIDDDGSSPFERPSFTHKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLP 756
           ++K ++ +      + P+F   V DCNQD+LF  LQ   N++A+ AE +FL +Y +PDLP
Sbjct: 583 SDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFLEKYSVPDLP 642

Query: 757 IYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISVACTT 816
           IYLNST LN+IF + Q+      LP   S  LTHIIPHVNLNHLLTS+IRDEIISV CTT
Sbjct: 643 IYLNSTSLNEIFNKLQQNSAMGDLPKRKS--LTHIIPHVNLNHLLTSNIRDEIISVGCTT 700

Query: 817 RYQGKFITQVMYAPCNYSSQE 837
           RY+GKFITQ+MYAPC Y + E
Sbjct: 701 RYEGKFITQIMYAPCYYENYE 721

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 82/322 (25%), Positives = 140/322 (43%), Gaps = 76/322 (23%)

Query: 32  IQKQESPKERKGSITSHLF------SSKGSSKRHALMPKPIEAQGNIKSHNVFKKDYSMD 85
           +Q     + R+ SITS LF       SK  S+R+ + P  +   G +   ++FK+DYS+ 
Sbjct: 41  VQHGTKERVRQQSITSQLFPGRHQARSKWKSQRN-VAPGAVSGVGGVD--HLFKRDYSLS 97

Query: 86  EPLTNKG--GIKNNDFNDENIHETMASLSLVTSSDNERKKSMSFARPGPSTPTVQPTKHD 143
           +  +  G  G++     D      +A L L    D+  +  MS   PGPS+ TV+ +K  
Sbjct: 98  DDSSAVGMEGVQEEGGVDLIGMPNVAGLKL----DSRAQAIMS---PGPSSATVEHSK-- 148

Query: 144 ITSLEGSTDVNTGIDNMNVAGDLNSHRPSIVALKNTLAESSIHPPSDLSKTVSTSSNCQS 203
              LE S        +  +A  +  HRPSIVALK  L +  +  P           +   
Sbjct: 149 ---LEASI-------SPELAAQV--HRPSIVALKQNLIQGHMGHPLHSPLRDDYDGDDDD 196

Query: 204 FSTESSSSALHKTESIDIPRRHSQGFNENYNETMLKHPTVHSYQYQYFNNENTNNDGGLH 263
             T  SSS +  + +IDIP                           Y N    N    + 
Sbjct: 197 GDTAPSSSYV-PSATIDIP---------------------------YSNPSTMNTLSIIA 228

Query: 264 KHKENFND----MQLSTSNDDEESGVLQSADIVVNQSTLQNALKRDMKRKRTDTISTNKS 319
           +H+E+++     + +ST + D   G ++++D+V++++ + + +K DM+RKR       K 
Sbjct: 229 QHQEDYSTRSSAVSISTQDLD---GYIENSDVVLSEALVDSVVKNDMRRKR----QLQKQ 281

Query: 320 GAPTSDAL-----KAKDEPEAK 336
            A  S+A+     +A  +P+ K
Sbjct: 282 SAEASEAINENKNEANQQPDVK 303

>KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.527
           YDR422C
          Length = 561

 Score =  255 bits (651), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 156/376 (41%), Positives = 207/376 (55%), Gaps = 39/376 (10%)

Query: 474 NDNVHVVLKWRD-QIDNPKKCKIAIISDDIVNALEXXXXXXXXXXXXXXXXXLPMVFNPM 532
           N+NV V+LKWRD Q+   +    AI S DI + L                  L + ++  
Sbjct: 212 NENVRVILKWRDPQLQPYQGTGAAIKSHDIYSTLRAIKSELITPERENKEDLLYLDYDAK 271

Query: 533 IKEWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRD 592
            K+W++P+L LPPGIYRLKF IN  + HSNFLPTATD+ G IVNWFEVLPGY+ +EPYRD
Sbjct: 272 KKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRD 331

Query: 593 EII----ETTFHTAPSQGTLSVHDLTMIXXXXXXXFVSAKSDLSSFTPYSDYAGISRSSS 648
           E +    + +  + P + T  V D   I          +KS+L    P      +++ SS
Sbjct: 332 ESMIGQDDESIDSQPYKSTTDVTDYAGISRSSSVVSKHSKSNLR--LPNLHITSLNKESS 389

Query: 649 SVGTATKKASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKI--ANSEDTN-----KME 701
                   AS+     TN+ +    +   K  YS EIPELF+    N+  TN     + E
Sbjct: 390 --------ASVNEANETNEGNDIQLLPEPKYEYSTEIPELFQFDDVNTRKTNDIKEVRKE 441

Query: 702 IDDDGSSPFERPSFT-HKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLN 760
              +   P  +  FT  +V++ NQD LFA +Q+ G +  E AE  FL ++ + DLPIYLN
Sbjct: 442 SKLETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLN 501

Query: 761 STYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISVACTTRYQG 820
           STYLNK F                S  + HIIPHVNL HLLT+SI+++II V CTTRY G
Sbjct: 502 STYLNKNF----------------SGEVNHIIPHVNLRHLLTTSIKEDIICVGCTTRYAG 545

Query: 821 KFITQVMYAPCNYSSQ 836
           KFITQV+YAPC+Y  Q
Sbjct: 546 KFITQVIYAPCSYDKQ 561

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 68/130 (52%), Gaps = 22/130 (16%)

Query: 280 DEESGVLQSADIVVNQSTLQNALKRDMKRKRTDTISTNKSGAPTSDALKAKDEPEAKTKT 339
           D +SG++Q+ D V+NQ+ LQ+A+K+DMKRKR D   +N SG   +     + + + +   
Sbjct: 63  DPDSGIVQNQDRVLNQAILQHAIKKDMKRKRND---SNASGTAAAVLHNHRQQQQQEENV 119

Query: 340 EKPA------------MSATAAMMLKLYGDTTLKEKETFKNNTISGTIRYDDFYKRSESS 387
           E P             MSATAA+MLKLYGD      E  +   +          K + S+
Sbjct: 120 EGPTLVGAQTGAASGEMSATAAIMLKLYGDKNQLAHEVHEAREVHEV-------KSAASN 172

Query: 388 VNLPENKKLK 397
           V LPE KK+K
Sbjct: 173 VRLPEVKKIK 182

>KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.527
           YDR422C
          Length = 466

 Score =  237 bits (604), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 144/354 (40%), Positives = 195/354 (55%), Gaps = 54/354 (15%)

Query: 480 VLKWRDQIDNPKKCKIAIISDDIVNAL---EXXXXXXXXXXXXXXXXXLPMVFNPMIKEW 536
           +LKWR+ ID+     +AI+S DIV+ L                     + ++++ +  EW
Sbjct: 157 ILKWREPIDH--NSAVAIVSKDIVSTLLTIAKTHKSSIITFIERKKFKINLLYDIVTNEW 214

Query: 537 YMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRDEIIE 596
           Y+PNL LPPGIY+L+F IN ++ HSN+LPTAT++ GNIVNWFEV+ GY  +EPYRDE  E
Sbjct: 215 YLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDE--E 272

Query: 597 TTFHTAPSQGTLSVHDLTMIXXXXXXXFVSAKSDLSSFTPYSDYAGISRSSSSVGTATKK 656
              H   S    S+                      S    +DYAGISRSSS V   +  
Sbjct: 273 RIIHREKSTANESI----------------------SSNSLTDYAGISRSSSIVSNKSSL 310

Query: 657 ASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSEDTNKMEIDDDGSSPFERPSFT 716
            S         L+        +I Y+ EIPE+FK  ++ ++N      D S         
Sbjct: 311 ISSSLKLTNLNLN------DDEIKYTNEIPEIFKFDSTANSNVNNQAFDMS--------L 356

Query: 717 HKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLNSTYLNKIFTQFQKQHN 776
            KVID NQD +FA LQ+   ++ + AE  FLNR+ I DLPIYLNS +LNKIF +      
Sbjct: 357 SKVIDLNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLPIYLNSNFLNKIFIR------ 410

Query: 777 DPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAP 830
                 +++    + +PHVNLNHLLT+SI+D+ + VACTTRY GKFITQ+MYAP
Sbjct: 411 -----DNNNETTNNTVPHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459

 Score = 35.0 bits (79), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 33/72 (45%), Gaps = 33/72 (45%)

Query: 293 VNQSTLQNALKRDMKRKRTDTISTNKSGAPTSDALKAKDEPEAKTKTEKPAMSATAAMML 352
           +NQSTLQN     MKRKR+                            E+P MS TA  ML
Sbjct: 81  INQSTLQNV----MKRKRS----------------------------EQP-MSQTAKTML 107

Query: 353 KLYGDTTLKEKE 364
           KLYG++  +E+E
Sbjct: 108 KLYGNSAERERE 119

>Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {ON}
           complement(41725..43992) [2268 nt, 756 aa]
          Length = 755

 Score =  224 bits (572), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 140/385 (36%), Positives = 208/385 (54%), Gaps = 49/385 (12%)

Query: 472 LINDNVHVVLKWRDQIDNPKKCKIAIISDDIVNALEXXXXXXXXXXXXXXXXXLPMVFNP 531
           L ++NV V LKWRD ID+ +   I+I+S++I++ +                    MV+ P
Sbjct: 389 LGSENVRVFLKWRDLIDDIENANISIVSNEILSVICMNDLDSENSDSAR------MVYYP 442

Query: 532 MIKEWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYR 591
              EW    L LPPGIY+L+F++N  + HS++LPTATD++GNIVNWFEV  GY+++EP+R
Sbjct: 443 DTSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFR 502

Query: 592 D------EIIETTFHTAPSQGTLSVHDLTMIXXXXXXXFVSAKSDLSSFTPYSDYAGISR 645
           D      EI        P+  TL +   ++        F +++      TPYSD+AGI+R
Sbjct: 503 DNDYVKNEISGGILQPIPN--TLGIP--SVSSQLSSFSFHASRPT----TPYSDFAGINR 554

Query: 646 SSSSVGTATKKASLVSLRGTN-KLDLFTPIEPKKIAYSKEIPELFKIA------------ 692
           SS        +     ++ TN  L+  T +   K  Y+ EIPE++K              
Sbjct: 555 SSP----LPLREKSPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVDLDLTTAKATET 610

Query: 693 --NSEDTNK--MEIDDDGSSPFERPSFTHKVIDCNQDKLFADLQRD--GNIDAETAEALF 746
             + ED  K  + +   G+S F      + VI C+Q  LF  L ++    ++ +  E +F
Sbjct: 611 TTDDEDITKPPLYLGTGGNSIF------NDVIGCSQRDLFEKLSKNTGKGLNTDELEKIF 664

Query: 747 LNRYPIPDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIR 806
           L +YPI DLPIYLN+ Y+NK   Q +       +       + HI+PHVN+ HLLT +I+
Sbjct: 665 LAKYPITDLPIYLNTDYMNKALEQHRNIVGVDDVMQEEINVVNHIVPHVNIKHLLTHNIQ 724

Query: 807 DEIISVACTTRYQGKFITQVMYAPC 831
           D +I+VACT RY GKFITQV+Y+PC
Sbjct: 725 DSVIAVACTVRYGGKFITQVVYSPC 749

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 71/231 (30%), Positives = 110/231 (47%), Gaps = 24/231 (10%)

Query: 39  KERKGSITSHLFSSKGSSKRHALMPKPIEAQGNIKSHN---------VFKKDYSMDEPLT 89
           K+R+GSI S LF+S+ +S R+ +  + + A+ N+ + N         +FKKDYSM     
Sbjct: 36  KQRQGSIRSELFTSRNNSNRNKIYSE-LAARNNLTTINSSNTNVKESLFKKDYSMGRHPN 94

Query: 90  NKGGIKNN-DFNDENIHETMASLSLVTSSDNERKKSMSFARPGPSTPTVQPTKHDITSLE 148
               +KN  DF       +    S   SS+ +   + SF   GPST TV+ +   +  L+
Sbjct: 95  TVNHVKNRVDFTRN---SSNEYSSSSLSSNTDSAYTPSFFSLGPSTATVEQSTEKVIRLD 151

Query: 149 GSTDVNTGIDNMNVAGDLNSHRPSIVALKNTLAESSIHPP-SDLSKTVSTSSNCQSFSTE 207
                +  + +       + HRPSI+ALK  L ESS   P  D   +    S   S ST 
Sbjct: 152 EQHHPHQNLASKKDIVINHEHRPSILALKQNLYESSSGVPLYDSQPSSEVPSELHSPSTR 211

Query: 208 SSSSALHKTESIDIPRRHSQGFNENYNETMLKHPTVHSYQYQYFNNENTNN 258
           S      K+ SIDIP+       +N N+  L++P + + +Y   NN+N +N
Sbjct: 212 SFER--QKSVSIDIPQ-------DNSNKKDLRNPILINLEYNERNNKNESN 253

>Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON}
           (229891..231894) [2004 nt, 668 aa]
          Length = 667

 Score =  193 bits (491), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 129/379 (34%), Positives = 195/379 (51%), Gaps = 46/379 (12%)

Query: 477 VHVVLKWRDQIDNPKKCK-IAIISDDIVNALEXXXXXXXXXXXXXXXXXLPMVFNPMIKE 535
           V+VVL+WRD     + CK ++IIS+DI+ +++                   M ++     
Sbjct: 310 VNVVLRWRDSYIQNETCKSVSIISEDILTSVQAQNSGVLLISN------FSMTYDKNENN 363

Query: 536 WYMPNLTLPPGIYRLKFSINN-DITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPY---- 590
           W +P+L LPPG YRL+F I++ D  +SN+LP   D +G I+N  E+LPGY +VEP+    
Sbjct: 364 WVLPDLFLPPGKYRLRFLIDHHDFRYSNYLPVTEDELGTIINEIEILPGYKSVEPFEHNN 423

Query: 591 ----RDEIIETTFHTAPSQGTLS----VHDLTMIXXXXXXXFVSAKSDLSSFTPYSDYAG 642
               ++ II +      S+   S      +L           +S   D      YS   G
Sbjct: 424 HIMIQENIINSELSLNNSRQLQSEPPSYPELEENFSSPIESIISE--DELDNDQYSKVYG 481

Query: 643 ISRSSSSVGTATKKASLVSLRGTNKLDLFTPIEP--KKIAYSKEIPELFKIANSEDTNKM 700
             + ++S+G +  K SL              I+P   ++ Y+ EIP+LFKI ++      
Sbjct: 482 --KRNNSIGQS--KTSL-------------SIKPCISEVTYTNEIPQLFKITDNNCIVNE 524

Query: 701 EIDDDG---SSPFERPSFTHKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPI 757
             +  G      +  P   ++VIDCNQD LFA  Q++G +D E AE LFL +YP+PDLP+
Sbjct: 525 NYERYGFVEPPSYGEPGLENRVIDCNQDILFATFQQNGAVDVELAEQLFLEKYPVPDLPV 584

Query: 758 YLNSTYLNKIF--TQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISVACT 815
           +L+S +  K+F      K  ND              IPHVNLNH+LT+ I + +ISVACT
Sbjct: 585 FLDSHFSEKLFDNNDSSKNLNDMNGEDIQIKNNGQDIPHVNLNHVLTNKISNGMISVACT 644

Query: 816 TRYQGKFITQVMYAPCNYS 834
           TRY+ KF+T ++Y+P  +S
Sbjct: 645 TRYKRKFVTHILYSPSTHS 663

>TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5.527
           YDR422C
          Length = 646

 Score =  136 bits (342), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 103/366 (28%), Positives = 165/366 (45%), Gaps = 49/366 (13%)

Query: 479 VVLKWRDQIDNPKKCK-IAIISDDIVNALEXXXXXXXXXXXXXXXXXLPMVFNPMIKEWY 537
           V L+W D    P   + ++IIS+DI++ +                  LP+ ++ +  EW 
Sbjct: 314 VTLRWIDSKFKPNNYQSVSIISEDIIDVI------NFYRSNNDKIKRLPLKYDSLTHEWK 367

Query: 538 MPNLTLPPGIYRLKFSINN-DITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRDEIIE 596
           + +L LP G Y   F IN  D+ HS  + T  D  G  VN+FEV       EP +   + 
Sbjct: 368 ISDLFLPAGYYEFSFLINETDVHHSLHICTKMDRFGKRVNYFEVPKYVRTFEPLQ---LS 424

Query: 597 TTFHTAPSQGTLSVHDLTMIXXXXXXXFVSAKSDLSSFTPYSDYAGISRSSSSVGTATKK 656
           +  +T  +Q     H   +        F++    L ++   + Y     S +  GT    
Sbjct: 425 SALYTV-TQADDRRH---IECSKTSSEFLNL---LDNYDIRTRYNANFYSHNESGTGNNF 477

Query: 657 ASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANS---EDTNKMEIDDDGSSPFERP 713
            +                      Y+ +IPELFK +     E + + EI       +  P
Sbjct: 478 NN--------------------NKYTNQIPELFKFSEKNIRELSTETEITFLEPPSYGEP 517

Query: 714 SFTHKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLNSTYLNKIFTQ--- 770
           SF + ++DC+Q+KLF  LQ++G +D+  AE + L RYP+ +LPI+  +  + K+ +    
Sbjct: 518 SFYNNIVDCSQEKLFLSLQQNGAVDSYVAEQVILQRYPVSELPIFFENISMEKLASHNNN 577

Query: 771 FQKQHNDPTL-----PASSSIGLTHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFITQ 825
             K H +        P  S        PHV LNHL+T  I   ++SVA TTRY+ K+ITQ
Sbjct: 578 LNKSHTNKHWLEGLTPNESDNITPKEPPHVILNHLVTQKISRNVVSVAVTTRYKQKYITQ 637

Query: 826 VMYAPC 831
           ++Y+P 
Sbjct: 638 ILYSPI 643

>Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar to
           Ashbya gossypii AER361C
          Length = 450

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 83/293 (28%), Positives = 120/293 (40%), Gaps = 60/293 (20%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRDEIIETTFH 600
           L LPPG +R +F ++N++  S+FLPTATD MGN VN+ E++    A  P +++   +   
Sbjct: 217 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYMEIV----ASPPSQEQQPASDLQ 272

Query: 601 TAPSQGTLSVHDLTMIXXXXXXXFVSAKSDLSSFTPYSDYAGISRSSSSVGTATKKASLV 660
               +G +S H                +SD +S     +    SRS        K A  +
Sbjct: 273 YVSDEGPISKH---------VENIREGRSDAASAAVDEERGMSSRS--------KLALQI 315

Query: 661 SLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSEDTNKMEIDDDGSSPFERPSFTHKVI 720
                +  D +T    +    SKEIP              E   D  + F  PS      
Sbjct: 316 EDDPDDMGDGYTRFREE----SKEIP------------VYEFTQDIPAVFTDPSV----- 354

Query: 721 DCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLNSTYLNKIFTQFQKQHNDPTL 780
              Q  L  D Q++   +        L     P LP +L    LN         +N    
Sbjct: 355 -MGQYYLTLDQQKNNQQN--------LAWLTPPQLPPHLEHVILN--------HYNKSAD 397

Query: 781 PASSSIGLTHIIP-HVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAPCN 832
            AS +      IP HV LNHL TSSI+   + VA   RY+ K+ TQ++YAP +
Sbjct: 398 GASENTSGALPIPNHVVLNHLATSSIKHNTLCVASIVRYKSKYATQILYAPLH 450

>Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON}
           YER027C (REAL)
          Length = 418

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 79/293 (26%), Positives = 120/293 (40%), Gaps = 82/293 (27%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAV-EPYRDEIIETTF 599
           L LPPG +R +F ++N++  S++LPTATD MGN VN+ EV    D   EP +       +
Sbjct: 205 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVSAPPDWTNEPQQQVTDNKAY 264

Query: 600 HTAPSQGTLSVHDLTMIXXXXXXXFVSAKSDLSSFTPYSDYAGISRSSSSVGTATKKASL 659
           H   +Q T                 +SA+S ++          I +    +G        
Sbjct: 265 HADDNQST--------------KRPMSARSRIA--------LEIEKEPDDMGD------- 295

Query: 660 VSLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSEDTNKMEIDDDGSSPFERPSFTHKV 719
               G  +    TP +P  + Y+++IP +F      D N ME                  
Sbjct: 296 ----GYTRFHDETPSKP-NLEYTQDIPAVFT-----DPNVME------------------ 327

Query: 720 IDCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLNSTYLNKIFTQFQKQHNDPT 779
               Q  L  D Q++ + +              P LP +L +  LN  ++  Q  +    
Sbjct: 328 ----QYYLTLDQQQNNHQNMAWLTP--------PQLPPHLENVILNS-YSNAQTDNTSGA 374

Query: 780 LPASSSIGLTHIIP-HVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAPC 831
           LP          IP HV LNHL TSSI+   + VA   RY+ K++TQ++Y P 
Sbjct: 375 LP----------IPNHVILNHLATSSIKHNTLCVASIVRYKQKYVTQILYTPL 417

>KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON}
           uniprot|Q00995 Kluyveromyces lactis FOG1 protein
          Length = 486

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 23/42 (54%), Positives = 33/42 (78%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLP 582
           L LPPG +R +F ++N++  S+FLPTATD MGN VN+ E++P
Sbjct: 241 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIVP 282

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 40/80 (50%), Gaps = 9/80 (11%)

Query: 753 PDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIP-HVNLNHLLTSSIRDEIIS 811
           P LP  L +  LN         +N    P S +      IP HV LNHL TSSI+   + 
Sbjct: 414 PQLPPQLENVILNN--------YNKNAEPGSENNSGALPIPNHVVLNHLATSSIKHNTLC 465

Query: 812 VACTTRYQGKFITQVMYAPC 831
           VA   RY+ K+ TQ++YAP 
Sbjct: 466 VASIVRYKRKYATQILYAPL 485

>CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04739 Saccharomyces cerevisiae YER027c GAL83
           glucose repression protein
          Length = 415

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/42 (54%), Positives = 32/42 (76%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLP 582
           L LPPG +R +F ++N++  S+FLPTATD MGN VN+ E+ P
Sbjct: 202 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIAP 243

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 7/79 (8%)

Query: 753 PDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISV 812
           P LP +L +  LN  ++  Q + N+      ++ G   I  HV LNHL TSSI+   + V
Sbjct: 343 PQLPPHLENVILNS-YSNAQGESNE------NNSGALPIPNHVILNHLATSSIKHNTLCV 395

Query: 813 ACTTRYQGKFITQVMYAPC 831
           A   RY+ K++TQ++YAP 
Sbjct: 396 ASIVRYKRKYVTQILYAPL 414

>SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} similar
           to gnl|GLV|CAGL0A03696g Candida glabrata CAGL0A03696g
           and similar to YER027C uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible
           beta-subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and similar to YGL208W
           uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 503

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 33/42 (78%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLP 582
           L LPPG +R +F ++N++  S++LPTATD MGN VN+ E++P
Sbjct: 253 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEIVP 294

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 26/38 (68%)

Query: 794 HVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAPC 831
           HV LNHL TSSI+   + VA   RY+ K+ TQ++YAP 
Sbjct: 465 HVVLNHLATSSIKHNTLCVASIVRYKSKYATQILYAPL 502

>TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {ON}
           Anc_3.517 YER027C
          Length = 433

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVL 581
           L LPPG +R +F ++N++  S+FLPTATD MGN VN+ EV+
Sbjct: 202 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEVV 242

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 39/79 (49%), Gaps = 8/79 (10%)

Query: 753 PDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISV 812
           P LP +L +  LN          N        + G   I  HV LNHL TSSI+   + V
Sbjct: 362 PQLPPHLENVILNSYSGSGSDNEN--------TSGALPIPNHVVLNHLATSSIKHNTLCV 413

Query: 813 ACTTRYQGKFITQVMYAPC 831
           A   RY+ K++TQ++YAP 
Sbjct: 414 ASIVRYKSKYVTQILYAPL 432

>Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]
           {ON} YER027C (GAL83) - glucose repression protein, a
           component of the Snf1 complex [contig 188] FULL
          Length = 429

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 32/41 (78%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVL 581
           L LPPG +R +F ++N++  S+FLPTATD MGN VN+ E++
Sbjct: 168 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIV 208

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 44/86 (51%), Gaps = 16/86 (18%)

Query: 753 PDLPIYLNSTYLNKIFTQFQ-----KQHNDPTLPASSSIGLTHIIP-HVNLNHLLTSSIR 806
           P LP +L +  LN   +Q +      ++N   LP          IP HV LNHL TSSI+
Sbjct: 354 PQLPPHLENVILNNYSSQSEPGDSGSENNSGALP----------IPNHVVLNHLATSSIK 403

Query: 807 DEIISVACTTRYQGKFITQVMYAPCN 832
              + VA   RY+ K+ TQ++Y+P  
Sbjct: 404 HSTLCVASIVRYKRKYATQILYSPLQ 429

>KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {ON}
           Anc_3.517 YER027C
          Length = 348

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 40/58 (68%)

Query: 525 LPMVFNPMIKEWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLP 582
           + +V +P   +W    L LPPG +R +F ++N++  S+ +P+ATDSMGN+VN+ EV P
Sbjct: 132 IALVEHPTNPDWARVRLKLPPGNHRFRFVVDNELRFSDDVPSATDSMGNLVNYIEVKP 189

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 46/80 (57%), Gaps = 8/80 (10%)

Query: 753 PDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISV 812
           P +P + +   LN    Q   QH D      S+ G   I  HV LNHL+ +S++  ++++
Sbjct: 277 PQIPPHFDVVILND---QNSLQHTD-----DSNAGFLPIPNHVVLNHLIVNSVKSNMLAI 328

Query: 813 ACTTRYQGKFITQVMYAPCN 832
           + TTRY+ KFITQV Y+P +
Sbjct: 329 STTTRYKEKFITQVCYSPID 348

>TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa]
           {ON} Anc_3.517 YER027C
          Length = 424

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 32/42 (76%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLP 582
           L LPPG ++ +F ++N++  S+FLPTATD MGN VN+ E +P
Sbjct: 183 LQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAVP 224

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%)

Query: 794 HVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAPC 831
           HV L+HL TSSI+   + VA   RY+ K++TQ++YAP 
Sbjct: 386 HVVLHHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 423

>KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.517
           YER027C
          Length = 409

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 32/41 (78%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVL 581
           L LPPG +R +F ++N++  S++LPTATD MGN VN+ EV+
Sbjct: 178 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEVI 218

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 7/79 (8%)

Query: 753 PDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISV 812
           P LP +L +  LN  ++  Q + N+      ++ G   I  HV LNHL TSSI+   + V
Sbjct: 337 PQLPPHLENVILNS-YSNSQGESNE------NTSGALPIPNHVILNHLATSSIKHNTLCV 389

Query: 813 ACTTRYQGKFITQVMYAPC 831
           A   RY+ K++TQ++YAP 
Sbjct: 390 ASIVRYRQKYVTQILYAPL 408

>Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON}
           YER027C (REAL)
          Length = 417

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (77%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEV 580
           L LPPG +R +F ++N++  S++LPTATD MGN VN+ EV
Sbjct: 204 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEV 243

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 42/80 (52%), Gaps = 12/80 (15%)

Query: 753 PDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIP-HVNLNHLLTSSIRDEIIS 811
           P LP +L +  LN  ++  Q  +    LP          IP HV LNHL TSSI+   + 
Sbjct: 348 PQLPPHLENVILNS-YSNAQTDNTSGALP----------IPNHVILNHLATSSIKHNTLC 396

Query: 812 VACTTRYQGKFITQVMYAPC 831
           VA   RY+ K++TQ++Y P 
Sbjct: 397 VASIVRYKQKYVTQILYTPL 416

>Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON}
           YER027C (REAL)
          Length = 423

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (77%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEV 580
           L LPPG +R +F ++N++  S++LPTATD MGN VN+ EV
Sbjct: 207 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEV 246

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 44/79 (55%), Gaps = 7/79 (8%)

Query: 753 PDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISV 812
           P LP +L +  LN  ++  Q  +N+      ++ G   I  HV LNHL TSSI+   + V
Sbjct: 351 PQLPPHLENVILNN-YSNAQTDNNE------NTSGALPIPNHVILNHLATSSIKHNTLCV 403

Query: 813 ACTTRYQGKFITQVMYAPC 831
           A   RY+ K++TQ++Y P 
Sbjct: 404 ASIVRYKQKYVTQILYTPL 422

>YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}
           GAL83One of three possible beta-subunits of the Snf1
           kinase complex, allows nuclear localization of the Snf1
           kinase complex in the presence of a nonfermentable
           carbon source; contains glycogen-binding domain
          Length = 417

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (77%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEV 580
           L LPPG +R +F ++N++  S++LPTATD MGN VN+ EV
Sbjct: 204 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEV 243

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 42/80 (52%), Gaps = 12/80 (15%)

Query: 753 PDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIP-HVNLNHLLTSSIRDEIIS 811
           P LP +L +  LN  ++  Q  +    LP          IP HV LNHL TSSI+   + 
Sbjct: 348 PQLPPHLENVILNS-YSNAQTDNTSGALP----------IPNHVILNHLATSSIKHNTLC 396

Query: 812 VACTTRYQGKFITQVMYAPC 831
           VA   RY+ K++TQ++Y P 
Sbjct: 397 VASIVRYKQKYVTQILYTPL 416

>AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER027C
           (GAL83) and YGL208W (SIP2)
          Length = 475

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 36/55 (65%)

Query: 527 MVFNPMIKEWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVL 581
           +V +P     +   L LPPG +R +F ++N++  S+FL TATD MGN VN+ E++
Sbjct: 222 LVADPARPGVFQIKLQLPPGTHRFRFIVDNELRFSDFLLTATDQMGNFVNYLEIV 276

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 26/39 (66%)

Query: 794 HVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAPCN 832
           HV LNHL TSSI+   + VA   RY+ K+ TQ++YAP  
Sbjct: 437 HVVLNHLATSSIKHNTLCVASIVRYKQKYATQILYAPLQ 475

>KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {ON}
           Anc_3.517 YER027C
          Length = 423

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVL 581
           L LPPG ++ +F ++N++  S++LPTATD MGN VN+ EV+
Sbjct: 192 LQLPPGTHKFRFIVDNELRFSDYLPTATDQMGNFVNYLEVV 232

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 44/79 (55%), Gaps = 7/79 (8%)

Query: 753 PDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISV 812
           P LP +L +  LN  ++  Q + N+      ++ G   I  HV LNHL TSSI+   + V
Sbjct: 351 PQLPPHLENVILNS-YSSLQGESNE------NNSGALPIPNHVILNHLATSSIKHNTLCV 403

Query: 813 ACTTRYQGKFITQVMYAPC 831
           A   RY+ K+ TQ++YAP 
Sbjct: 404 ASIVRYKQKYATQILYAPL 422

>NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa]
           {ON} Anc_3.517 YER027C
          Length = 503

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 31/40 (77%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEV 580
           L LPPG +R +F ++N++  S++LPTATD MGN VN+ E+
Sbjct: 251 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 290

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 27/38 (71%)

Query: 794 HVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAPC 831
           HV LNHL TSSI+   + VA   RY+ K++TQ++YAP 
Sbjct: 465 HVILNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 502

>NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {ON}
           Anc_3.517 YER027C
          Length = 432

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 31/40 (77%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEV 580
           L LPPG +R +F ++N++  S++LPTATD MGN VN+ E+
Sbjct: 207 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 246

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 7/79 (8%)

Query: 753 PDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISV 812
           P LP +L +  LN  ++  Q  +N+      ++ G   I  HV LNHL TSSI+   + V
Sbjct: 360 PQLPPHLENVILNS-YSNSQGTNNE------NNSGALPIPNHVILNHLATSSIKHNTLCV 412

Query: 813 ACTTRYQGKFITQVMYAPC 831
           A   RY+ K++TQ++YAP 
Sbjct: 413 ASIVRYKRKYVTQILYAPL 431

>KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517
           YER027C
          Length = 389

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 35/52 (67%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRD 592
           L LP G ++ +F ++N++  S+FLPTATD  GN VN+ EV P  + +E  +D
Sbjct: 193 LKLPVGTHKFRFVVDNELRFSDFLPTATDQTGNFVNYIEVKPSEETLELEKD 244

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 29/37 (78%)

Query: 794 HVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAP 830
           +V LNHLLTSSI++ ++ + C+ RY+ K++TQV Y P
Sbjct: 351 YVTLNHLLTSSIKNNMLCLGCSVRYRQKYVTQVYYTP 387

>Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON}
           complement(4330..5637) [1308 nt, 436 aa]
          Length = 435

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (75%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVL 581
           L LPPG ++ +F ++N++  S+FLPTATD MGN VN+ E +
Sbjct: 178 LQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAV 218

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (54%), Gaps = 13/82 (15%)

Query: 753 PDLPIYLNSTYLNKIFTQFQK--QHNDPTLPASSSIGLTHIIP-HVNLNHLLTSSIRDEI 809
           P LP +L +  LN   +   +  Q+N  +LP          IP HV LNHL TSSI+   
Sbjct: 363 PQLPPHLENVILNSYSSNSPETGQNNSGSLP----------IPNHVVLNHLATSSIKHNT 412

Query: 810 ISVACTTRYQGKFITQVMYAPC 831
           + VA   RY+ K++TQ++YAP 
Sbjct: 413 LCVASIVRYKRKYVTQILYAPL 434

>KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} similar
           to uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation and similar to YER027C uniprot|Q04739
           Saccharomyces cerevisiae YER027C GAL83 One of three
           possible beta-subunits of the Snf1 kinase complex allows
           nuclear localization of the Snf1 kinase complex in the
           presence of a nonfermentable carbon source contains
           glycogen-binding domain
          Length = 416

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (73%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLP 582
           L LPPG +R +F ++N++  S++L TATD MGN VN+ E+ P
Sbjct: 168 LQLPPGTHRFRFIVDNELRFSDYLATATDQMGNFVNYLEISP 209

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 41/80 (51%), Gaps = 6/80 (7%)

Query: 753 PDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIP-HVNLNHLLTSSIRDEIIS 811
           P LP +L +  LN          +DP    S +      IP HV LNHL TSSI+   + 
Sbjct: 341 PQLPPHLENVILNNY-----SNSSDPGGSGSENNSGALPIPNHVVLNHLATSSIKHNTLC 395

Query: 812 VACTTRYQGKFITQVMYAPC 831
           VA   RY+ K+ TQ++Y+P 
Sbjct: 396 VASIVRYKRKYATQILYSPL 415

>Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W
           (REAL)
          Length = 441

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (54%), Gaps = 7/82 (8%)

Query: 753 PDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISV 812
           P LP  L +  LNK +   Q Q N+      ++ G   I  HV LNHL+TSSI+   + V
Sbjct: 367 PQLPPQLENVILNKYYAT-QDQFNE------NNSGALPIPNHVVLNHLVTSSIKHNTLCV 419

Query: 813 ACTTRYQGKFITQVMYAPCNYS 834
           A   RY+ K++TQ++Y P   S
Sbjct: 420 ASIVRYKQKYVTQILYTPIESS 441

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEV 580
           L L PG +R +F ++N++  S+FLPTATD MGN VN+ EV
Sbjct: 232 LRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEV 271

>YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of
           three beta subunits of the Snf1 serine/threonine protein
           kinase complex involved in the response to glucose
           starvation; null mutants exhibit accelerated aging;
           N-myristoylprotein localized to the cytoplasm and the
           plasma membrane
          Length = 415

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (54%), Gaps = 7/82 (8%)

Query: 753 PDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISV 812
           P LP  L +  LNK +   Q Q N+      ++ G   I  HV LNHL+TSSI+   + V
Sbjct: 341 PQLPPQLENVILNKYYAT-QDQFNE------NNSGALPIPNHVVLNHLVTSSIKHNTLCV 393

Query: 813 ACTTRYQGKFITQVMYAPCNYS 834
           A   RY+ K++TQ++Y P   S
Sbjct: 394 ASIVRYKQKYVTQILYTPIESS 415

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEV 580
           L L PG +R +F ++N++  S+FLPTATD MGN VN+ EV
Sbjct: 206 LRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEV 245

>TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa]
           {ON} Anc_3.517 YER027C
          Length = 404

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (75%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVL 581
           L LP G +R +F ++N++  S++LPTATD MGN VN+ EV+
Sbjct: 187 LQLPVGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEVI 227

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 44/79 (55%), Gaps = 7/79 (8%)

Query: 753 PDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISV 812
           P LP +L +  LN  +T  Q   N+      ++ G   I  HV LNHL TSSI+   + V
Sbjct: 332 PQLPPHLENVPLNS-YTNSQNDSNE------NNSGALPIPNHVVLNHLATSSIKHNTLCV 384

Query: 813 ACTTRYQGKFITQVMYAPC 831
           A   RY+ K++TQ++YAP 
Sbjct: 385 ASIVRYKRKYVTQILYAPL 403

>Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)
          Length = 415

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEV 580
           L L PG +R +F ++N++  S+FLPTATD MGN VN+ EV
Sbjct: 206 LRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFVNYIEV 245

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 44/79 (55%), Gaps = 14/79 (17%)

Query: 757 IYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIP-HVNLNHLLTSSIRDEIISVACT 815
           + LN  Y+ +   QF  ++N   LP          IP HV LNHL+TSSI+   + VA  
Sbjct: 350 VILNKYYMTQ--DQFN-ENNSGALP----------IPNHVVLNHLITSSIKHNTLCVASI 396

Query: 816 TRYQGKFITQVMYAPCNYS 834
            RY+ K++TQ++YAP   S
Sbjct: 397 VRYKQKYVTQILYAPIESS 415

>KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.527
           YDR422C
          Length = 326

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 53/113 (46%), Gaps = 9/113 (7%)

Query: 479 VVLKWRDQIDNPKKC-KIAIISDDIVNALEXXXXXXXXXXXXXXXXXLPMVFNPMIKEWY 537
           V L++RD    P +   +AI   DI + L+                 +P+ F     EW 
Sbjct: 72  VKLRFRDSHTIPFRVHSVAIQGTDITSKLQRTGKMGGLQQ-------IPLQFEGDSSEWV 124

Query: 538 MPNLTLPPGIYRLKFSINNDIT-HSNFLPTATDSMGNIVNWFEVLPGYDAVEP 589
            P+L LPPG Y+ +F IN+  + HS +LP  T   G   N+F V+   + VEP
Sbjct: 125 APDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIENDEVVEP 177

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 44/111 (39%), Gaps = 18/111 (16%)

Query: 723 NQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLNSTYLNKIFTQFQKQHNDPTLPA 782
           NQ   F    ++ +  +   +A F  RY +P +P Y  S  +            D TL  
Sbjct: 227 NQKTFFYYAFQEQDAASGDYDAQFCERYTVPIIPPYFYSIDITP---------QDNTLKV 277

Query: 783 SSSIGLTHIIPHVNLNHLLTSS---IRDEIISVACTTRYQGKFITQVMYAP 830
              I L       NLN  +  S   I ++ + + C   Y+GK++  + Y P
Sbjct: 278 PLPIQLA------NLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322

>Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)
          Length = 414

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEV 580
           L L PG +R +F ++N++  S+FLPTATD MGN VN+ EV
Sbjct: 205 LRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFVNYIEV 244

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (54%), Gaps = 7/82 (8%)

Query: 753 PDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISV 812
           P LP  L +  LNK  T  Q Q N+      ++ G   I  HV LNHL+TSSI+   + V
Sbjct: 340 PQLPPQLENVILNKYCTT-QDQVNE------NNSGALPIPNHVVLNHLITSSIKHNTLCV 392

Query: 813 ACTTRYQGKFITQVMYAPCNYS 834
           +   RY+ K++TQ++Y P   S
Sbjct: 393 SSIVRYKQKYVTQILYTPIESS 414

>NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517
          Length = 500

 Score = 52.4 bits (124), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 29/40 (72%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEV 580
           L LP G +R +F ++N++  S+FLPTATD  GN VN+ EV
Sbjct: 271 LQLPAGTHRFRFIVDNELKFSDFLPTATDQTGNFVNYLEV 310

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 30/45 (66%)

Query: 787 GLTHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAPC 831
           G   I  HV LNHL+T+SI+   + VA   RY+ K++TQ++YAP 
Sbjct: 455 GALPIPNHVVLNHLVTTSIKHNTLCVASIIRYKHKYVTQILYAPL 499

>ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {ON}
           some similarities with uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible beta-
           subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and some similarities with
           YGL208W uniprot|P34164 Saccharomyces cerevisiae YGL208W
           SIP2 Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 348

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 31/43 (72%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPG 583
           L LP G +R +F ++N++  S++LPTATD MGN VN+ E+  G
Sbjct: 155 LQLPIGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEIGRG 197

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 27/38 (71%)

Query: 794 HVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAPC 831
           HV LNHL TSSI+   + VA   RY+ K++TQ++YAP 
Sbjct: 310 HVVLNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 347

>CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa]
           {ON} similar to uniprot|P34164 Saccharomyces cerevisiae
           YGL208w SIP2 or uniprot|Q04739 Saccharomyces cerevisiae
           YER027c GAL83
          Length = 432

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 28/40 (70%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEV 580
           L L PG +R +F ++N +  S+ LPTATD MGN VN+ EV
Sbjct: 213 LQLAPGTHRFRFIVDNQLRFSDNLPTATDQMGNFVNYLEV 252

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 41/81 (50%), Gaps = 13/81 (16%)

Query: 753 PDLPIYLNSTYLNKIFTQFQK--QHNDPTLPASSSIGLTHIIP-HVNLNHLLTSSIRDEI 809
           P LP  L +  LNK      +  ++N   LP          IP H  LNHL+T+SI+   
Sbjct: 361 PQLPPQLENVILNKFGEPLSQSTENNAGALP----------IPNHSVLNHLVTTSIKHNT 410

Query: 810 ISVACTTRYQGKFITQVMYAP 830
           + VA   RY+ K+++Q+ Y P
Sbjct: 411 LCVATNNRYRQKYVSQIYYVP 431

>NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {ON}
           Anc_3.517 YER027C
          Length = 582

 Score = 51.2 bits (121), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 29/40 (72%)

Query: 541 LTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEV 580
           L LP G +R +F ++N++  S++LPTATD  GN VN+ EV
Sbjct: 280 LQLPEGTHRFRFIVDNELRFSDYLPTATDQTGNFVNYLEV 319

>Kwal_47.18638 s47 (907369..908499) [1131 bp, 377 aa] {OFF} [contig
           192] PARTIAL
          Length = 377

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 22/28 (78%)

Query: 476 NVHVVLKWRDQIDNPKKCKIAIISDDIV 503
           + HV+LKW+D I +PK CK++I+S DI 
Sbjct: 349 DTHVILKWKDNIVDPKSCKMSIVSKDIC 376

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 87/389 (22%), Positives = 130/389 (33%), Gaps = 146/389 (37%)

Query: 1   MGNNPSTTDSENTAADLQEKKAGFHNKHLTRIQKQESPKERKGSITSHLFSSKGSS---- 56
           MGNNPST              A   N+ ++++      + R+ SITS LF S+ +     
Sbjct: 1   MGNNPST--------------ANMQNRRVSQLVNDS--RGRQDSITSQLFPSRTTGRNPE 44

Query: 57  -----KRHALMPKPIEAQGNIKSHNVFKKDYSMDE-------------------PLTNKG 92
                K   L  K         + + F+KDYS+D                    P+    
Sbjct: 45  EKKGWKSRVLHGKRAGTTSPSSAPSPFRKDYSLDSASETASYNFKKSASGNPAPPMCIAA 104

Query: 93  GIKNNDFNDENIHETMASLSLVTSSDNERKKSMSFA----RPGPSTPTVQPTKHDITSLE 148
                D +   + + +A LSL  +S+++   + S A     PGPS+P VQ TK +     
Sbjct: 105 HASAEDSSSLLLRDHLAELSL-QNSESQAHVAASPAPLLQSPGPSSPVVQSTKQEA---- 159

Query: 149 GSTDVNTGIDNMNVAGDLNSHRPSIVALKNTLAESSI-----HPPSDLSKTVSTSSNCQS 203
                            L     S+ +LK  L E  I      PPS              
Sbjct: 160 -----------------LFEQLSSMTSLKKMLVEGRIGDQINAPPS-------------- 188

Query: 204 FSTESSSSALHKTESIDIPRRHSQGFNENYNETMLKHPTVHSYQYQYFNNENTNNDGGLH 263
                         SIDIPRR S   ++ Y                              
Sbjct: 189 --------------SIDIPRRPSVAVSDTY------------------------------ 204

Query: 264 KHKENFNDMQLSTSNDDEESGVLQSADIVVNQSTLQNALKRDMKRKRTDTI---STNKSG 320
                     +S   DDEES +    D+V+N S L+NA+KR    ++   +    +++  
Sbjct: 205 ----------MSDDGDDEESLLQGVNDVVINNSMLENAMKRKRSSRKNKALGASCSSRET 254

Query: 321 APTSDALKAKDEPEAKTKTEKPAMSATAA 349
            P S   K K    A  +   P+ SA  A
Sbjct: 255 MPHSGLKKLKPLEPASDRINLPSFSAMHA 283

>Smik_10.319 Chr10 complement(504885..505307) [423 bp, 140 aa] {ON}
           YJR044C (REAL)
          Length = 140

 Score = 34.3 bits (77), Expect = 0.49,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 2/71 (2%)

Query: 744 ALFLNRYPIPDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTS 803
           ALF N YP+ D+ I+L +   N IF    K H    +  SS+ G    + H     L+TS
Sbjct: 31  ALFHNYYPLFDILIFLLAPIPNTIFNAGNKYHTSDFMSDSSNTG--QDLAHFLTGMLVTS 88

Query: 804 SIRDEIISVAC 814
            +   I+   C
Sbjct: 89  GVALPIVFYHC 99

>YJR044C Chr10 complement(518763..519185) [423 bp, 140 aa] {ON}
           VPS55Late endosomal protein involved in late endosome to
           vacuole trafficking; functional homolog of human obesity
           receptor gene-related protein (OB-RGRP)
          Length = 140

 Score = 34.3 bits (77), Expect = 0.49,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 2/71 (2%)

Query: 744 ALFLNRYPIPDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTS 803
           ALF N YP+ D+ I+L +   N IF    K H    +  SS+ G    + H     L+TS
Sbjct: 31  ALFHNYYPLFDILIFLLAPIPNTIFNAGNKYHTSDFMSDSSNTG--QDLAHFLTGMLVTS 88

Query: 804 SIRDEIISVAC 814
            I   ++   C
Sbjct: 89  GIALPVVFYHC 99

>KLTH0F02068g Chr6 complement(165601..169410) [3810 bp, 1269 aa]
           {ON} similar to uniprot|Q06321 Saccharomyces cerevisiae
           YLR189C ATG26 UDP-glucose:sterol glucosyltransferase
           conserved enzyme involved in synthesis of sterol
           glucoside membrane lipids involved in autophagy
          Length = 1269

 Score = 35.8 bits (81), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 44/87 (50%), Gaps = 7/87 (8%)

Query: 123 KSMSFARPGPSTPTVQPTKHDITSLEGS-----TDVNTGIDNMNVAGDLN--SHRPSIVA 175
           +S +F R  PS     P  +    +EG      +DV  G D  + A D N  S  PS ++
Sbjct: 132 RSEAFERSEPSKNPGTPEVNKDDEVEGPASSSPSDVTVGADENSEANDSNPISETPSQIS 191

Query: 176 LKNTLAESSIHPPSDLSKTVSTSSNCQ 202
            K+TL E S+ P SDL   +++SSN +
Sbjct: 192 KKDTLFEISVVPNSDLQSIMTSSSNSR 218

>Suva_12.127 Chr12 complement(192544..192966) [423 bp, 140 aa] {ON}
           YJR044C (REAL)
          Length = 140

 Score = 32.7 bits (73), Expect = 1.4,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 2/71 (2%)

Query: 744 ALFLNRYPIPDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTS 803
           ALF N YP+ D+ I+L +   N IF+   + H    +  SS+ G    + H     L+TS
Sbjct: 31  ALFHNYYPLFDILIFLLAPIPNTIFSTGNQYHTSDFMSDSSNTG--QDLAHFLTGMLVTS 88

Query: 804 SIRDEIISVAC 814
            +   ++   C
Sbjct: 89  GVALPVVFYHC 99

>ZYRO0C17270g Chr3 (1345022..1351885) [6864 bp, 2287 aa] {ON}
           similar to uniprot|P38111 Saccharomyces cerevisiae
           YBR136W MEC1 Central regulator of the Mec1p/Tel1p
           signaling network; required for mitotic growth, DNA
           repair and mitotic recombination, regulates
           phosphorylation of Rad53p, required for dmc1 arrest and
           meiotic recombination; similar to phosphatidylinositol
           (PI)3- kinases required for DNA damage induced
           checkpoint responses in G1, S/M, intra S, and G2/M in
           mitosis
          Length = 2287

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 701 EIDDDGSSPFERPSFTHKVIDCNQDKLFA-DLQRDGNIDAETAEALFLNRYP 751
           +I  DG +P E       ++D N  ++FA  L R G +  ET E LFLNR P
Sbjct: 665 KITCDGDNPEEINEQKAVLLDKNSRQIFAVALVRHGLVSLETLETLFLNRLP 716

>Skud_8.269 Chr8 (471255..473060) [1806 bp, 601 aa] {ON} YHR202W
           (REAL)
          Length = 601

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 51/113 (45%), Gaps = 7/113 (6%)

Query: 694 SEDTNKMEIDDDGSSPFERPSFTHKVIDCNQDKLFADLQR---DGNIDAETAEALFLNRY 750
           +E    + I+    + F+ P FT + ID N+D     L+R   D +I   T    F++R 
Sbjct: 295 AETVGFLSINMTNFADFDNPIFTRRYIDFNKDAFTYHLRRIANDADISLSTRRGGFISRL 354

Query: 751 PIPDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTS 803
            + DL   LN   L++      + +   T P  S   L H+I H  L +L+ S
Sbjct: 355 -VNDLRHELN---LDQKLGYIPRTYYVSTRPLDSEENLYHLITHKILPNLVPS 403

>CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some
           similarities with uniprot|Q06554 Saccharomyces
           cerevisiae YLR247c
          Length = 1470

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 36/85 (42%), Gaps = 3/85 (3%)

Query: 4   NPSTTDSENTAADLQEKKAGFHNKHLTRIQKQESPKERKGSITSHLFSSKGSSKRHALMP 63
           N S +   +T  DL  K+  F NK+   I  QE  +  K S   +   +KG       + 
Sbjct: 302 NHSVSFGYSTIKDLVSKQFYFWNKYTGYILSQEEVRSLKSSFNEYEVGAKGVLAEEMGLG 361

Query: 64  KPIEAQGNIKSHNVFKKDYSMDEPL 88
           K +E    I    + K+ Y  DEPL
Sbjct: 362 KTLEILALI---CINKRKYKADEPL 383

>Skud_10.262 Chr10 complement(475043..475465) [423 bp, 140 aa] {ON}
           YJR044C (REAL)
          Length = 140

 Score = 32.0 bits (71), Expect = 3.0,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 2/71 (2%)

Query: 744 ALFLNRYPIPDLPIYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTS 803
           ALF N YP+ D+ I+L +   N +F    K H    +  SS+ G    + H     L+TS
Sbjct: 31  ALFHNYYPLFDILIFLLAPIPNTLFGAGNKYHTSDFMSDSSNTG--QDLAHFLTGMLVTS 88

Query: 804 SIRDEIISVAC 814
            +   ++   C
Sbjct: 89  GVALPVVLYHC 99

>TBLA0D00500 Chr4 (131830..135177) [3348 bp, 1115 aa] {ON} Anc_7.408
           YER110C
          Length = 1115

 Score = 32.7 bits (73), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 52/102 (50%), Gaps = 7/102 (6%)

Query: 94  IKNNDFNDENIHETMASLSLVTSSDNERKKSMSFARPGPSTPTVQPTKHDITSLEGSTDV 153
           I +N   DE++   + +L  + S+ + R+  +S A+ GP    +  T   + S E   DV
Sbjct: 265 IASNTNLDEDVR--VFALQFIISALSYRRSKVSQAKLGPE---ITMTALKVASEE--IDV 317

Query: 154 NTGIDNMNVAGDLNSHRPSIVALKNTLAESSIHPPSDLSKTV 195
           +  ++N + AG+   + PS+ A++     SS  PPS +S  +
Sbjct: 318 DDELNNEDEAGENEENTPSLTAIRLLAFASSELPPSQVSSVI 359

>KNAG0D01430 Chr4 complement(238537..242511) [3975 bp, 1324 aa] {ON}
           Anc_7.463 YJR092W
          Length = 1324

 Score = 32.7 bits (73), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 40/84 (47%), Gaps = 9/84 (10%)

Query: 81  DYSMDEPLTNKGGIKNNDFNDENIHETMASLSLVTSSDNERKKSMSFARPGPSTPTVQPT 140
           + S+ EPL +   +K ND N E + E  +  S+V S +NE         P  S P V+  
Sbjct: 545 ELSVKEPLLDHKNVKGNDIN-EFVTENESISSIVHSMNNE--------HPKTSEPPVEQN 595

Query: 141 KHDITSLEGSTDVNTGIDNMNVAG 164
              I+S E   ++   I+N+ + G
Sbjct: 596 ISSISSSEDLDEIEMAIENLRIEG 619

>TBLA0H00850 Chr8 (188637..191318) [2682 bp, 893 aa] {ON} Anc_8.401
           YLR240W
          Length = 893

 Score = 32.0 bits (71), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 5/73 (6%)

Query: 340 EKPAMSATAAMMLKLYGDTTLKEKETFKNNTISGTIRYDDFYKRSESSVNLPENKKLKSF 399
           +KP + A+  +   L  D TLK    + N+ +  +++   F K S  ++ LP     KSF
Sbjct: 28  QKPLLKASQRI---LNPDLTLKSSNVYPNSDLLVSVQI--FNKLSNRNLTLPVYSPFKSF 82

Query: 400 DNNTKNGNGYVSV 412
            NNT+  N ++ +
Sbjct: 83  RNNTRKWNQWIKL 95

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 93,141,729
Number of extensions: 4452496
Number of successful extensions: 22041
Number of sequences better than 10.0: 863
Number of HSP's gapped: 22198
Number of HSP's successfully gapped: 1032
Length of query: 842
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 724
Effective length of database: 39,950,811
Effective search space: 28924387164
Effective search space used: 28924387164
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 70 (31.6 bits)