Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0H015805.525ON90990949040.0
NCAS0F010705.525ON90490524090.0
KAFR0E033105.525ON93893122110.0
SAKL0G04884g5.525ON93093521830.0
YDR421W (ARO80)5.525ON95092721670.0
Suva_2.5985.525ON96593821290.0
Skud_4.6955.525ON95492820900.0
Smik_4.6965.525ON94994120580.0
TDEL0A038905.525ON83188519220.0
ZYRO0D12518g5.525ON88190119170.0
KNAG0C032505.525ON93694819120.0
Kpol_1028.825.525ON92593319050.0
KLTH0G03718g5.525ON85790518060.0
KLLA0A01804g5.525ON94579717890.0
TPHA0L003505.525ON85990817790.0
TBLA0D016705.525ON101881516100.0
CAGL0F03025g5.525ON92892816000.0
ADR199C5.525ON94496914670.0
Smik_17.27singletonON6881401211e-05
NCAS0A061904.344ON8941731192e-05
CAGL0I07755g3.109ON1053941182e-05
YBL005W (PDR3)4.113ON9761011131e-04
TBLA0H006808.423ON8801121121e-04
TBLA0E047504.344ON1283911121e-04
TDEL0D00820na 1ON6852761066e-04
Ecym_1146na 1ON665461067e-04
NCAS0B082001.199ON875961058e-04
Kwal_47.168624.344ON743421030.001
TBLA0F012003.109ON1086751030.002
SAKL0H13024g8.423ON754981020.002
NDAI0A010401.199ON995841020.002
Smik_15.673.109ON1030781020.002
Ecym_6141na 2ON11469930.003
NCAS0H00780singletonON909461000.003
KNAG0M00120singletonON881891000.003
NDAI0D00900singletonON865891000.003
Suva_9.592.231ON926135990.004
KLTH0C07480g3.264ON775122990.004
Smik_2.1154.113ON971102990.004
Ecym_81598.879ON90853990.005
NCAS0A03570na 3ON97883990.005
NDAI0D031804.344ON98979990.005
SAKL0G17908g4.344ON80944980.005
AGL091W8.423ON86657980.005
SAKL0D03586g3.264ON801131980.006
KLLA0A06039g1.199ON65748970.007
ZYRO0E06270g2.565ON91257980.007
NDAI0A03410na 3ON980100970.008
Kwal_56.230583.264ON77552970.008
Suva_16.25singletonON14389910.008
AAL175W8.879ON88358960.009
TDEL0H007901.199ON827104960.009
KNAG0E041004.344ON90372960.010
Kpol_2001.161.199ON80288960.010
NCAS0A125802.547ON70450960.011
Smik_4.4608.423ON918114950.013
Kpol_1001.34.344ON85652950.013
NDAI0C048408.423ON94896950.013
KLTH0D16852g4.344ON81144950.014
NDAI0D035504.113ON111845950.014
TBLA0I025408.423ON125951950.014
KAFR0B014502.547ON108862950.014
SAKL0D00264g8.879ON84839940.015
Kwal_23.31228.423ON78871940.016
SAKL0A01386gna 4ON77068940.016
ZYRO0D08316gna 4ON68078940.017
ZYRO0B14476gna 1ON70781940.018
TBLA0E034803.109ON104642940.019
KAFR0A03060singletonON86051940.019
TPHA0A045403.109ON1178117940.020
Ecym_51313.264ON77045930.021
KNAG0A044808.423ON101352930.022
Skud_2.2773.109ON1066128930.022
CAGL0C01199g8.423ON92244930.022
Smik_12.2898.423ON81290930.025
YGL013C (PDR1)4.113ON106869930.026
NCAS0A03070singletonON65652920.027
Ecym_2345na 5ON63743920.027
Ecym_11354.344ON82255920.028
KAFR0E012503.264ON736105920.030
NDAI0B015402.565ON80367920.030
KLTH0D07260g2.547ON97938920.033
SAKL0H25146gna 5ON64544910.033
Kwal_56.246707.360ON64355910.036
ZYRO0A00440g8.879ON85044910.036
TBLA0C062306.60ON79567910.038
NCAS0H002707.512ON90646910.039
TPHA0M010403.264ON77064910.040
Skud_2.1064.113ON1010125910.041
KLLA0C08657gna 4ON72252910.042
KNAG0A025508.423ON73057910.042
ZYRO0G19338gna 5ON65355900.043
ACR241C1.199ON79568910.043
KLLA0E18129g2.654ON86545910.044
NDAI0G041403.109ON100193910.044
Suva_15.773.109ON102977910.044
KNAG0C059804.113ON968116910.045
TPHA0C049808.879ON85247900.046
ZYRO0A03058g3.264ON73663900.046
YKR064W (OAF3)1.199ON86361900.047
AFR171Wna 5ON61290900.048
KAFR0C013203.109ON100642900.049
Kwal_47.16939na 1ON66972900.051
YIL130W (ASG1)2.231ON964136900.051
KLLA0F19602g8.283ON60348900.052
Kwal_33.139341.199ON79780900.053
NCAS0C027308.423ON77558900.053
Kpol_538.528.879ON90740900.056
KLLA0F10373g6.154ON348114890.056
Kwal_27.96888.879ON84137900.056
NCAS0C047803.109ON91499900.057
TDEL0D051503.109ON99642900.057
KAFR0H018008.423ON79457890.060
Smik_7.2774.113ON106976900.061
KLLA0E02663gna 6ON110956890.062
Kpol_1002.52.547ON95842890.063
TPHA0B015854.344ON81277890.064
Suva_10.3238.423ON81394890.065
KLTH0E16500g8.879ON83337890.065
Smik_11.3261.199ON86552890.066
CAGL0K11902g3.264ON83170890.066
TPHA0C021808.423ON88668890.066
NDAI0A087907.17ON105979890.072
TDEL0D036103.264ON72447890.074
KLTH0H16170gna 7ON61944880.075
CAGL0D03850g5.322ON83437890.076
KAFR0L021308.879ON88239890.077
Skud_2.397.389ON115940890.077
NDAI0F00110singletonON50839880.082
NCAS0E023107.56ON71859880.085
Suva_2.517.389ON115540880.085
TDEL0F054708.423ON81057880.085
ZYRO0B14718g4.344ON103544880.086
NCAS0A105503.264ON74151880.091
YBL066C (SEF1)7.389ON114840880.093
Kwal_56.226053.109ON86542880.094
KLLA0F14322g1.277ON71742880.095
CAGL0H06875g8.879ON70239880.096
Ecym_51831.199ON81063880.097
Ecym_41448.423ON84049880.098
SAKL0D13464g2.565ON68776870.098
KLTH0F03014gsingletonON61239870.099
NCAS0B028608.423ON86962880.099
TPHA0G003807.512ON87342880.10
TDEL0G04890singletonON58443870.10
Smik_2.507.389ON115076880.10
NCAS0A047502.547ON114144880.10
KAFR0I002804.344ON93689870.10
KNAG0C011601.199ON835256870.11
KLTH0B00352gsingletonON93445870.11
KLTH0G07898g5.235ON866121870.11
KLLA0A03421gna 8ON88049870.11
NDAI0K018002.547ON121044870.11
KNAG0A071002.547ON128644870.11
YDR034C (LYS14)3.264ON79061870.11
YLR228C (ECM22)8.423ON81468870.11
KLLA0A02585gna 9ON37042860.12
Kwal_26.81092.547ON97038870.12
Skud_13.664.344ON93954870.13
TBLA0C040504.113ON120797870.13
Kpol_529.158.423ON94849870.13
KLLA0B04840gna 1ON77143860.13
Skud_12.2968.423ON81457860.13
CAGL0H00396g7.512ON94040860.14
SAKL0H24860gna 10ON97195860.14
KAFR0B028208.283ON66490860.14
KLTH0H00968g7.360ON62351860.14
KNAG0G021308.283ON63237860.15
KAFR0A014801.277ON72549860.15
KLTH0B09262gsingletonON82048860.15
KLLA0F25630g2.547ON100740860.15
Suva_2.3818.423ON91861860.15
Skud_4.2873.264ON78467860.16
TBLA0I018903.264ON82545860.16
NDAI0A034204.113ON110846860.16
Skud_4.4758.423ON91361860.16
Ecym_2522na 11ON92680860.16
KNAG0A02290singletonON80071860.17
TBLA0A04280singletonON89244860.17
AFR096W1.277ON85240860.17
Kpol_1049.19na 12ON94344860.17
YLR014C (PPR1)5.235ON90455860.17
KNAG0F037207.512ON76654850.18
TPHA0F025506.61ON79978850.18
NCAS0D041906.279ON89038850.18
KLLA0F09559gsingletonON65868850.19
KLLA0F04213g3.264ON76845850.19
TPHA0L010608.423ON97350850.19
KLTH0F05258g1.199ON80287850.19
SAKL0A09856g2.547ON1020117850.19
YML076C (WAR1)4.344ON94452850.19
Smik_12.775.235ON90349850.20
Suva_2.1873.264ON78461850.20
Kpol_1071.107.56ON698202850.21
Smik_4.2693.264ON77867850.21
YBR297W (MAL33)na 13ON46891840.21
Kpol_495.213.109ON1085111850.21
SAKL0B04620gna 9ON36242840.21
KLLA0C16489gna 14ON72856850.22
Skud_12.825.235ON89949850.22
CAGL0L01903g2.547ON128738850.22
ZYRO0A13596gsingletonON64838840.23
Suva_11.2991.199ON88941840.23
TPHA0B004104.344ON94544840.24
NCAS0C051002.651ON1019237840.24
Kwal_26.7095na 15ON83849840.24
SAKL0H00682gna 16ON92260840.25
KNAG0E041507.17ON113637840.25
Skud_7.2744.113ON108043840.25
TDEL0B004808.879ON83539840.25
KLLA0F02387g7.56ON72735840.26
CAGL0F07909g3.109ON104954840.26
NCAS0A016304.113ON104368840.26
Ecym_5044na 17ON90362840.27
CAGL0M05907g1.199ON891112840.27
ZYRO0E05676g2.547ON106641840.27
NDAI0I007406.279ON103338840.28
YML099C (ARG81)8.879ON88078840.28
Kpol_1018.927.389ON106039840.28
NCAS0C002208.879ON83951840.29
Skud_15.643.109ON103242840.29
NCAS0A150207.512ON80953840.29
KLLA0B04620g4.344ON91950840.30
CAGL0F09229gna 18ON83552840.30
ZYRO0A09350g8.423ON79357830.30
Kwal_34.15751na 7ON62858830.30
KNAG0D035204.113ON103048840.31
KNAG0D052407.512ON86943830.31
TBLA0F029207.512ON92341830.31
NCAS0I002707.17ON944196830.32
Smik_13.368.879ON88078830.32
ABL099W3.264ON80045830.32
Suva_1.147.17ON104560830.32
Kwal_23.29055.235ON88199830.32
Suva_11.2132.654ON985120830.33
Ecym_63401.277ON95240830.34
KNAG0E002107.17ON94853830.34
NDAI0E034608.423ON94958830.34
TBLA0D054201.277ON75740830.34
KLTH0D02222gna 15ON84735830.34
NDAI0A057503.264ON75945830.35
Suva_2.1214.113ON971102830.35
Skud_15.5027.56ON75935830.35
KLLA0E20307g7.389ON111990830.35
Skud_11.3001.199ON86550830.36
Suva_8.3877.56ON75935830.36
SAKL0G11902g5.235ON90642830.37
YDR213W (UPC2)8.423ON91361830.37
ZYRO0A10956g5.235ON85560830.37
KAFR0B063408.423ON86452830.37
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0H01580
         (909 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.5...  1893   0.0  
NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.5...   932   0.0  
KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {O...   856   0.0  
SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} simila...   845   0.0  
YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zin...   839   0.0  
Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421...   824   0.0  
Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421...   809   0.0  
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...   797   0.0  
TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.5...   744   0.0  
ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} simi...   743   0.0  
KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {O...   741   0.0  
Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa] ...   738   0.0  
KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} simila...   700   0.0  
KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {...   693   0.0  
TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON}     689   0.0  
TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {...   624   0.0  
CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} simila...   620   0.0  
ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}...   569   0.0  
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    51   1e-05
NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON} Anc_4...    50   2e-05
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    50   2e-05
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    48   1e-04
TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {O...    48   1e-04
TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON} Anc_...    48   1e-04
TDEL0D00820 Chr4 (151394..153451) [2058 bp, 685 aa] {ON}               45   6e-04
Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar t...    45   7e-04
NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON} Anc_1...    45   8e-04
Kwal_47.16862 s47 complement(147009..149240) [2232 bp, 743 aa] {...    44   0.001
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    44   0.002
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    44   0.002
NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {O...    44   0.002
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    44   0.002
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    40   0.003
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    43   0.003
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      43   0.003
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               43   0.003
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    43   0.004
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    43   0.004
Smik_2.115 Chr2 (210321..213236) [2916 bp, 971 aa] {ON} YBL005W ...    43   0.004
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    43   0.005
NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {O...    43   0.005
NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.3...    43   0.005
SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON} simi...    42   0.005
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    42   0.005
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    42   0.006
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    42   0.007
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    42   0.007
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    42   0.008
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    42   0.008
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    40   0.008
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    42   0.009
TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa] {O...    42   0.009
KNAG0E04100 Chr5 (814663..817374) [2712 bp, 903 aa] {ON} Anc_4.3...    42   0.010
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    42   0.010
NCAS0A12580 Chr1 complement(2481447..2483561) [2115 bp, 704 aa] ...    42   0.011
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    41   0.013
Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}...    41   0.013
NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON} Anc_8...    41   0.013
KLTH0D16852g Chr4 (1392572..1395007) [2436 bp, 811 aa] {ON} simi...    41   0.014
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    41   0.014
TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8....    41   0.014
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    41   0.014
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    41   0.015
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    41   0.016
SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON} conser...    41   0.016
ZYRO0D08316g Chr4 (719929..721971) [2043 bp, 680 aa] {ON} conser...    41   0.017
ZYRO0B14476g Chr2 complement(1175759..1177882) [2124 bp, 707 aa]...    41   0.018
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    41   0.019
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    41   0.019
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    41   0.020
Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar t...    40   0.021
KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {...    40   0.022
Skud_2.277 Chr2 complement(508677..511877) [3201 bp, 1066 aa] {O...    40   0.022
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    40   0.022
Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {...    40   0.025
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    40   0.026
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               40   0.027
Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar t...    40   0.027
Ecym_1135 Chr1 complement(276229..278697) [2469 bp, 822 aa] {ON}...    40   0.028
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    40   0.030
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    40   0.030
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    40   0.033
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    40   0.033
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    40   0.036
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    40   0.036
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    40   0.038
NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}...    40   0.039
TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {...    40   0.040
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    40   0.041
KLLA0C08657g Chr3 (757100..759268) [2169 bp, 722 aa] {ON} some s...    40   0.042
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    40   0.042
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    39   0.043
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    40   0.043
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    40   0.044
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    40   0.044
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    40   0.044
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    40   0.045
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    39   0.046
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    39   0.046
YKR064W Chr11 (562547..565138) [2592 bp, 863 aa] {ON}  OAF3Putat...    39   0.047
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    39   0.048
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    39   0.049
Kwal_47.16939 s47 (180147..182156) [2010 bp, 669 aa] {ON} [conti...    39   0.051
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    39   0.051
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    39   0.052
Kwal_33.13934 s33 complement(456687..459080) [2394 bp, 797 aa] {...    39   0.053
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     39   0.053
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    39   0.056
KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some s...    39   0.056
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    39   0.056
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               39   0.057
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    39   0.057
KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa] {O...    39   0.060
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    39   0.061
KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON} conse...    39   0.062
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    39   0.063
TPHA0B01585 Chr2 complement(352396..354834) [2439 bp, 812 aa] {ON}     39   0.064
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    39   0.065
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    39   0.065
Smik_11.326 Chr11 (552455..555052) [2598 bp, 865 aa] {ON} YKR064...    39   0.066
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    39   0.066
TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {O...    39   0.066
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    39   0.072
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    39   0.074
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    39   0.075
CAGL0D03850g Chr4 (384689..387193) [2505 bp, 834 aa] {ON} weakly...    39   0.076
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    39   0.077
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    39   0.077
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 39   0.082
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      39   0.085
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    39   0.085
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    39   0.085
ZYRO0B14718g Chr2 (1196539..1199646) [3108 bp, 1035 aa] {ON} sim...    39   0.086
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    39   0.091
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    39   0.093
Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089...    39   0.094
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    39   0.095
CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa] {...    39   0.096
Ecym_5183 Chr5 complement(385669..388101) [2433 bp, 810 aa] {ON}...    39   0.097
Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}...    39   0.098
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    38   0.098
KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} simila...    38   0.099
NCAS0B02860 Chr2 complement(488982..491591) [2610 bp, 869 aa] {O...    39   0.099
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       39   0.10 
TDEL0G04890 Chr7 (903504..903581,903640..905316) [1755 bp, 584 a...    38   0.10 
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    39   0.10 
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    39   0.10 
KAFR0I00280 Chr9 complement(57061..59871) [2811 bp, 936 aa] {ON}...    38   0.10 
KNAG0C01160 Chr3 complement(226939..229446) [2508 bp, 835 aa] {O...    38   0.11 
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    38   0.11 
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    38   0.11 
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    38   0.11 
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    38   0.11 
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    38   0.11 
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    38   0.11 
YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON} ...    38   0.11 
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    38   0.12 
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    38   0.12 
Skud_13.66 Chr13 complement(111847..114666) [2820 bp, 939 aa] {O...    38   0.13 
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    38   0.13 
Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}...    38   0.13 
KLLA0B04840g Chr2 (439864..442179) [2316 bp, 771 aa] {ON} conser...    38   0.13 
Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa] {...    38   0.13 
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    38   0.14 
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    38   0.14 
KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa] {O...    38   0.14 
KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} simila...    38   0.14 
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    38   0.15 
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    38   0.15 
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    38   0.15 
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    38   0.15 
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    38   0.15 
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    38   0.16 
TBLA0I01890 Chr9 complement(423851..426328) [2478 bp, 825 aa] {O...    38   0.16 
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    38   0.16 
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    38   0.16 
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    38   0.16 
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               38   0.17 
TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa] ...    38   0.17 
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    38   0.17 
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    38   0.17 
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    38   0.17 
KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON} Anc_7.5...    37   0.18 
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    37   0.18 
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     37   0.18 
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    37   0.19 
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    37   0.19 
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    37   0.19 
KLTH0F05258g Chr6 complement(462417..464825) [2409 bp, 802 aa] {...    37   0.19 
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    37   0.19 
YML076C Chr13 complement(112513..115347) [2835 bp, 944 aa] {ON} ...    37   0.19 
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    37   0.20 
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    37   0.20 
Kpol_1071.10 s1071 (22248..24344) [2097 bp, 698 aa] {ON} (22248....    37   0.21 
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    37   0.21 
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    37   0.21 
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    37   0.21 
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    37   0.21 
KLLA0C16489g Chr3 (1444456..1446642) [2187 bp, 728 aa] {ON} cons...    37   0.22 
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    37   0.22 
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    37   0.22 
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    37   0.23 
Suva_11.299 Chr11 (546739..549408) [2670 bp, 889 aa] {ON} YKR064...    37   0.23 
TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}...    37   0.24 
NCAS0C05100 Chr3 complement(1038084..1041143) [3060 bp, 1019 aa]...    37   0.24 
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    37   0.24 
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    37   0.25 
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    37   0.25 
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    37   0.25 
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    37   0.25 
KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa] {...    37   0.26 
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    37   0.26 
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    37   0.26 
Ecym_5044 Chr5 complement(91778..94489) [2712 bp, 903 aa] {ON} s...    37   0.27 
CAGL0M05907g Chr13 (622029..624704) [2676 bp, 891 aa] {ON} simil...    37   0.27 
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    37   0.27 
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    37   0.28 
YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}  A...    37   0.28 
Kpol_1018.92 s1018 (244116..247298) [3183 bp, 1060 aa] {ON} (244...    37   0.28 
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       37   0.29 
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    37   0.29 
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    37   0.29 
KLLA0B04620g Chr2 complement(413129..415888) [2760 bp, 919 aa] {...    37   0.30 
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    37   0.30 
ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} simila...    37   0.30 
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    37   0.30 
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    37   0.31 
KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON} Anc_7.5...    37   0.31 
TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON} Anc_7.5...    37   0.31 
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    37   0.32 
Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}...    37   0.32 
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    37   0.32 
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    37   0.32 
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    37   0.32 
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    37   0.33 
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    37   0.34 
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    37   0.34 
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     37   0.34 
TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa] ...    37   0.34 
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    37   0.34 
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    37   0.35 
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    37   0.35 
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    37   0.35 
KLLA0E20307g Chr5 (1806005..1809364) [3360 bp, 1119 aa] {ON} uni...    37   0.35 
Skud_11.300 Chr11 (544149..546746) [2598 bp, 865 aa] {ON} YKR064...    37   0.36 
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    37   0.36 
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    37   0.37 
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    37   0.37 
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    37   0.37 
KAFR0B06340 Chr2 (1311310..1313904) [2595 bp, 864 aa] {ON} Anc_8...    37   0.37 
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    37   0.37 
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    37   0.38 
ACL195C Chr3 complement(19204..19533) [330 bp, 109 aa] {ON} NOHB...    34   0.39 
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    36   0.40 
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    36   0.40 
AER153W Chr5 (925950..928196) [2247 bp, 748 aa] {ON} Syntenic ho...    36   0.41 
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    36   0.41 
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    36   0.41 
NCAS0F02700 Chr6 complement(547682..550189) [2508 bp, 835 aa] {O...    36   0.41 
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    36   0.42 
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    36   0.42 
NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON} Anc_2.547     36   0.42 
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    36   0.42 
SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa] {...    36   0.45 
KLTH0C00880g Chr3 complement(85841..89098) [3258 bp, 1085 aa] {O...    36   0.45 
SAKL0F12342g Chr6 (964262..967393) [3132 bp, 1043 aa] {ON} simil...    36   0.45 
KAFR0G00570 Chr7 complement(148813..151401) [2589 bp, 862 aa] {O...    36   0.46 
Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa] {...    36   0.46 
KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly...    36   0.47 
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    36   0.47 
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    36   0.47 
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    36   0.48 
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    36   0.48 
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    36   0.49 
KLTH0E08140g Chr5 (747649..749547) [1899 bp, 632 aa] {ON} conser...    36   0.49 
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    36   0.49 
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    36   0.50 
Smik_13.64 Chr13 complement(110338..113172) [2835 bp, 944 aa] {O...    36   0.50 
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    36   0.51 
NCAS0A06710 Chr1 (1324253..1326562) [2310 bp, 769 aa] {ON} Anc_5...    36   0.52 
KLTH0C06776g Chr3 complement(586976..590140) [3165 bp, 1054 aa] ...    36   0.52 
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      36   0.53 
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...    36   0.54 
Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON} (21147....    36   0.54 
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    36   0.54 
CAGL0M02651g Chr13 complement(304583..305971) [1389 bp, 462 aa] ...    36   0.54 
AAL057C Chr1 complement(246899..249328) [2430 bp, 809 aa] {ON} S...    36   0.54 
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    36   0.54 
Suva_13.76 Chr13 complement(113974..116811) [2838 bp, 946 aa] {O...    36   0.54 
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    36   0.55 
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    36   0.55 
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...    36   0.55 
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    36   0.56 
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...    36   0.56 
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    36   0.56 
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    36   0.56 
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    36   0.57 
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    36   0.57 
Suva_15.245 Chr15 complement(416757..419414) [2658 bp, 885 aa] {...    36   0.57 
Smik_18.3 Chr18 complement(3105..5219) [2115 bp, 704 aa] {ON} YK...    36   0.58 
KLTH0D16456g Chr4 complement(1360294..1362279) [1986 bp, 661 aa]...    36   0.58 
KLTH0A07766g Chr1 (654163..655980) [1818 bp, 605 aa] {ON} conser...    36   0.58 
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    36   0.59 
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    36   0.60 
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    36   0.61 
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...    36   0.61 
Ecym_3395 Chr3 complement(750356..753481) [3126 bp, 1041 aa] {ON...    36   0.61 
KLLA0D10593g Chr4 complement(900326..903103) [2778 bp, 925 aa] {...    36   0.64 
Kwal_27.10852 s27 complement(526456..529596) [3141 bp, 1046 aa] ...    36   0.64 
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    36   0.65 
SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON...    36   0.66 
SAKL0H16544g Chr8 (1454826..1454875,1454943..1456692) [1800 bp, ...    35   0.68 
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    36   0.68 
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    35   0.69 
TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON}       35   0.71 
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    35   0.72 
NDAI0A06990 Chr1 (1593540..1596476) [2937 bp, 978 aa] {ON} Anc_3...    35   0.72 
Ecym_7203 Chr7 (415869..418523) [2655 bp, 884 aa] {ON} similar t...    35   0.72 
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    35   0.72 
TDEL0C01580 Chr3 complement(272178..275687) [3510 bp, 1169 aa] {...    35   0.73 
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    35   0.74 
TBLA0B06240 Chr2 complement(1469510..1473817) [4308 bp, 1435 aa]...    35   0.74 
NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884...    35   0.75 
ZYRO0D01650g Chr4 complement(131688..134270) [2583 bp, 860 aa] {...    35   0.75 
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    35   0.76 
TBLA0G00730 Chr7 complement(165589..167994) [2406 bp, 801 aa] {O...    35   0.77 
CAGL0H04367g Chr8 complement(410256..413093) [2838 bp, 945 aa] {...    35   0.78 
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    35   0.79 
Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}...    35   0.80 
TDEL0D00730 Chr4 complement(129036..131456) [2421 bp, 806 aa] {O...    35   0.80 
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    35   0.81 
KLLA0F18084g Chr6 complement(1652031..1654613) [2583 bp, 860 aa]...    35   0.81 
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    35   0.81 
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    35   0.82 
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    35   0.82 
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    35   0.83 
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    35   0.84 
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    35   0.84 
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    35   0.84 
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    35   0.85 
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    35   0.87 
TBLA0E03050 Chr5 complement(764239..766578) [2340 bp, 779 aa] {O...    35   0.88 
NDAI0D00220 Chr4 complement(43353..46187) [2835 bp, 944 aa] {ON}...    35   0.90 
ZYRO0D02090g Chr4 complement(167354..169882) [2529 bp, 842 aa] {...    35   0.91 
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    35   0.91 
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    35   0.93 
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    35   0.94 
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    35   0.95 
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    35   0.98 
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    35   1.0  
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    35   1.1  
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    35   1.1  
KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.2...    35   1.1  
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    35   1.1  
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    35   1.1  
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    35   1.1  
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    35   1.1  
Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa] {O...    35   1.1  
ABR174W Chr2 (728570..731164) [2595 bp, 864 aa] {ON} Syntenic ho...    35   1.2  
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    35   1.2  
SAKL0G17622g Chr7 complement(1525163..1527193) [2031 bp, 676 aa]...    35   1.2  
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    35   1.2  
ZYRO0B03278g Chr2 (269277..272996) [3720 bp, 1239 aa] {ON} simil...    35   1.3  
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                35   1.3  
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    35   1.3  
Smik_4.68 Chr4 (133172..134758) [1587 bp, 528 aa] {ON} YDL170W (...    35   1.3  
ZYRO0D14432g Chr4 complement(1222977..1226489) [3513 bp, 1170 aa...    35   1.3  
KLLA0D00396g Chr4 complement(36277..37362) [1086 bp, 361 aa] {ON...    34   1.3  
Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}...    35   1.3  
KNAG0B02380 Chr2 complement(466392..469595) [3204 bp, 1067 aa] {...    35   1.4  
Ecym_4686 Chr4 complement(1336279..1339581) [3303 bp, 1100 aa] {...    35   1.4  
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    35   1.4  
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    35   1.4  
Suva_4.76 Chr4 (144078..145667) [1590 bp, 529 aa] {ON} YDL170W (...    34   1.5  
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    35   1.5  
YLL054C Chr12 complement(32673..35204) [2532 bp, 843 aa] {ON} Pu...    35   1.5  
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    35   1.5  
TBLA0C01910 Chr3 complement(448085..448684,448765..451611) [3447...    35   1.5  
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    34   1.6  
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    35   1.6  
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    34   1.6  
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    34   1.6  
KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {...    34   1.6  
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    34   1.6  
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    34   1.6  
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    34   1.6  
TBLA0C02060 Chr3 (486966..489920) [2955 bp, 984 aa] {ON} Anc_1.1...    34   1.7  
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    34   1.7  
TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa] {O...    34   1.7  
Suva_4.265 Chr4 (467625..470438) [2814 bp, 937 aa] {ON} YBR033W ...    34   1.8  
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    34   1.8  
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    34   1.8  
Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063...    34   1.9  
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    34   1.9  
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    34   2.0  
Suva_10.182 Chr10 complement(342360..344330) [1971 bp, 656 aa] {...    34   2.0  
KLLA0C04620g Chr3 complement(422705..426514) [3810 bp, 1269 aa] ...    34   2.0  
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...    34   2.1  
NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa] ...    34   2.2  
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    34   2.2  
KLLA0F10835g Chr6 (997512..999782) [2271 bp, 756 aa] {ON} conser...    34   2.2  
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    34   2.2  
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    34   2.2  
KLTH0C10032g Chr3 complement(830334..832934) [2601 bp, 866 aa] {...    34   2.2  
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    34   2.3  
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    34   2.3  
NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235     34   2.3  
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    34   2.3  
Skud_2.145 Chr2 (271582..274335) [2754 bp, 917 aa] {ON} YBR033W ...    34   2.4  
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    34   2.6  
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    34   2.6  
TDEL0C01880 Chr3 (332932..334554) [1623 bp, 540 aa] {ON} Anc_7.3...    33   2.7  
SAKL0G09768g Chr7 (828604..830937) [2334 bp, 777 aa] {ON} simila...    33   2.7  
CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa...    33   2.7  
YBR150C Chr2 complement(541209..544493) [3285 bp, 1094 aa] {ON} ...    33   2.9  
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    33   3.2  
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    33   3.4  
Ecym_5675 Chr5 (1373252..1375264) [2013 bp, 670 aa] {ON} similar...    33   3.4  
Kwal_YGOB_gneas1 s33 complement(285483..287042) [1560 bp, 519 aa...    33   3.5  
Kwal_55.21884 s55 (1020057..1022705) [2649 bp, 882 aa] {ON} YLR4...    33   3.6  
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    33   3.7  
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    33   3.8  
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    33   3.8  
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    33   4.0  
Skud_12.166 Chr12 complement(320672..322621) [1950 bp, 649 aa] {...    33   4.2  
TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa] {O...    33   4.2  
TPHA0C01130 Chr3 complement(257491..260127) [2637 bp, 878 aa] {O...    33   5.0  
Suva_14.423 Chr14 (733379..735229) [1851 bp, 616 aa] {ON} YNR063...    33   5.1  
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    33   5.1  
YLR098C Chr12 complement(337527..339473) [1947 bp, 648 aa] {ON} ...    33   5.2  
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    33   5.3  
Kwal_8.580 s8 (13266..15182) [1917 bp, 638 aa] {ON} [contig 311]...    33   5.4  
Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480 a...    32   5.7  
KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.2...    32   6.4  
NDAI0C04170 Chr3 complement(953071..955548) [2478 bp, 825 aa] {O...    32   6.7  
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    32   6.8  
KLTH0A06644g Chr1 complement(553084..555270) [2187 bp, 728 aa] {...    32   6.9  
Kpol_345.3 s345 complement(7411..11517) [4107 bp, 1368 aa] {ON} ...    32   7.0  
Ecym_3200 Chr3 complement(384639..387116) [2478 bp, 825 aa] {ON}...    32   7.2  
TBLA0A00280 Chr1 (45618..47912) [2295 bp, 764 aa] {ON}                 32   7.4  
Kwal_14.931 s14 complement(119423..122608) [3186 bp, 1061 aa] {O...    32   7.7  
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    32   8.0  
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    32   8.4  
ZYRO0C11880g Chr3 (929030..930943) [1914 bp, 637 aa] {ON} simila...    32   8.6  
KLTH0D03718g Chr4 complement(362790..364790) [2001 bp, 666 aa] {...    32   9.2  
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    32   9.3  
NDAI0K02840 Chr11 (640461..643634) [3174 bp, 1057 aa] {ON} Anc_6...    32   9.5  
ZYRO0G02046g Chr7 complement(157899..161087) [3189 bp, 1062 aa] ...    32   10.0 

>NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.525
           YDR421W
          Length = 909

 Score = 1893 bits (4904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 909/909 (100%), Positives = 909/909 (100%)

Query: 1   MCASLLENEVLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
           MCASLLENEVLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC
Sbjct: 1   MCASLLENEVLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60

Query: 61  VFLTTKGRKADLGTSKIPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPI 120
           VFLTTKGRKADLGTSKIPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPI
Sbjct: 61  VFLTTKGRKADLGTSKIPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPI 120

Query: 121 SPTKWKIGLTSMQNSLEFLAKAAGNVGFLSAPSAHSAREELNSAVVPKATSLPQEESLMN 180
           SPTKWKIGLTSMQNSLEFLAKAAGNVGFLSAPSAHSAREELNSAVVPKATSLPQEESLMN
Sbjct: 121 SPTKWKIGLTSMQNSLEFLAKAAGNVGFLSAPSAHSAREELNSAVVPKATSLPQEESLMN 180

Query: 181 MTSSLHSDLLNISPIGKLQHKSLPLIDKLNIVRPTPRRKLTDIDYIGPNRLLSESDAIEL 240
           MTSSLHSDLLNISPIGKLQHKSLPLIDKLNIVRPTPRRKLTDIDYIGPNRLLSESDAIEL
Sbjct: 181 MTSSLHSDLLNISPIGKLQHKSLPLIDKLNIVRPTPRRKLTDIDYIGPNRLLSESDAIEL 240

Query: 241 IDLFFLTMFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNGQNNKR 300
           IDLFFLTMFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNGQNNKR
Sbjct: 241 IDLFFLTMFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNGQNNKR 300

Query: 301 RHIDVHEKLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYASDPAL 360
           RHIDVHEKLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYASDPAL
Sbjct: 301 RHIDVHEKLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYASDPAL 360

Query: 361 NDISKRNMEPQIIKREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTKVAIAT 420
           NDISKRNMEPQIIKREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTKVAIAT
Sbjct: 361 NDISKRNMEPQIIKREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTKVAIAT 420

Query: 421 HISDTHTAMNMNQRSALSHSFNSDFFDHLSKSRYIGKDSTQVVNENFYLTQILQNKESKE 480
           HISDTHTAMNMNQRSALSHSFNSDFFDHLSKSRYIGKDSTQVVNENFYLTQILQNKESKE
Sbjct: 421 HISDTHTAMNMNQRSALSHSFNSDFFDHLSKSRYIGKDSTQVVNENFYLTQILQNKESKE 480

Query: 481 RWKKISATFQKDNEETVGQLSDMEYEFLNDEYALYFSKEDNDSSQRPPLPLKFTFVQRAK 540
           RWKKISATFQKDNEETVGQLSDMEYEFLNDEYALYFSKEDNDSSQRPPLPLKFTFVQRAK
Sbjct: 481 RWKKISATFQKDNEETVGQLSDMEYEFLNDEYALYFSKEDNDSSQRPPLPLKFTFVQRAK 540

Query: 541 LELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLIDSWYSNYNSLLKTDAVRP 600
           LELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLIDSWYSNYNSLLKTDAVRP
Sbjct: 541 LELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLIDSWYSNYNSLLKTDAVRP 600

Query: 601 VSPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQVDVGQNKLKLNEITRCAIY 660
           VSPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQVDVGQNKLKLNEITRCAIY
Sbjct: 601 VSPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQVDVGQNKLKLNEITRCAIY 660

Query: 661 VEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFIVKCYLTLTSGSFSSNPEA 720
           VEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFIVKCYLTLTSGSFSSNPEA
Sbjct: 661 VEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFIVKCYLTLTSGSFSSNPEA 720

Query: 721 RTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAILLYLCREMKSKHESSQQS 780
           RTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAILLYLCREMKSKHESSQQS
Sbjct: 721 RTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAILLYLCREMKSKHESSQQS 780

Query: 781 KGYDSKSSSNAPLSDDVITNQSGDKMSEDILLKSHAEVAAKDPRTSQENIELQMNKPNLD 840
           KGYDSKSSSNAPLSDDVITNQSGDKMSEDILLKSHAEVAAKDPRTSQENIELQMNKPNLD
Sbjct: 781 KGYDSKSSSNAPLSDDVITNQSGDKMSEDILLKSHAEVAAKDPRTSQENIELQMNKPNLD 840

Query: 841 GKFASDMDFTTDNLNELPGDVANWFTTSGNIGLEFVEPWTEMIEQMYLQSGDANTTFDDL 900
           GKFASDMDFTTDNLNELPGDVANWFTTSGNIGLEFVEPWTEMIEQMYLQSGDANTTFDDL
Sbjct: 841 GKFASDMDFTTDNLNELPGDVANWFTTSGNIGLEFVEPWTEMIEQMYLQSGDANTTFDDL 900

Query: 901 YKEICQDSK 909
           YKEICQDSK
Sbjct: 901 YKEICQDSK 909

>NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.525
           YDR421W
          Length = 904

 Score =  932 bits (2409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/905 (55%), Positives = 619/905 (68%), Gaps = 39/905 (4%)

Query: 12  QKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKAD 71
           ++ + + KW+R ++AC +C++RKVKCD+GPLENPH PPC RCRREGKTC+F ++ G    
Sbjct: 19  KRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIF-SSGGN--- 74

Query: 72  LGTSKIPSTTPTLKPNSGNSVSKKR---LDSSTDLVNEV-PVKIPKTSPSNPISP-TKWK 126
            G S    +T   K N       KR   +D+++ L ++    KI KT  +    P  KWK
Sbjct: 75  -GMSSANLSTMNGKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPREKWK 133

Query: 127 IGLTSMQNSLEFLAKAAGNVGFLSAPSAHSAREELNSAVVPKATSLPQEESLMNMTSSLH 186
           + L SMQNSLEFLAKAA +V   S P +     +L        TS   +  +    S   
Sbjct: 134 LELASMQNSLEFLAKAADSVAHQSNPESFKETAKLAKNGASNDTS-ENDTPVQQQDSPNE 192

Query: 187 SDLLNISPIGKLQHKSLPLIDKLNIVRPTPRRKLTDIDYIGPNRLLSESDAIELIDLFFL 246
           + L  ++     +  +LP ++K   +RP   + L+D+++IGP++LLSE +A ELIDLFFL
Sbjct: 193 NYLTPLTTPHNSRRSALPQLEKSISIRPKSSQTLSDMEFIGPSKLLSEEEARELIDLFFL 252

Query: 247 TMFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNGQNNKRRHIDVH 306
           TM PFFP+IPLQLQ+  EL +YPILLCAILTISSRYH FD F D  N     ++R+I VH
Sbjct: 253 TMNPFFPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEF-DGYNGTPGRQKRNIHVH 311

Query: 307 EKLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYASDPALNDISKR 366
           EKLWIYCQRLISQT+WAEASTRSIGTI AFIIFTEWNPRAIHW WSDYA++P   D++KR
Sbjct: 312 EKLWIYCQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYANNPEQYDMTKR 371

Query: 367 NMEPQIIKREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTKVAIATHISDTH 426
               Q   ++E+GLTGI AIRRSDRMAWML+GTAVRLAQD G I T+ KV +ATHIS+++
Sbjct: 372 ESFSQEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAKVFVATHISESY 431

Query: 427 TAMNMNQRSALSHSFNSDFFDHLSKSRYIGKDSTQVV-NENFYLTQILQNKESKERWKKI 485
           TA+NMNQ   LS SFN    D        G D+   V NE  YL QILQN ESK RW  I
Sbjct: 432 TAINMNQGLILSQSFNERNLD--------GIDNLNGVDNERLYLEQILQNDESKARWNGI 483

Query: 486 SATFQKDNEETVGQ--LSDMEYEFLNDEYALYFSKEDNDSSQRPP--LPLKFTFVQRAKL 541
                 DNE  + +  L D+E EFLNDEY LY++  D D+ Q     +PLKFT  Q+AKL
Sbjct: 484 LKLL--DNEVGISEEYLQDVEREFLNDEYTLYYADHDEDTQQHTQQIIPLKFTSTQKAKL 541

Query: 542 ELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLIDSWYSNYNSLLKTDAVRPV 601
           ELLRI+ LGYETIYYE G+QRLVS DQR NLAVLNIL+PLI+SWY+NY SLL+      +
Sbjct: 542 ELLRILILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRSLLEIREGEVL 601

Query: 602 SPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQVDVGQNKLKLNEITRCAIYV 661
           S    + K++AF+MS+ I+ ETMISDYYYCQLYI+SLALQVDV +NKLKLNEI RCA +V
Sbjct: 602 SLNQRRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDVEENKLKLNEIRRCASFV 661

Query: 662 EKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFIVKCYLTLTSGSFSSNPEAR 721
           EKAY+AAKEILESAGRVHKL MLKYMPV+WV+RIVRSVAFIVKCYLTLT    S+NPEA 
Sbjct: 662 EKAYIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSDLSTNPEAN 721

Query: 722 TILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAILLYLCREMKSKHESSQQSK 781
           TIL LSAISVDETIQTIQ  AI LKEAAPDELHL TRYSAIL+YLCREMK +       K
Sbjct: 722 TILRLSAISVDETIQTIQTAAITLKEAAPDELHLCTRYSAILMYLCREMKLR------DK 775

Query: 782 GYDSKSSSNAPLSDDVITNQSGDKMSEDILLKSHAEVAAKDPRTSQENIELQMNKPNLDG 841
             ++ ++        +I N + D +  + +  +   V +  P +  +       K  L  
Sbjct: 776 TNNNNNTGENEEQKILIENSNPDGV--EGVASNFGNVPSTLPPSYAQK---STTKEQLSD 830

Query: 842 KFASDMDFTTDNLNELPGDVANWFTTSGNIGLEFVEPWTEMIEQMYLQSGDANTTFDDLY 901
             A  M F  D    L  +V +WF   G+IGL+FVEPWTEMIEQ YLQSGD NT+F++LY
Sbjct: 831 DGAHSMSF-MDEGPSLSNNVTDWFNVGGDIGLDFVEPWTEMIEQRYLQSGDVNTSFEELY 889

Query: 902 KEICQ 906
           +++C+
Sbjct: 890 RQLCE 894

>KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {ON}
           Anc_5.525 YDR421W
          Length = 938

 Score =  856 bits (2211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/931 (48%), Positives = 611/931 (65%), Gaps = 64/931 (6%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIP 78
           KW+R YKAC NC+ RKVKCD+GP +NPH PPC RC+RE + C+F + + +K D+ +  + 
Sbjct: 15  KWRRSYKACLNCRARKVKCDLGPYDNPHPPPCVRCKREQRECLFTSRRKKKDDVISGTVS 74

Query: 79  STTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPISP--TKWKIGLTSMQNSL 136
            T         +   + +L+S +         +   SP NP +   +KWK GL SMQN+L
Sbjct: 75  LTNVPSAITQEDDNDRIQLNSGSS-----KGALFSNSPKNPNTQDQSKWKYGLGSMQNTL 129

Query: 137 EFLAKAAGNVG------FLSAPSAHSAREELNSAVVPKATSLPQEESLMNMTSSLHSDLL 190
           EFLA AAG+V         +A  +H   +E +       +S   E   +  TS       
Sbjct: 130 EFLATAAGSVSKESNRRLTTARHSHQYAKETSEDFRVDDSSPSSERKDITDTSEQSV--- 186

Query: 191 NISPIGK---LQHKSLPLIDKLNIVRPTPRRKLTDIDYIGPNRLLSESDAIELIDLFFLT 247
            I+P+ K    Q  ++ LI++L+ VRP P +KL DIDYIGP+ LLSE +A ELID +FLT
Sbjct: 187 -IAPLLKECGTQRATVSLIEELSRVRPKPNKKLADIDYIGPSNLLSEQEARELIDAYFLT 245

Query: 248 MFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNGQNNKRRHIDVHE 307
           M PFFPNIPLQLQ+P EL  YPILLCAILT+SSRYH F  F     NG+NNKR +I+VHE
Sbjct: 246 MHPFFPNIPLQLQDPDELVNYPILLCAILTMSSRYHPFSEFG--FYNGENNKR-NIEVHE 302

Query: 308 KLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYASDPALNDISKRN 367
            LW YCQRLISQT+WAEASTRSIGT+LAFIIFTEWNPR IHW  +DYA+       ++++
Sbjct: 303 TLWDYCQRLISQTVWAEASTRSIGTVLAFIIFTEWNPRQIHWRRTDYANS------AEKD 356

Query: 368 MEPQIIKREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTKVAIATHISDTHT 427
            +    +++++GLTGI AIRRSDRM+WML+G+AVRLAQD G I T+TK+ +A+HISDT  
Sbjct: 357 TDVPHSQKDDDGLTGIGAIRRSDRMSWMLTGSAVRLAQDMGFIETSTKIFVASHISDTFA 416

Query: 428 AMNMNQRSALSHSFNSDFFDHLSKSRYIGKDSTQ-----VVNENFYLTQILQNKESKERW 482
           +MNMNQR ALS +F+   F    + R    DS Q     V NE FYL Q+LQN+ES+ERW
Sbjct: 417 SMNMNQRCALSETFSVVGFG-AGRERASAIDSEQTDVDEVGNEKFYLEQMLQNEESRERW 475

Query: 483 KKISATFQKDNEETVGQLSDMEYEFLNDEYALYFSKEDNDSSQRP---PLPLKFTFVQRA 539
            ++    Q +N++  G L+D+E EFLNDEY LY++  +++  Q+    P PLKF+F QRA
Sbjct: 476 TRVLERLQHNNDKKNGPLTDLEREFLNDEYVLYYANRNDEMVQQHLQLPFPLKFSFHQRA 535

Query: 540 KLELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLIDSWYSNYNSLLKTDAVR 599
           K+EL+RI+ + Y+TIYY+ G+++L S+DQ  NLAVL ILSPLI+ WY+ Y +LLK  + +
Sbjct: 536 KIELIRIILIAYDTIYYDKGKRKLTSNDQVHNLAVLGILSPLIEGWYATYRNLLKISSGQ 595

Query: 600 PVSPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQVDVGQNKLKLNEITRCAI 659
           P S  + K K+   ++ + I+ E+++SDYYYCQLYI+SLALQVDV   KL++NE T+ A 
Sbjct: 596 PYSIEIRKNKRAVHELGEEINRESILSDYYYCQLYIYSLALQVDVKGPKLRINEATKSAK 655

Query: 660 YVEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFIVKCYLTLTSGSFSSNPE 719
           YVE AYVAAKEIL S+ RVH+LKMLKYMPV+WVMRIVR+V+F+VKCYLTLT G    N E
Sbjct: 656 YVELAYVAAKEILISSTRVHRLKMLKYMPVRWVMRIVRAVSFLVKCYLTLTGGGGVPNSE 715

Query: 720 ARTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAILLYLCREMKSKHESSQQ 779
           A+TIL L  IS+DETI TI+  A+ILKEA+PDELHL  RYSAILLYLC+EM  K + +Q+
Sbjct: 716 AQTILKLCCISLDETIHTIRLAALILKEASPDELHLCVRYSAILLYLCKEMNLKSKRNQK 775

Query: 780 ---SKGYDSKSSSNAPLS------------DDVITNQSGDKMSEDILLKSHAEVAAKDPR 824
              S G     S N  +             D   T+ S +  S + LL ++         
Sbjct: 776 LLVSHGILINESRNRQMGSRRTKATQDSDIDLGSTDDSKNIQSNNELLPNNISTTNGLTT 835

Query: 825 TSQENIELQMNKPNLDGKFASDMDFTTDNLN-----------ELPGDVANWFTTSGNIGL 873
           +     E++   PN     ++  D T +NL+            LP +  +WF+ S +IGL
Sbjct: 836 SLFNTEEMRSETPNQRIPTSAVADNTPNNLDNDGTNNPTNFPSLPDEAIDWFSGSADIGL 895

Query: 874 EFVEPWTEMIEQMYLQSGDANTTFDDLYKEI 904
           +FVEPWTE++EQ +LQSGD N  F++LY ++
Sbjct: 896 DFVEPWTELLEQRFLQSGDGNNIFEELYNQV 926

>SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 930

 Score =  845 bits (2183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/935 (49%), Positives = 606/935 (64%), Gaps = 85/935 (9%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIP 78
           KW+R Y+AC NC+ RKVKCD+GP++NPHDPPC RC+RE K C+F T   ++  L  + + 
Sbjct: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIF-TESNKRGGLRVANVS 76

Query: 79  STTPTLKPNSGNSVSK--KRLDSSTDLVNEVPVKIPKTSPSNPISPTKWKIGLTSMQNSL 136
           +    +  N+ N+ +   K + S          + P     N I P      LT+MQ++L
Sbjct: 77  A----IAENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLPINSELTTMQDAL 132

Query: 137 EFLAKAAGNVGFLSAPS---AHSAREEL----NSAVVPKATSLPQEESLMNMTSSLHSDL 189
           EFLAKAAG+V    +     A +  EEL    NS      +S   ++S  N  S+   D 
Sbjct: 133 EFLAKAAGSVAKEDSRDLVDASTKYEELESQSNSRTDTPISSGSAQDSTRNSNSANIPDE 192

Query: 190 LNISPIGK---LQHKSLPLIDKLNIVRPTPRRKLTDIDYIGPNRLLSESDAIELIDLFFL 246
             I+P+ +   L   ++PLI+KL+ VRP P R+LTDI+YIG  ++LSE +A++LIDLFFL
Sbjct: 193 ACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSEEEAVKLIDLFFL 252

Query: 247 TMFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNGQNNKRRHIDVH 306
           TM PFFP++PLQLQNP ELAQYPILLCAILTISSRYHSFD    ++ NG++N R ++++H
Sbjct: 253 TMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEV--NMYNGESNNR-NVEIH 309

Query: 307 EKLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYASDPALNDISKR 366
           E+LWIYCQRLISQT+WAEASTRSIGT+LAF++FTEWNPRAIHW WSDYA++P LND+SKR
Sbjct: 310 ERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWSDYANNPDLNDVSKR 369

Query: 367 NMEPQII----------KREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTKV 416
           ++               ++  +GLTG+ A+RRSDRMAWML+GTAVRLAQD G + T++K+
Sbjct: 370 DLSNVACSSSSSTACNSQQHGDGLTGLSAMRRSDRMAWMLTGTAVRLAQDMGFMNTSSKI 429

Query: 417 AIATHISDTHTAMNMNQRSALSHSFNSDFFDHLSKSRYIGKDSTQVVNENFYLTQILQNK 476
             ATHIS+THTAMNMNQRS LS S        L++    G +   V NE++YL QIL++ 
Sbjct: 430 FTATHISETHTAMNMNQRSILSQS--------LAEINLNGYED-DVENESYYLGQILKSD 480

Query: 477 ESKERWKKISATFQKDNEETVGQLSDMEYEFLNDEYALYFSKED-----------NDSSQ 525
            SKERW K        +  T G+++D+E EF+NDEY LY+S +D           ND   
Sbjct: 481 GSKERWSKFLKKL--GSSSTRGRMNDIEREFVNDEYVLYYSDKDGAPAHADEYTMNDDKN 538

Query: 526 RP------PLPLKFTFVQRAKLELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILS 579
           R       P  LKF+F QRAK+ELLRI+++GYETIY   G+ +L S+ Q  NLA+L+ILS
Sbjct: 539 RKKQIEEEPYNLKFSFGQRAKIELLRIMSIGYETIY--RGKLKLYSNSQYHNLALLSILS 596

Query: 580 PLIDSWYSNYNSLLKTDAVRPVSPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLA 639
           PLI+SWY+ Y ++LK  +    +  M   K+  F++++ +  E++ISDYYYCQLYI+SLA
Sbjct: 597 PLIESWYNTYKTILKPCSGAACNTAMCSEKKYIFELTEKVDRESLISDYYYCQLYIYSLA 656

Query: 640 LQVDVG---QNKLKLNEITRCAIYVEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIV 696
           LQVDVG     KL++NEIT+CA YVE AY AAKEIL SA RVHKLKMLKYMPV+WV RIV
Sbjct: 657 LQVDVGTPKDKKLRMNEITKCARYVELAYNAAKEILNSAIRVHKLKMLKYMPVRWVTRIV 716

Query: 697 RSVAFIVKCYLTLTSGSFSSNPEARTILSLSAISVDETIQTIQDTAIILKEAAPDELHLS 756
           RSVAF+VKCYLTLT    ++NPEA TIL+LS I  +E IQTIQ  AI L+EA+PDELHL 
Sbjct: 717 RSVAFVVKCYLTLTGSGIATNPEANTILTLSVIPTEEIIQTIQRAAITLREASPDELHLC 776

Query: 757 TRYSAILLYLCREMKSKHESSQQSKGYDSKSSSNAPLSDDVITNQSGDKMSEDILLKSHA 816
           TRYS IL+YLC EMK +   + Q     S S     +S +   N  G   + +    S  
Sbjct: 777 TRYSTILMYLCTEMKLRSRPNPQPPVPRSISEQPEQISVETTFNFCGKNETHEKGQGSQQ 836

Query: 817 EVAAKDPRTSQENIELQMNKPNLDGKFASDMDFTTDNL--------NELPGDVANWFTTS 868
                 PR         MN       FA    F  DN         + LP  V +WF+TS
Sbjct: 837 RGPLPPPR---------MNSLPETTNFA----FNVDNFFSPQGAQTHHLPTQVVDWFSTS 883

Query: 869 GNIGLEFVEPWTEMIEQMYLQSGDANTTFDDLYKE 903
             IGL+FVEPWTEMIEQ ++ S D N TF++LY +
Sbjct: 884 DEIGLDFVEPWTEMIEQQFI-SNDNNKTFENLYNQ 917

>YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zinc
           finger transcriptional activator of the Zn2Cys6 family;
           activates transcription of aromatic amino acid catabolic
           genes in the presence of aromatic amino acids
          Length = 950

 Score =  839 bits (2167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/927 (48%), Positives = 608/927 (65%), Gaps = 59/927 (6%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIP 78
           K +R Y+AC +C+ RKVKCD+GP++NPHDPPCARC+RE K C+F + KG   DL  + I 
Sbjct: 17  KRRRTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELKKCIFSSNKGTSNDLPPNSIN 76

Query: 79  STTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPISP--TKWKIGLTSMQNSL 136
           + +    P+ G S  + + DS++ ++++VP+     S          KWK+ L+SMQN+L
Sbjct: 77  AIS---LPSLGKSKQEIQNDSTSPILSDVPLSRKGISSEKSFKSEGMKWKLELSSMQNAL 133

Query: 137 EFLAKAAGNVGFLSAPSAHSAREELNSAVVPKATSL------PQEESLMNMTSSLHSDLL 190
           EFLA+AAG V   +   A    +E ++   P  +SL        +E L  ++ S  ++ L
Sbjct: 134 EFLAQAAGTV---AKEGAKEIIKEKSTTPKPLKSSLDATNKSATDEGLKRLSKSDSTNTL 190

Query: 191 NISPIGKLQH------KSLPLIDKLNIVRPTPRRKLTDIDYIGPNRLLSESDAIELIDLF 244
             +    L H      K+  L++++  VRP P RK+ D DYIGP+ LL++ +AIELI+ F
Sbjct: 191 YENTADMLNHTLNTNRKTSQLMEEIGKVRPPPTRKIDDFDYIGPDSLLTKEEAIELIEAF 250

Query: 245 FLTMFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNGQNNKRRHID 304
           FLTM PFFPNIPLQL +PKELA+YPIL CAILT+S+RYH FDT    ++NG++  R HI+
Sbjct: 251 FLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHPFDTLG--LDNGEDGMR-HIE 307

Query: 305 VHEKLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYASDPALNDIS 364
           VH+KLW+YCQ+LISQTIWAEASTRSIGT+LAFIIFTEWNPR+IH+ WSDYA+DP LN+++
Sbjct: 308 VHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDPELNNVN 367

Query: 365 KRNMEPQIIKREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTKVAIATHISD 424
            R  +    +++EEGLTG+ AIRRSDRM+WML+G+AVRLAQD G I  ++KV I THIS+
Sbjct: 368 ARGSKNISTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKVFIVTHISE 427

Query: 425 THTAMNMNQRSALSHSFNSDFFDHLSKSRYIGKDSTQ--VVNENFYLTQILQNKESKERW 482
           T +AMNMNQRS L+ SF S    +L K    G +S +  + NE FYL +IL ++ESK RW
Sbjct: 428 TTSAMNMNQRSLLAESF-SVLNLNLGKIENDGNESNEDYLGNEKFYLNEILPDEESKLRW 486

Query: 483 KKISATFQKDNEETVGQLSDMEYEFLNDEYALYFSKEDNDSS----QRPPLPLKFTFVQR 538
           K++    + D++     L+D E EFLNDEY LY+S + +D++      PP PL+F+F QR
Sbjct: 487 KRVFENSENDHDNEKNFLTDWEREFLNDEYVLYYSNKKDDTNLAQNHIPPFPLRFSFAQR 546

Query: 539 AKLELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLIDSWYSNYNSLLKTDAV 598
           AK+E++RI+++ YETIY E  +++L + DQR NL+VL++ SPLI+ W SNY  LL   + 
Sbjct: 547 AKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLIEGWLSNYRELLVPLSD 606

Query: 599 RPVSPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQVDVGQNKLKLNEITRCA 658
            P S    K K++ F     I+GE++I+D+ YCQLYIFSLALQVD   ++L +NEI   A
Sbjct: 607 VPFSLADRKNKKQIFDNIDRINGESIITDFNYCQLYIFSLALQVDGKTSRLNMNEIVTSA 666

Query: 659 IYVEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFIVKCYLTLTSGSFSSNP 718
            YVE AY +AKEIL SA RV +  MLKYMPV+WV+RI+RS+AFIVKCYLTLT    ++NP
Sbjct: 667 RYVELAYRSAKEILSSAKRVSRQGMLKYMPVRWVIRIIRSIAFIVKCYLTLTGSELATNP 726

Query: 719 EARTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAILLYLCREMKSKHES-- 776
           +AR IL LSAISVDET   I+DTA+ LKEA PDELHL  RY+AIL+YLC EMK + +S  
Sbjct: 727 DARNILKLSAISVDETFDIIRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLRKKSYL 786

Query: 777 --------------SQQSKGYDSKSSSNAPLSDDVITNQSGDKMSEDILLKSHAEVAAKD 822
                         S +    + +  +  P    + + + G   +E     S   +  + 
Sbjct: 787 ERPPLLRDGTTPLESNRESSLEGQDLTKKP----IFSKRIGYNKTETTFEPSERPLTEEI 842

Query: 823 PRTSQENIELQMNKPNLDGKFASDMDFTTDNLN-------ELPGDVANWFTTSGNIGLEF 875
              SQ N     +K  +D     + D TT  LN        L  +V +WF  S +IGLEF
Sbjct: 843 NSNSQ-NSNDTSSKGIVDPFVEQNNDITTALLNNELFQGPSLSDEVTDWFGASEDIGLEF 901

Query: 876 VEPWTEMIEQMYLQSGDA-NTTFDDLY 901
           VEPWTE+IEQ Y+Q GD  N  F++LY
Sbjct: 902 VEPWTELIEQRYMQCGDGDNNNFENLY 928

>Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421W
           (REAL)
          Length = 965

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/938 (47%), Positives = 604/938 (64%), Gaps = 77/938 (8%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIP 78
           K +R Y+AC NC+ RKVKCD+GP++NPH PPCARC+RE K C+F + +     L  S I 
Sbjct: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMIN 87

Query: 79  STTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPISPT-------KWKIGLTS 131
            T       S ++ SK       DL++  P  +P  S  N  + T       KWK+ L+S
Sbjct: 88  IT-------SKSASSKSEQGVPNDLMSSTPSDMP-LSGKNTDNETLFKSEGMKWKLELSS 139

Query: 132 MQNSLEFLAKAAGNVGFLSAPSAHSAREELNSAVVPKATSL------PQEESLMNMTSSL 185
           MQN+LEFLA+AAG V   +   A    ++ ++   P   SL        +E L  ++ SL
Sbjct: 140 MQNTLEFLAQAAGTV---AKEGAKEIIKDESTTTTPFVNSLHSSCQPSTDEGLKPLSRSL 196

Query: 186 HSDLLNISPIGKL----------QHKSLPLIDKLNIVRPTPRRKLTDIDYIGPNRLLSES 235
            +     +PI  L             +  LI+++  VRP P RK+ D +YIGP  LL++ 
Sbjct: 197 SAASDTNTPIENLTVALATTLNANRTTSQLIEEIGKVRPIPTRKIEDFEYIGPANLLTKE 256

Query: 236 DAIELIDLFFLTMFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNG 295
           +AIELI+ FFLTM PFFPNIP QL +PKELAQYPIL CAILT+S+RYH FDT    ++NG
Sbjct: 257 EAIELIEAFFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYHPFDTLG--LDNG 314

Query: 296 QNNKRRHIDVHEKLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYA 355
           +N  R H++VH+KLW+YCQ+LISQTIWAEASTRSIGT+LAFIIFTEWNPR+IH  WSDYA
Sbjct: 315 ENGTR-HVEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHCKWSDYA 373

Query: 356 SDPALNDISKRNMEPQIIKREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTK 415
           +DP LN+++ R  +    +R+EEGLTG+ AIRRSDRM+WML+G+AVRLAQD G I  +++
Sbjct: 374 NDPELNNVNVRGGKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSR 433

Query: 416 VAIATHISDTHTAMNMNQRSALSHSFNSDFFDHLSKSRYIGKDSTQ----VVNENFYLTQ 471
           + I THIS+T +AMNMNQRS L+ SF+     +L+  R+    +      + NE FYL +
Sbjct: 434 IFIVTHISETTSAMNMNQRSVLAESFS---VLNLNLGRFDNDGNENNENYLGNERFYLDE 490

Query: 472 ILQNKESKERWKKISATFQKDNEETVGQLSDMEYEFLNDEYALYFSKEDNDSS----QRP 527
           IL N ESKERWKK+    + D++     L+D E EFLNDEY LY+S + +D++      P
Sbjct: 491 ILPNDESKERWKKVLENLEADSDNEKCVLTDWEREFLNDEYVLYYSNKKDDTNLAQNHMP 550

Query: 528 PLPLKFTFVQRAKLELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLIDSWYS 587
           P PL+F+F QRAK+E++RI+++ YETIY E  +++L + DQR NL+VL++ SPL++ W S
Sbjct: 551 PFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLMEGWLS 610

Query: 588 NYNSLLKTDAVRPVSPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQVDVGQN 647
           NY  +L   +  P S    K K++       I+GE++I+D+ YCQLYIFSLALQVD   +
Sbjct: 611 NYREVLVPLSDVPFSLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFSLALQVDGKIS 670

Query: 648 KLKLNEITRCAIYVEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFIVKCYL 707
           +L ++EI + A YVE AY +AKEIL SA RV +  MLKYMPV+WV+RI+RS+AFIVKCYL
Sbjct: 671 RLNMSEIVKSAKYVELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIRSIAFIVKCYL 730

Query: 708 TLTSGSFSSNPEARTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAILLYLC 767
           TLT    ++NP+AR IL LSAISVDET   I+DTA+ LKEA PDELHL  RY+AIL+YLC
Sbjct: 731 TLTGSEIATNPDARNILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQRYAAILMYLC 790

Query: 768 REMKSKHES------SQQSKGYDSKSSSNAPLSD-DVITNQSGDKMSEDILLKSHAEVAA 820
            EMK + +S      + ++     KSS  +PL   +++   + DK +      S+AE   
Sbjct: 791 TEMKLRKKSHLERPPTSRTGIAPLKSSDESPLEGANLVKGPTFDKTAG----TSNAECIF 846

Query: 821 KDP--RTSQENIELQMN-------KPNLDGKFASDMDFTTDNLN-------ELPGDVANW 864
            DP  +TS E     +N       K  L+       D T   LN        L  +V +W
Sbjct: 847 -DPVGKTSAEETSNNLNNSTELPFKTGLNSFVEQTNDITAMLLNNELIQGPSLSEEVTDW 905

Query: 865 FTTSGNIGLEFVEPWTEMIEQMYLQSGDA-NTTFDDLY 901
           F+ S +IGLEFVEPWTE+IEQ Y+Q GD  N  F++LY
Sbjct: 906 FSASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFENLY 943

>Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421W
           (REAL)
          Length = 954

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/928 (47%), Positives = 592/928 (63%), Gaps = 57/928 (6%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIP 78
           K +R Y+AC NC+ RKVKCD+GP++NPH PPCARC+RE K C F +T+G       + I 
Sbjct: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGETNGTSPNMIT 76

Query: 79  STTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPISP--TKWKIGLTSMQNSL 136
           + + T    S   +  +   S++ +  ++ +   +T           KWK  L+SMQN+L
Sbjct: 77  AASKTFLSKSEQQIRNR---STSPITADMTLSGKETGNETSFKSEGVKWKFELSSMQNAL 133

Query: 137 EFLAKAAGNVGFLSA------------PSAHSAREELNSAVVPKATSLPQEESLMNMTSS 184
           EFLA+AAG V    A            P          SA       L + +S  + T +
Sbjct: 134 EFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKRLSRGDSAASATCT 193

Query: 185 LHSDLLNISPIGKLQHKSLP-LIDKLNIVRPTPRRKLTDIDYIGPNRLLSESDAIELIDL 243
            H ++  +       +++   LI +++ VRP+P RK+ D DYIGP+ LL++ +AIELI+ 
Sbjct: 194 PHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDYIGPDNLLTKEEAIELIEA 253

Query: 244 FFLTMFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNGQNNKRRHI 303
           FFLTM PFFPNIPLQL +PKELA+YPIL CAILT+S+RYH FDT    + NG+N   RHI
Sbjct: 254 FFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFDTLG--LYNGENG-LRHI 310

Query: 304 DVHEKLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYASDPALNDI 363
           +VH+KLW+YCQ+LISQTIWAEASTRSIGT+LAFIIFTEWNPR+IH+ WSDYA+DP LN++
Sbjct: 311 EVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDPELNNV 370

Query: 364 SKRNMEPQIIKREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTKVAIATHIS 423
           + R  +    +++EEGLTG+ AIRRSDRM+WML+G+AVRLAQD G I  ++K+ I THIS
Sbjct: 371 NVRGSKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKIFIVTHIS 430

Query: 424 DTHTAMNMNQRSALSHSFNSDFFDHLSKSRYIGKDSTQ--VVNENFYLTQILQNKESKER 481
           +T +AMNMNQRS L+ SF S    +L K    GK++ +    NE FYL +IL N E K+R
Sbjct: 431 ETTSAMNMNQRSLLAESF-SVLNLNLEKFDSDGKENNENYFGNEKFYLDEILPNDEIKKR 489

Query: 482 WKKI--SATFQKDNEETVGQLSDMEYEFLNDEYALYFSKEDNDSS----QRPPLPLKFTF 535
           WK +   +    DNE+ +  L+D E EFLNDEY LY+S +++D++      PP PL+F+F
Sbjct: 490 WKGVFEDSADASDNEKYL--LTDWEREFLNDEYVLYYSNKNDDTNLAQNHTPPFPLRFSF 547

Query: 536 VQRAKLELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLIDSWYSNYNSLLKT 595
            QRAK+E++RI+++ YETIY E  +++L + DQR NL+VL+I SPL++ W SNY  +L  
Sbjct: 548 AQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSIFSPLMEGWLSNYREVLVP 607

Query: 596 DAVRPVSPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQVDVGQNKLKLNEIT 655
            +  P S    K K++ F     I+GE++I+D+ YCQLYIFSLALQVD   ++L +NEI 
Sbjct: 608 LSDVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQLYIFSLALQVDGKISRLNMNEIV 667

Query: 656 RCAIYVEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFIVKCYLTLTSGSFS 715
             A YVE AY +AKEIL SA RV +  MLK+MPV+WV+RI+RS+AFIVKCYLTLT    +
Sbjct: 668 TSARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLTLTGSELA 727

Query: 716 SNPEARTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAILLYLCREMKSKHE 775
           +NP+AR IL LSAISVDET   ++DTA+ LKEA PDELHL  RY+AIL+YLC EMK +  
Sbjct: 728 TNPDARNILKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLRKS 787

Query: 776 SSQQSKGYDSKSS----SNAPLSDDVITNQSGDKMSEDI---LLKSHAEVAAKDPRTSQE 828
           S  +       S+    SN   S + +          DI      S  E   K P    +
Sbjct: 788 SHLERPSLLRSSTTPLESNHGFSLEGVDVTKKSTFYRDIGGNKTDSKFETPEKLP---VD 844

Query: 829 NIELQMNKPN-LDGK------FASDMDFTTDNLN-------ELPGDVANWFTTSGNIGLE 874
            I   +N  N L GK         + D T   LN        L  +V +WF  S +IGLE
Sbjct: 845 EIGDNLNNSNDLSGKAIVNSFVEQNNDITAALLNNELFQGPSLSEEVTDWFGASEDIGLE 904

Query: 875 FVEPWTEMIEQMYLQSGDA-NTTFDDLY 901
           FVEPWTE+IEQ Y+Q GD  N  F++LY
Sbjct: 905 FVEPWTELIEQRYMQCGDGDNNNFENLY 932

>Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421W
           (REAL)
          Length = 949

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/941 (46%), Positives = 597/941 (63%), Gaps = 88/941 (9%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIP 78
           K +R Y+AC NC+ RKVKCD+GP++NPH+PPCARC+RE + C+F + K  K     S  P
Sbjct: 17  KRRRTYQACINCRSRKVKCDLGPVDNPHEPPCARCKRELRECLFSSQKVVK----NSTSP 72

Query: 79  STTPTLKPNSGNSVS-KKRLDSSTDLVNEVPVKIPKTSPSNPISPTKWKIGLTSMQNSLE 137
               T+  + G   +  +RL SS   ++E          S+ +   KWK+ L+SMQN+LE
Sbjct: 73  HMVNTICQSKGEIPNHSRRLISSEMALSEKGTNDETLFKSDGV---KWKLELSSMQNALE 129

Query: 138 FLAKAAGNVG--------------------FLSAPSAHSAREELNSAVVPK----ATSLP 173
           FLA+AAG V                      L  P   +A +EL +  + +    AT+ P
Sbjct: 130 FLAQAAGTVAKEGAKETIKDRSATPRPSESSLDTPHQSAANKELKTLSISECDASATNTP 189

Query: 174 QEESLMNMTSSLHSDLLNISPIGKLQHKSLPLIDKLNIVRPTPRRKLTDIDYIGPNRLLS 233
            E     + ++L+S+            K   LI +++  RP P R++ D +YIGP+ LL+
Sbjct: 190 HENITDTLAAALNSN-----------QKMSQLIKEISRARPMPTRRIDDFEYIGPDNLLT 238

Query: 234 ESDAIELIDLFFLTMFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSIN 293
           + +AIELI+ FFLTM PFFPNIPLQL +PKELA+YPIL C+ILT+S+RYH FDT    ++
Sbjct: 239 KEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCSILTVSARYHPFDTLG--LD 296

Query: 294 NGQNNKRRHIDVHEKLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSD 353
           NG+N  R HI+VH+KLWIYCQ+LISQTIWAEASTRSIGT+LAFIIFTEWNPR+IH+ WSD
Sbjct: 297 NGENGIR-HIEVHDKLWIYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSD 355

Query: 354 YASDPALNDISKRNMEPQIIKREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTN 413
           YA+DP LN++  R  +    K++EEGLTG+ AIRRSDRM+WML+G+AVRLAQD G I  +
Sbjct: 356 YANDPELNNVGVRESKNISTKKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENS 415

Query: 414 TKVAIATHISDTHTAMNMNQRSALSHSF-----NSDFFD---HLSKSRYIGKDSTQVVNE 465
           +K+ I THIS+T +AMNMNQR  L+ SF     N   FD   +     Y+G       NE
Sbjct: 416 SKIFIVTHISETTSAMNMNQRPLLAESFSVLNLNVRKFDDDGNKGNENYLG-------NE 468

Query: 466 NFYLTQILQNKESKERWKKISATFQKDNEETVGQLSDMEYEFLNDEYALYFS--KEDNDS 523
            FYL +IL + ESK+RWKK+    + D++     L+D E EFLNDEY LY+S  K+D + 
Sbjct: 469 KFYLNEILPDDESKKRWKKVFKDSEDDDDSEKNILTDWEREFLNDEYVLYYSNKKDDTNL 528

Query: 524 SQR--PPLPLKFTFVQRAKLELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPL 581
           +Q   PP PL+F+F QRAK+E++RI+++ YETIY E  +++L + DQR NL+VL++ SPL
Sbjct: 529 AQNPMPPSPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPL 588

Query: 582 IDSWYSNYNSLLKTDAVRPVSPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQ 641
           I+ W SNY  +L   +         K K++ F     ++GET+I+D+ YCQLYIFSLALQ
Sbjct: 589 IEGWLSNYREVLVPISDVSFLLADRKNKKQVFDNINRLNGETIITDFNYCQLYIFSLALQ 648

Query: 642 VDVGQNKLKLNEITRCAIYVEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAF 701
           VD   ++L +NEI   A YVE AY +AKEIL SA RV +  MLKYMPV+W +RI+RS+AF
Sbjct: 649 VDGKTSRLNMNEIMTSARYVELAYRSAKEILSSAKRVSRQGMLKYMPVRWAIRIIRSIAF 708

Query: 702 IVKCYLTLTSGSFSSNPEARTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSA 761
           IVKCYLTLT    ++NP+AR IL LSAISVDET   I+DTA+ LKEA PDELHL  RY+A
Sbjct: 709 IVKCYLTLTGSELATNPDARNILKLSAISVDETFDIIRDTAVTLKEATPDELHLCQRYAA 768

Query: 762 ILLYLCREMKSKHESSQQSKGYDSKSSSNAPLSDDVITNQSGDKMSEDI-----LLKSHA 816
           IL+YLC EMK + +S  +     +  ++  PL  +  ++  G   ++       +  + A
Sbjct: 769 ILMYLCTEMKLRKKSYTERPPLSTNGTT--PLESNCESSPEGVDFTKKPTFPKNIRSNKA 826

Query: 817 EVAAKDPRTS-QENIE-------LQMNKPNLDGKFASDMDFTTDNLN-------ELPGDV 861
           E  ++  + S  E I+          +K   +     + D TT  LN        L  +V
Sbjct: 827 ECNSESSKKSPMEEIDSNLNNPNNLSSKVIFNPFVEQNNDTTTTLLNNELFQGPSLSEEV 886

Query: 862 ANWFTTSGNIGLEFVEPWTEMIEQMYLQSGDAN-TTFDDLY 901
            +WF  S +IGL FVEPWTE+IEQ Y+Q GD +   F++LY
Sbjct: 887 TDWFGASEDIGLGFVEPWTELIEQRYMQCGDGDINNFENLY 927

>TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.525
           YDR421W
          Length = 831

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/885 (46%), Positives = 556/885 (62%), Gaps = 95/885 (10%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIP 78
           KW+R YKAC NC+LRK+KCDMGPL+ PH+PPC RC+REGKTC FL  + RK  +   +  
Sbjct: 14  KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFL--QSRKKSVFKRQHR 71

Query: 79  STTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIP----KTSPSNPISPTKWKIGLTSMQN 134
           +    L+           ++    + +EV V  P    +    N I   KW+  ++SMQN
Sbjct: 72  TNGLELQ---------DEVEKHVVITHEVDVGGPSDRIERHSRNKID-GKWRFEISSMQN 121

Query: 135 SLEFLAKAAGNVGFLSAPSAHSAREELNSAVVPKATSLPQEESLMNMTSSLHSDLLNISP 194
           +LEFLAKAAG+V      +     ++++ + V +  S  ++ +  +  +S    +  +  
Sbjct: 122 ALEFLAKAAGSVA--KEDNQLHEIKQIDPSQVSRDDSSWKDLTPTSFEASRAGIMAPLEA 179

Query: 195 IGKLQHKSLPLIDKLNIVRPTPRRKLTDIDYIGPNRLLSESDAIELIDLFFLTMFPFFPN 254
                 K++PLI KL+ VRP P  KL+++++IG +  L+E + I+L+D+FFLTM+PFFP+
Sbjct: 180 DEGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLVDVFFLTMYPFFPH 239

Query: 255 IPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNGQNNKRRHIDVHEKLWIYCQ 314
           IPLQLQ+P+ELA+YP+LLC+I+T+S+RYHSF       +N QNN  R+I+VHE+LWIYCQ
Sbjct: 240 IPLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLK-DNMQNN--RNIEVHEQLWIYCQ 296

Query: 315 RLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYA----SDPALNDISKRNMEP 370
           +LISQTIWAEASTRSIGT+LAF++FTEWNPRAIHW WSDYA    S    ND S      
Sbjct: 297 KLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGDSKDRSNDFS------ 350

Query: 371 QIIKREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTKVAIATHISDTHTAMN 430
             I R+ E LTG+ AIRRSDRMAWML+G AVRLAQD G   T++K+  ATHIS+THTAMN
Sbjct: 351 --ISRDSERLTGMAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFTATHISETHTAMN 408

Query: 431 MNQRSALSHSFNSDFFDHLSKSRYIGKDSTQVVNENFYLTQILQNKESKERWKKISATFQ 490
           + QRS L+ S N      +   R     +  V NE FYL +IL+N +SK+RW +     +
Sbjct: 409 VGQRSTLTESLNEINLGSIKFPR-----NNSVGNEQFYLEKILENDDSKDRWTRFLHDIR 463

Query: 491 KD-NEETVGQLSDMEYEFLNDEYALYFSKEDN----DSSQRPPLPLKFTFVQRAKLELLR 545
            D      G L+D+E EFLNDEY LY++ + +    DSS   P PL+F+ +QRAK+ELLR
Sbjct: 464 DDYAHHDEGPLTDIEREFLNDEYVLYYTADGDSKHRDSSNLLPFPLRFSKIQRAKIELLR 523

Query: 546 IVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLIDSWYSNYNSLLKTDAVRPVSPGM 605
           I+T+G+E IY    +Q+ + +D  RNL++L+++SPLI+SWY +Y+ LL+    +P +  +
Sbjct: 524 IITVGFEAIYCTKDKQQSLFNDPTRNLSLLHLISPLIESWYKSYHDLLEPAEGKPCTVDL 583

Query: 606 HKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQVDVGQNKLKLNEITRCAIYVEKAY 665
            + K+E   + + I  E++I +YYYCQLYI+S ALQVDV + +LKL+EITR A YVE AY
Sbjct: 584 CRNKREVHYVVRKIDRESLICEYYYCQLYIYSSALQVDVKEGQLKLHEITRSAKYVELAY 643

Query: 666 VAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFIVKCYLTLTSGSFSSNPEARTILS 725
            AAK +L SA R+H+L +LK MPV+WV RIV+SVAFIVKCYLTL   +  +NP A TIL 
Sbjct: 644 NAAKMLLTSATRLHRLNLLKCMPVRWVTRIVKSVAFIVKCYLTLMGNAVVNNPLANTILK 703

Query: 726 LSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAILLYLCREMKSKHESSQQSKGYDS 785
           L+ I  ++ ++TI   A+ILKEA+PDELHL  RYS IL+ LC EM+       +S+ Y +
Sbjct: 704 LTVIPAEDILKTIHTAALILKEASPDELHLCMRYSTILMSLCSEMR-------ESEDYTT 756

Query: 786 KSSSNAPLSDDVITNQSGDKMSEDILLKSHAEVAAKDPRTSQENIELQMNKPNLDGKFAS 845
            S +             G    +D            DP   Q                  
Sbjct: 757 DSPT------------PGTTFGQD-----------NDPSPIQ------------------ 775

Query: 846 DMDFTTDNLNELPGDVANWFTTSGNIGLEFVEPWTEMIEQMYLQS 890
                 D    LP DV +WF+TS  IGLEFVE W EMIEQ YLQ 
Sbjct: 776 ----PLDTAIPLPNDVVDWFSTSDEIGLEFVESWAEMIEQRYLQG 816

>ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 881

 Score =  743 bits (1917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/901 (45%), Positives = 547/901 (60%), Gaps = 69/901 (7%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIP 78
           KW+R YKAC +C+ +K+KCDMGPL+NPH PPC RCRRE K C+    K R       K+ 
Sbjct: 17  KWRRIYKACISCRNKKMKCDMGPLDNPHGPPCMRCRRENKECILPENKRRGNTDTEFKLG 76

Query: 79  STTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPISPT--KWKIGLTSMQNSL 136
                 K  +G      + +S   L+++     P  S SN +     KWK  + +M N+L
Sbjct: 77  ------KIENGLVGVMNKSESEQSLLSQTRAPPPNGSTSNNLDLVDPKWKFEIGTMYNAL 130

Query: 137 EFLAKAAGNVGFLSAPSAHSA--REELNSAVVPK-ATSLPQEESLMNMTSSLHSDLLNIS 193
           EFLAKAAG+V         S   R +L    +P  A +    +++ N+  S  S L  ++
Sbjct: 131 EFLAKAAGSVSKEEPIEMKSPQNRSDLGVGNMPDTALNGVMSDNIGNLDISDESFLAPLT 190

Query: 194 PIGKLQHKSLPLIDKLNIVRPTPRRKLTDIDYIGPNRLLSESDAIELIDLFFLTMFPFFP 253
                Q  + PLI+KL+ +RP   +KL D+DYIGP++LLSE +A  LID+FFLTM PFFP
Sbjct: 191 TANGSQRAAAPLIEKLSSMRPKSSKKLIDVDYIGPSKLLSEDEATRLIDIFFLTMHPFFP 250

Query: 254 NIPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNGQNNKRRHIDVHEKLWIYC 313
           +IPLQLQ+P EL +YPILLCAILTIS+RY+ F           N   R+I+VHE+LWIYC
Sbjct: 251 HIPLQLQDPDELVRYPILLCAILTISARYNPFGELGFYDGEAHN---RNIEVHERLWIYC 307

Query: 314 QRLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYASDPALNDISKRNMEPQII 373
           QRLISQTIWAEASTRSIGT+LAF++FTEWNPRAIHW WSDYA++P LND++KR       
Sbjct: 308 QRLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANNPELNDVTKRETHGANT 367

Query: 374 KREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTKVAIATHISDTHTAMNMNQ 433
            R+ E  TG+ A+RRSDRMAWML G AVRLAQD   I T++K+ +ATHI++ HTAMN+NQ
Sbjct: 368 PRDTETFTGMAAVRRSDRMAWMLIGAAVRLAQDMSFIDTSSKIFVATHIAEAHTAMNLNQ 427

Query: 434 RSALSHSFNSDFFDHLSKSRYIGKDSTQVVNENFYLTQILQNKESKERWKK-ISATFQKD 492
           +S LS S +    + L +   IG       NENFYL  ILQ  ESKERW   +    +  
Sbjct: 428 KSILSESLSEVNREVLERLDDIG-------NENFYLEHILQKDESKERWTNFLQNVSEGR 480

Query: 493 NEETVGQLSDMEYEFLNDEYALYFSKEDNDSSQRP----PLPLKFTFVQRAKLELLRIVT 548
             +  G L+DME EFLNDEY LY+    ND+S +     P PLKF+  QRAK+ELLRI+T
Sbjct: 481 RAKGTGPLTDMEREFLNDEYVLYYVNARNDASSKSSLTLPFPLKFSHPQRAKIELLRILT 540

Query: 549 LGYETIYYENGEQR--LVSDDQRRNLAVLNILSPLIDSWYSNYNSLLKTDAVRPVSPGMH 606
           +GYE+IYYE+ + +  L++ + +RNLA+L I+S LI+ W++ Y  LL      P S  M 
Sbjct: 541 IGYESIYYESEKDKTQLINGNPKRNLALLEIISTLIEKWHATYKDLLIPANATPCSLDMA 600

Query: 607 KRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQVDVGQNKLKLNEITRCAIYVEKAYV 666
           + K+   +++Q I  E++  DY YCQLYI+SLALQ DV    LK+ EI + A YVE AY 
Sbjct: 601 RNKRAVHELTQQIDRESLSCDYNYCQLYIYSLALQNDVKNMDLKMPEIRKSARYVELAYR 660

Query: 667 AAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFIVKCYLTLTSGSFSSNPEARTILSL 726
           AA+ IL+SA R+H LKML+YMPV+WV RIVR+VAF+VKCYL LT    ++NP A TIL L
Sbjct: 661 AAEGILDSAERIHSLKMLRYMPVRWVTRIVRAVAFLVKCYLVLTKDGLAANPVAGTILRL 720

Query: 727 SAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAILLYLCREMKSKHESS--------- 777
           + I  +ET+  I+  A+ L+EAAPDE+HL  RYS IL +LC E+K + + S         
Sbjct: 721 TVIPSEETVPIIERAAVTLQEAAPDEVHLGMRYSKILKFLCAEVKMRTQMSERDEEAEEE 780

Query: 778 ----QQSKGYDSKSSSNAPLSDDVITNQSGDKMSEDILLKSHAEVAAKDPRTSQENIELQ 833
               QQ + Y  +           + +QS    S  ++L S     + DP +        
Sbjct: 781 RKQRQQLECYHRQPRERRQQHAQPVISQSHSPPSPSVMLNS-----SMDPYSP------- 828

Query: 834 MNKPNLDGKFASDMDFTTDNLNELPGDVANWFTTSGNIGLEFVEPWTEMIEQMYLQSGDA 893
            + P  D  F    D                F  S +IGL+FV+ WTEMIE  Y+Q    
Sbjct: 829 -SAPPADLPFEDPFDL---------------FAASDDIGLDFVDTWTEMIENRYMQDELG 872

Query: 894 N 894
           N
Sbjct: 873 N 873

>KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {ON}
           Anc_5.525 YDR421W
          Length = 936

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/948 (44%), Positives = 566/948 (59%), Gaps = 80/948 (8%)

Query: 15  APNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGT 74
            P   W RG+KACTNC+++KV+CD GP +NPH PPCARC+RE K C F    G++ D+ T
Sbjct: 14  GPQTHWIRGFKACTNCRIKKVRCDFGPSDNPHPPPCARCKRESKNCTFTAKTGKEQDMVT 73

Query: 75  SKIPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSP-SNPISP-TKWKIGLTSM 132
            +  +  PT+       V K  L      V   P  I   S   N  +P T WK+ LTSM
Sbjct: 74  GEATNGIPTVDTVP---VKKNELALPALAVTVSPGLIQNRSEMGNEANPNTGWKLELTSM 130

Query: 133 QNSLEFLAKAAGNVGFLSAPSAHSAREELNSAVVPKATSLPQEE--SLMNMTSSLHSDLL 190
            N+L FLA+AAG V       +++  + L    +P   S P  E   L + T +  +  L
Sbjct: 131 HNTLAFLAQAAGTV-------SNTLNKGLMKKTLPSDRSTPSLEISRLGSKTPTGFASSL 183

Query: 191 NIS----PIGKL-----QHKSLPLIDKLNIVRPTPRRKLTDIDYIGPNRLLSESDAIELI 241
            +     P   L         + LI+K    +    + L DI  IG N LLSE +A   I
Sbjct: 184 GLGMPSNPTKTLLQEIETQNKVQLIEKSKNTKSKVPKTLKDIKCIGENGLLSEQEATAFI 243

Query: 242 DLFFLTMFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNGQNNKRR 301
           D FF TM PFFP IPLQLQ+P EL +YPILLCAILTIS+RYHSF  F    +NG  NKR 
Sbjct: 244 DAFFCTMHPFFPYIPLQLQDPLELLEYPILLCAILTISTRYHSFSEFG--FDNGDYNKR- 300

Query: 302 HIDVHEKLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYASD--PA 359
           + +VHEKLW  CQ ++S+TIW EASTRSIGT+LAFI+FTEWNPR IHW  SDYA+D   A
Sbjct: 301 NFEVHEKLWDNCQVMLSKTIWGEASTRSIGTVLAFILFTEWNPRQIHWKKSDYANDDDEA 360

Query: 360 LNDISKRNMEPQIIKREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTKVAIA 419
           ++++S           E E LTG  AIRRSDRMAWML+G+AVRLAQD G + TN KV +A
Sbjct: 361 VSELSND---------EAEELTGTKAIRRSDRMAWMLTGSAVRLAQDMGFMETNAKVCVA 411

Query: 420 THISDTHTAMNMNQRSALSHSFN-------SDFFDHLSKSRYIGKDSTQVVNENFYLTQI 472
           THISD   +MNMNQ+  LS +FN       +   D L+ S   G       +E  ++ Q+
Sbjct: 412 THISDAFASMNMNQKPVLSGNFNVLQGGTNNYTSDPLNSS---GSSHESTCSEQAFMKQM 468

Query: 473 LQNKESKERWKKISAT------FQKDNEETVGQLSDMEYEFLNDEYALYFSKED-NDSSQ 525
           L+N  S  RW+ I ++      FQ+   E    LSD+E EFLNDE+ LY+S E  +D+ +
Sbjct: 469 LENTNSHTRWRHILSSLQMEDLFQRQRNEYSNDLSDLEREFLNDEFILYYSLERRSDNQE 528

Query: 526 RPPLPLKFTFVQRAKLELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLIDSW 585
            PP PL+F++ Q+AK+EL  I+ LGY+TIYY+ G ++L S++Q  NL+VL+ILSPL++ W
Sbjct: 529 TPPFPLQFSYAQKAKIELTNIMLLGYDTIYYDRGRKKLASNNQLHNLSVLSILSPLMEGW 588

Query: 586 YSNYNSLLKTDAVRPVSPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQVDVG 645
           ++ Y +LL   +  P +      K+  +++S+NI  E++I DY Y QLYI+SLALQ D  
Sbjct: 589 HNVYKNLLIAPSANPYTTTTRGDKRAMYELSKNIDSESIICDYRYSQLYIYSLALQADFK 648

Query: 646 QNKLKLNEITRCAIYVEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFIVKC 705
           + +L ++EIT+ A YVE A+ AAKEI+ SA RVHKL +LKYMPV+WVMR+VR+V+F+VKC
Sbjct: 649 RAELTVSEITQNAKYVEIAFNAAKEIIFSAFRVHKLNLLKYMPVRWVMRLVRAVSFLVKC 708

Query: 706 YLTLTS----GSFSSNPEARTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSA 761
            L L +    G  SS  E RTIL L +ISV +T  TI+  A+ LKEA PDELHLS RYSA
Sbjct: 709 CLILNATSIGGGGSSEAEVRTILKLCSISVKDTANTIKMAAMTLKEATPDELHLSMRYSA 768

Query: 762 ILLYLCREMKSKHESSQQ-------SKGYDSKSSSNAPLSDDVITNQSGDKMSEDILLKS 814
           ILLYLCRE++S+ +SS++       +  Y    +      +    +  G   +  I    
Sbjct: 769 ILLYLCRELESEKDSSKKIPFPNNATTKYAISPTYEGRDGEIAAGSAGGCANTAHITANR 828

Query: 815 HAEVAAKD-PRTSQENIELQMNKPNLDGKFASDMDF-------------TTDNL-NELPG 859
              V   D   T+  N E   N   ++G    D +              TTD L   LP 
Sbjct: 829 LRTVPLSDINETTGRNTEDTANNNIVNGSLNGDRNHLGTTEGTGAASQSTTDRLTGSLPD 888

Query: 860 DVANWFTTSGNIGLEFVEPWTEMIEQMYLQSGDANTTFDDLYKEICQD 907
           +V NWF+ +  IGLEFVEPWT+MIEQ +LQSG  N  F++LY+   Q+
Sbjct: 889 EVTNWFSGNAEIGLEFVEPWTDMIEQRFLQSGTGNDVFEELYQYFDQN 936

>Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa]
           {ON} complement(183595..186372) [2778 nt, 926 aa]
          Length = 925

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/933 (44%), Positives = 571/933 (61%), Gaps = 81/933 (8%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRK--------- 69
           KW+R Y+AC NC+ RK+KCD+GPL+NPH PPC RC+RE + C+F  TK R          
Sbjct: 18  KWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRRDVTAKINNMK 77

Query: 70  -ADLGTSKIPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPISPTKWKIG 128
            ++L  S I S  P         V KK L+      +++     +  P++    + W+  
Sbjct: 78  GSELERSIISSILP--------DVDKKSLNGGGSAGSDLKQNNIRKKPTD----SNWQSD 125

Query: 129 LTSMQNSLEFLAKAAGNVGFLSAPSAHSAREELNSAVVPKAT-SLPQEESLMNMTSSLHS 187
           +++MQ +LEFLA A G +      S  +  +         A  S P  ++  +++ S  +
Sbjct: 126 ISTMQTALEFLANAVGVISKSDTRSLLNLNQNNTLIENEDADDSNPNNDNSEDVSRSDSN 185

Query: 188 DLLNISPIGKLQHKSL------PLIDKLNIVRPTPRRKLTDIDYIGPNRLLSESDAIELI 241
              + + I  L H         PL+  +  +RP P R L+DI+YIGPN+LL+E +A  LI
Sbjct: 186 TPKSRNSIFSLIHDDTASKVISPLMGTIESIRPKPTRNLSDIEYIGPNKLLTEDEARTLI 245

Query: 242 DLFFLTMFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNGQNNKRR 301
           ++FFLTM P+FP IPLQL NP EL +YPILLCAILT+SSRY+SF+     INN +  K R
Sbjct: 246 NVFFLTMHPYFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFNEIF--INN-EYEKDR 302

Query: 302 HIDVHEKLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYASDPALN 361
           +I VHEKLW YCQRLIS TIWAEASTRSIGTILAF++FTEWNPRAIHW WSDY ++P L 
Sbjct: 303 NIVVHEKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHWTWSDYGNNPELT 362

Query: 362 DISKRNMEPQIIKREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTKVAIATH 421
             +K N E  + + + E  TG +A+R SDRMAWM +G+AVRLAQD   I  N K+ +ATH
Sbjct: 363 CFTKNN-ENNMSEFKGEKTTGFEAMRHSDRMAWMFTGSAVRLAQDMHFIDNNYKIFMATH 421

Query: 422 ISDTHTAMNMNQRSALSHSFNSDFFDHLSKSRYIGKD---------STQVVNENFYLTQI 472
           IS+T  AMN+NQRS LS S ++    +LS +R  GK+         +    NE +YL QI
Sbjct: 422 ISETFNAMNVNQRSTLSDSLSNI---NLSITRSHGKNNDDEEGHIFAENFGNEQYYLEQI 478

Query: 473 LQNKESKERWKKISATFQKD-NEETVGQLSDMEYEFLNDEYALYFSKEDNDSSQRP---- 527
           L++ +SKE+W K       + + E    ++D E E+LNDEY LY+  ++N+   +P    
Sbjct: 479 LKHDKSKEKWIKFLKEINSNKSSENSTVITDAEREYLNDEYILYY--QNNNPETQPTWGN 536

Query: 528 --------PLPLKFTFVQRAKLELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILS 579
                   P PLKF    +AK+E+LRI+++ YETIY    ++ L  ++QR+NLAVL+I S
Sbjct: 537 HSVTSTSLPYPLKFASFHKAKIEILRIMSIAYETIYSAKNKRVLAFNNQRQNLAVLSIFS 596

Query: 580 PLIDSWYSNYNSLLKTDAVRPVSPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLA 639
           PLI+SWYSN++ LLK     P     +K K    K+SQ I  E++I DYYYCQLYI+SLA
Sbjct: 597 PLIESWYSNHHGLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYYCQLYIYSLA 656

Query: 640 LQVDVGQNKLKLNEITRCAIYVEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSV 699
           L+VD+  N L L+EIT+ A YV  AY AAKEIL SA RV+KLK+L+Y+PV+WV RI+RSV
Sbjct: 657 LKVDIKDNNLNLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVRWVTRILRSV 716

Query: 700 AFIVKCYLTLTSGSFSSNPEARTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRY 759
           AFIVKC+L LT    S N E   I+ LS I VDE ++ I+ T++ L +A+PDELHL  RY
Sbjct: 717 AFIVKCFLLLTESETSENSEINAIIRLSGIPVDEALELIETTSVTLNDASPDELHLCKRY 776

Query: 760 SAILLYLCREMKSKHESSQQSKGYDSKSSSNAPLSDDVITNQSGDKMS---------EDI 810
           S+ILLY+C+E+++K ++   ++G  +K  +    +D  + N+S + +S         E  
Sbjct: 777 SSILLYMCKELRNKTQNLYMNEGVAAKQEN----ADVKVGNKSLENLSSIENSQEPIEPF 832

Query: 811 LLKSHAEVAAKDPRTSQENIELQMNKPNLDGKFASDMDFTTDNLNELPGDVANWFTTSGN 870
           ++  H +     P  + E I +  N    +            N     G+V +WF++S +
Sbjct: 833 IMNEHPQTEL--PINTTEQIAIVGN----EHHGIEQTPILNPNSMSFQGEVIDWFSSSAD 886

Query: 871 IGLEFVEPWTEMIEQMYLQS--GDANTTFDDLY 901
           IGLEFVE WTEMIEQMYL+S  GD N   + L+
Sbjct: 887 IGLEFVESWTEMIEQMYLRSSDGDQNIHVNSLF 919

>KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 857

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/905 (43%), Positives = 551/905 (60%), Gaps = 93/905 (10%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIP 78
           K++RGYKAC NC+ RK +CD+GP ++P DPPC RC+RE K CVFL    R    G  +I 
Sbjct: 16  KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRG---GRKRIE 72

Query: 79  STTPTLKPNSGNS--VSKKRLDSSTDLVNEVPVKIPKTSPSNPISPTKWKIGLTSMQNSL 136
            T        GN+   +  R ++    +    +K   +     ++P      L SM N+L
Sbjct: 73  WTV------DGNTDVNATARFEAEDKYIPVATLKDTTSIKEGSLTPE-----LNSMHNAL 121

Query: 137 EFLAKAAGNVGFLSAPSAHSAREELNSAVVPKATSLPQEESLMNMTSSLHSDLLNISPIG 196
           EFLAKAAG+     + S   + E  +  +  K  +  +EES     S   S   +++  G
Sbjct: 122 EFLAKAAGSAAKEDSRSRIPSYERQDKTIREK--TYHREESPNQHASG--SKRASLATPG 177

Query: 197 KLQHKSLPLIDKLNIVRPTPRRKLTDIDYIGPNRLLSESDAIELIDLFFLTMFPFFPNIP 256
           KL       I+KL+  +P     L D++YIG ++LL+E +A  LIDLFFL M PFFP IP
Sbjct: 178 KL-------IEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNMHPFFPYIP 230

Query: 257 LQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNGQNNKRRHIDVHEKLWIYCQRL 316
            QL+  +EL +YPILLCAILTIS+RYH+F      ++ G+ + R +I+VH++LWIYCQRL
Sbjct: 231 FQLRCSQELKRYPILLCAILTISARYHNFAEH--KVSEGERSSR-NIEVHDRLWIYCQRL 287

Query: 317 ISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYASDPALNDISKRNMEPQIIKRE 376
           ISQ++WAEASTRS+GTILAF++FTEWNPRAIHW+W+DYA+D +L+DIS+R+   +  + +
Sbjct: 288 ISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISRRDYHSEAKRSD 347

Query: 377 EEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTKVAIATHISDTHTAMNMNQRSA 436
              LTG+ A+RRSDRMAWML+GTAVRLAQD G +  + K+  A HI++T TAMNMNQRS 
Sbjct: 348 NTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMNNSPKIFTALHITETQTAMNMNQRSI 407

Query: 437 LSHSFNSDFFDHLSKSRYIGKDSTQVVNENFYLTQILQNKESKERWKKISATFQKDNEE- 495
           LS S        L++    G D    ++ +  + +I +N++SK RWK  S T Q+D+ E 
Sbjct: 408 LSQS--------LAEVSLNGHDGDSGLS-SACIEEIFRNEDSKRRWK--SYTQQRDSVEG 456

Query: 496 -TVGQLSDMEYEFLNDEYALYFSKEDNDS---------SQRPPLP----LKFTFVQRAKL 541
            +VG   D E EFL DEYA +F  ED+D+          ++  L     L FT  QRAK+
Sbjct: 457 KSVG-FCDNEKEFLIDEYA-FFHNEDSDAYRDLSNLGTHEKSKLSAADKLLFTPRQRAKV 514

Query: 542 ELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLIDSWYSNYNSLLKTDAVRPV 601
           ELLRI+++GYE IYY++ +  L+  D +  LAVL IL+P+I  W++ Y  LL   A    
Sbjct: 515 ELLRIMSIGYEAIYYKDTKLTLI--DHKHKLAVLGILAPMIKGWHNTYKHLLVPFAGGQC 572

Query: 602 SPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQVDVGQNKLK---LNEITRCA 658
            P   + K   +     I  E++ISDY+YCQLYI+SLALQ++ G  K K   +NE+T+ A
Sbjct: 573 PPTRDENKNATYDTPSKIDSESLISDYFYCQLYIYSLALQIEAGTEKDKKPNINELTKSA 632

Query: 659 IYVEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFIVKCYLTLTSGSFSSNP 718
            YVE AY AAKE+L SA RVHKL+ LKYMPV+W  RI+R+VAF+V+CY+TLT     S+P
Sbjct: 633 KYVELAYNAAKEVLHSAIRVHKLRALKYMPVRWAARIIRAVAFVVRCYMTLTGSGLGSDP 692

Query: 719 EARTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAILLYLCREMKSKHESSQ 778
            A TIL++  IS +E I+ IQ  AI L+EA+PDELHL +R+S +L++LC EMK K  S  
Sbjct: 693 RATTILAVCVISAEEIIEMIQKAAITLREASPDELHLCSRFSTVLMFLCTEMKRKQHSEP 752

Query: 779 QSKGYDSKSSSNAPLSDDVITNQSGDKMSEDILLKSHAEVAAKDPRTSQENIELQMNKPN 838
           Q+      SS +                     L +  +  A+ P T  EN         
Sbjct: 753 QNSELRRSSSHS---------------------LHNPTDAPARMPTTPAENYAAT----- 786

Query: 839 LDGKFASDMDFTTDNLNELPGDVANWFTTSGNIGLEFVEPWTEMIEQMYLQSGDANTTFD 898
               FA      T + + LP ++ +WF TS ++GL+FVEPW EM+EQ ++ + D N TF+
Sbjct: 787 ---DFAIPAFLETPHPSHLPSELEDWFCTSDDVGLDFVEPWAEMLEQQFINN-DKNMTFE 842

Query: 899 DLYKE 903
           +LY E
Sbjct: 843 NLYNE 847

>KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {ON}
           similar to uniprot|Q04052 Saccharomyces cerevisiae
           YDR421W ARO80 Zinc finger transcriptional activator of
           the Zn2Cys6 family activates transcription of aromatic
           amino acid catabolic genes in the presence of aromatic
           amino acids
          Length = 945

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/797 (48%), Positives = 521/797 (65%), Gaps = 77/797 (9%)

Query: 20  WKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIPS 79
           +KRGYKAC NCK+RKVKCD+GP +NPH PPC RC+RE + C+F  TK     +    + S
Sbjct: 17  FKRGYKACLNCKMRKVKCDLGPFDNPHGPPCVRCKRESRECMFTETKRGGFRVAKQSLVS 76

Query: 80  TTPTLKPNSGNSVS------------KKRLDSSTDLVNEVPVKIPKTSPSNPISPTKWKI 127
                + ++G S++            KK LD+  D + +   K   +  ++P  PT    
Sbjct: 77  LK---EESAGKSMADVITSVIQGQTLKKELDTDLDRL-QTHTKDDISINTDP--PT---- 126

Query: 128 GLTSMQNSLEFLAKAAGNVGFLSAPSAHSAREELNSAV-------------VPKATSLPQ 174
               +QN+  FLAKAAG+V      +    R+++++A               P  +S   
Sbjct: 127 ----LQNAFYFLAKAAGSV------AKEDLRDQVDAATKYDEIEPTDAVSRQPSVSSYGN 176

Query: 175 EESLMNMTSSLHSDLLN-------ISPIGKLQHKSLPLIDKLNIVRPTPRRKLTDIDYIG 227
           +++  +M  S    +L        + P G+ +  ++PLI+KL+ VRP P  KL DI+YIG
Sbjct: 177 KQATGSMEPSSIPKMLTDSYVTSFVEPEGQ-KPGTIPLIEKLSSVRPKPSMKLGDIEYIG 235

Query: 228 PNRLLSESDAIELIDLFFLTMFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHSF-D 286
           P +LL+E++A + ID FFLTM PF P IPLQLQ+  ELA+YP+LLC ILTIS+RYH+  D
Sbjct: 236 PYQLLTEAEARKRIDAFFLTMHPFSPYIPLQLQDADELARYPLLLCTILTISARYHTLHD 295

Query: 287 TFADSINNGQNNKRRHIDVHEKLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNPRA 346
              + I+N       H+++HE+LWIYCQRL+SQT+WAEASTRSIGTILAF+IFTEWNPRA
Sbjct: 296 LGLNEIDNTV-----HVELHERLWIYCQRLVSQTVWAEASTRSIGTILAFLIFTEWNPRA 350

Query: 347 IHWNWSDYASDPALNDISKRNMEPQIIKREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQD 406
           IHW  SDYA+ P ++D+ KR        +  + LTG+ A+RRSDRM+W+L+G AVRLAQD
Sbjct: 351 IHWKGSDYANYPDISDLPKRPSSQTSQPQGSDSLTGLAAMRRSDRMSWLLTGNAVRLAQD 410

Query: 407 TGLIRTNTKVAIATHISDTHTAMNMNQRSALSHSFNSDFFDHLSKSRYIGKDSTQVVNEN 466
             +I  ++K+ + THI +THTAMN+N+RS+LS S        LS+ R  G +   + NE 
Sbjct: 411 LNVIEFSSKIFVMTHICETHTAMNLNKRSSLSES--------LSEVRLNGFEDNDLDNEQ 462

Query: 467 FYLTQILQNKESKERWKKISATFQKDNEETVGQLSDMEYEFLNDEYALYFSKEDNDSSQR 526
           F+L +ILQN +SKERW +      + +++  G L+D+E EFLNDEY LY    +N ++Q 
Sbjct: 463 FFLERILQNDKSKERWARFLERVGERSKK--GSLTDIEREFLNDEYLLYHYNTENPNTQS 520

Query: 527 -PPLPLKFTFVQRAKLELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLIDSW 585
            P   LKF+ +QR K+ELL+IV+LGYE +Y  NG  +L S D+ + L++L++LSPLI+ W
Sbjct: 521 DPEFRLKFSKIQRGKVELLKIVSLGYENVY--NG--KLSSHDRHQRLSMLSVLSPLIEGW 576

Query: 586 YSNYNSLLKTDAVRPVSPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQ---V 642
           Y+ Y SLL        S      K   F+M++ +  E++ISDYYYCQLYI+SLALQ    
Sbjct: 577 YNIYKSLLVPCGGAACSIAKSSNKSFVFEMTEKVEHESLISDYYYCQLYIYSLALQWDHQ 636

Query: 643 DVGQNKLKLNEITRCAIYVEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFI 702
           D   +KL+LNEIT+ A YVE AY AAKEIL SA RVHKLKMLKYMPV+WVMRIVRS+ F+
Sbjct: 637 DTSTSKLRLNEITKSARYVELAYNAAKEILNSAQRVHKLKMLKYMPVRWVMRIVRSIVFM 696

Query: 703 VKCYLTLTSGSFSSNPEARTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAI 762
           +KCYLTLT    + NPEA TIL++S +  DE IQTIQ TAIIL+ AAPDELHL +RYS I
Sbjct: 697 IKCYLTLTGNGITQNPEANTILTMSVLPTDEIIQTIQRTAIILRAAAPDELHLCSRYSTI 756

Query: 763 LLYLCREMKSKHESSQQ 779
           L+YLC EMK + + + Q
Sbjct: 757 LMYLCTEMKHRCKPNMQ 773

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 30/48 (62%), Gaps = 3/48 (6%)

Query: 857 LPGDVANWFTTSGNIGLEFVEPWTEMIEQMYLQSGDANTT---FDDLY 901
           LP  + +WF  +  IGL+FV PWTEM+E+ ++   D ++    F+D Y
Sbjct: 894 LPPQLVDWFNDNNEIGLDFVGPWTEMVEKQFVNKVDDSSYENWFNDFY 941

>TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/908 (42%), Positives = 552/908 (60%), Gaps = 74/908 (8%)

Query: 14  RAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLG 73
           R  + KWKR ++AC  C+ RK+KC++GPL+NPH PPC RC+RE + C+F+    +   L 
Sbjct: 7   RTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSRSLS 66

Query: 74  TSKIPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPISPTKWKIGLTSMQ 133
              I         N G+     +L        +      K   +  +  + W+  ++SMQ
Sbjct: 67  PKDI---------NYGDDGDDNKLKFIHYQQGDNKGANNKEIQNMALEDSAWESDVSSMQ 117

Query: 134 NSLEFLAKAAGNVGFLSAPSAHSAREELNSAVVPKATSLPQEESLMNMTSSLHSDLLNIS 193
           N+LE+LA AA +V   S    H    +L+  V   +     +E+++            + 
Sbjct: 118 NALEYLASAAKSV---SQFENHKPTSKLSDMVNSYSKDDMTQENIIK----------ELF 164

Query: 194 PIGKLQHKSLPLIDKLNIVRPTPRRKLTDIDYIGPNRLLSESDAIELIDLFFLTMFPFFP 253
              +L++ +  LI +L+ +R  P +KL+DI YIG ++LL+E +A  LI++FF  + PFFP
Sbjct: 165 EKTELKNPASSLIAQLSRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIEVFFQKLHPFFP 224

Query: 254 NIPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNGQNNKRRHIDVHEKLWIYC 313
            IPLQL NP++L +YPILLCA++TIS+RY++F    D     + +   +I +HEKLW+YC
Sbjct: 225 YIPLQLHNPEQLVRYPILLCAVITISARYNNF---GDLDLKTRESPDYNITIHEKLWMYC 281

Query: 314 QRLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYASDPALNDISKRNMEPQII 373
           QRLIS+TIWAEASTRSIGTILAF++FTEWNPRAIHWNWSDYA+D    + ++ N    I 
Sbjct: 282 QRLISRTIWAEASTRSIGTILAFLLFTEWNPRAIHWNWSDYANDSETINFNELNEFDPIN 341

Query: 374 KREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTKVAIATHISDTHTAMNMNQ 433
             + E +TG +A+R SDRMAWML+G+AVRLAQD   I T+ K+ +ATHI++T+ AMN+N 
Sbjct: 342 SYKGESITGFEAMRHSDRMAWMLTGSAVRLAQDMKFIDTSNKIFLATHIAETYNAMNVNL 401

Query: 434 RSALS--------HSFNSD---FFDHLSKSRYIGKDSTQVVNENFYLTQILQNKESKERW 482
           RS+LS        HS   D     D     RY G       NE +YL QI +N + +E  
Sbjct: 402 RSSLSESLSNVNIHSKKIDPVKIIDGKKSERYFG-------NEKYYLEQIFKNAKDRESS 454

Query: 483 KKISATFQKDNEETVGQLSDMEYEFLNDEYALYFSKEDNDSSQRPPL--PLKFTFVQRAK 540
             +     ++         D E +FLNDEY L++S  D D++Q   L  PL FT +QRAK
Sbjct: 455 YDLLENILRE-RRNAKAFPDNERDFLNDEYILFYSNPD-DATQNDELDTPLDFTVIQRAK 512

Query: 541 LELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLIDSWYSNYNSLLKTDAVRP 600
           +ELL+I+++GYETIY E G +   +++Q++NLA+LNI S LIDSWY NYN LL  +    
Sbjct: 513 IELLKIMSIGYETIYLEKGRRYTTANNQKQNLAMLNIFSALIDSWYVNYNELLSPEET-- 570

Query: 601 VSPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQVDVGQNKLKLNEITRCAIY 660
           + P ++  K     M+Q I  E++I DYYYCQLYI+SL+LQV+  ++KLKL E+++ A Y
Sbjct: 571 LDPVLNASKMGLQSMTQIIENESLICDYYYCQLYIYSLSLQVEDEESKLKLKELSQSAKY 630

Query: 661 VEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFIVKCYLTLTSGSFSSNPEA 720
           V  AY +AKEIL SA R+ +++MLK++PV+WV+RIVR+++FIVKCY+T T     +  E 
Sbjct: 631 VSIAYSSAKEILNSAKRLQEVRMLKFIPVRWVIRIVRAISFIVKCYVTATDKDSMNYKEL 690

Query: 721 RTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAILLYLCREMKSKHESSQQS 780
            ++LSLS I VDE+++ I   A++LKE+ PDELHL TRYS ILL L RE+K    S+QQ+
Sbjct: 691 NSLLSLSGIPVDESLELIHTAAVLLKESTPDELHLCTRYSKILLCLYRELKMDTLSTQQA 750

Query: 781 KGYDSKSSSNAPLSDDVITNQSGDKMSEDILLKSHAEVAAKDPRTSQENIELQMNKPNLD 840
            G DS                    M E +   +  E A +   T+  N   Q+    L 
Sbjct: 751 HGNDS--------------------MPERLTADTTLENAIRTEFTTTSNSGSQVELTPLS 790

Query: 841 GKFAS---DMDFTTDNLNELPGDVANWFTTSGNIGLEFVEPWTEMIEQMYLQSGDA-NTT 896
            K A+   D + TT      P +V +WF+TS +IGLEFVEPWTEMIEQ Y++SG+  N  
Sbjct: 791 NKLATLPIDRN-TTPPYASFPTEVVDWFSTSADIGLEFVEPWTEMIEQRYIKSGNTQNKD 849

Query: 897 FDDLYKEI 904
           FDDL   I
Sbjct: 850 FDDLLSTI 857

>TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {ON}
           Anc_5.525 YDR421W
          Length = 1018

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/815 (41%), Positives = 489/815 (60%), Gaps = 64/815 (7%)

Query: 12  QKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKAD 71
           + +  + +W+R YKAC NC+L+KVKCD+GPLENPH PPC RC+RE + C+F     +   
Sbjct: 16  KSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGT 75

Query: 72  LGTSKIPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPS---NPISPTK---- 124
           +             PNS     +  +  +TD++ E    I  T+ S   N IS ++    
Sbjct: 76  VENENDSIDDNQRVPNS----PEDEIQQNTDIIQERISSIVATNESRFNNDISNSQKHER 131

Query: 125 ----------WKIGLTSMQNSLEFLAKAAGNVGFLSAPSA-----HSAREELNSAVVPKA 169
                      K+  T+M+N+LEFLA AAG               +   +ELN   +  +
Sbjct: 132 KDKPSERKSNLKVNFTNMRNALEFLANAAGQAAEERLSEEEEELNNKFEKELNDDHI--S 189

Query: 170 TSLPQEESLMNMTSSLHSDL-------LNISPIGKLQHKSLPLIDKLNIVRPTPRRKLTD 222
              P  +S  +  S  H DL       L +S     + K   LI+ +   RP   RKLTD
Sbjct: 190 IDSPATQSTTSTDSVKHLDLSDESIASLFLSENETNRKKVTSLIEAVIAARPISNRKLTD 249

Query: 223 IDYIGPNRLLSESDAIELIDLFFLTMFPFFPNIPLQLQNPKELAQYPILLCAILTISSRY 282
            DYIG ++++SE +AI+LI+ FFLTM PF+P +P QLQ+P ELA+YPILLC ILTISSR+
Sbjct: 250 YDYIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILLCTILTISSRH 309

Query: 283 HSFDTFADSINNGQNNKRRHIDVHEKLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEW 342
           H F+       NG N+KR HIDVHEKLW+YCQ++ISQT+WAEASTRS+GT+LAF++FTEW
Sbjct: 310 HKFNELGTY--NGVNDKR-HIDVHEKLWVYCQKMISQTVWAEASTRSLGTVLAFLLFTEW 366

Query: 343 NPRAIHWNWSDYASDPALNDISKRNMEPQIIKREEEGLTGIDAIRRSDRMAWMLSGTAVR 402
           NPRAIHW W+DYA++P LND S  +       +  +  TG+ AIRRSDRMAWML GT+VR
Sbjct: 367 NPRAIHWKWADYANNPKLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDRMAWMLCGTSVR 426

Query: 403 LAQDTGLIRTNTKVAIATHISDTHTAMNMNQRSALSHSFNSDFFDHLSKSRYIGKDSTQV 462
           +AQD G I  ++ V +ATH S+T  AMN+ QRS+L+ S N  ++     S Y  K    +
Sbjct: 427 IAQDMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSSYRNKQQQTL 486

Query: 463 VNENFYLTQIL-QNKESKER--WKKISATFQKDNEETVG-----QLSDMEYEFLNDEYAL 514
            NE FY+  I  +N +  ER  WK   +  Q++ E  +       LSD    FLNDE+AL
Sbjct: 487 KNEIFYIENIFSENFKITERNYWK---SQLQENIENKIDIDDKIALSDKVRGFLNDEFAL 543

Query: 515 YFSKED-----NDSSQRP-------PLPLKFTFVQRAKLELLRIVTLGYETIYYENGEQR 562
           ++S  +     N+ + +P       PLP+  +  Q+A +ELLRI +  Y+TIY  N  Q+
Sbjct: 544 FYSNGNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKTIYSRNQNQK 603

Query: 563 LVSDDQRRNLAVLNILSPLIDSWYSNYNSLLK-TDAVRPVSPGMHKRKQEAFKMSQNISG 621
           L S++Q  N+++L+I +PL+ +W   +  LL+ +D   P++      K+   + ++ I G
Sbjct: 604 LSSNNQSHNISLLDIFAPLLHNWTIAFGDLLQPSDVCEPINLNNRNNKRVVKEFNKIIEG 663

Query: 622 ETMISDYYYCQLYIFSLALQVDVGQNKLKLNEITRCAIYVEKAYVAAKEILESAGRVHKL 681
           E++I DY YCQLYIFSLALQ+ +    L +NEIT+ + Y+  AY +AKE + S  RV  L
Sbjct: 664 ESLICDYNYCQLYIFSLALQIGLDGEILTVNEITKSSTYINLAYQSAKEYILSTERVFTL 723

Query: 682 KMLKYMPVKWVMRIVRSVAFIVKCYLTL--TSGSFSSNPEARTILSLSAISVDETIQTIQ 739
           KMLKYMPV+W+ R++R+ AF+VKCYL++  T    +S  E   I  L   S +E ++ I+
Sbjct: 724 KMLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGGTSANEVLELIK 783

Query: 740 DTAIILKEAAPDELHLSTRYSAILLYLCREMKSKH 774
            +AI+L  ++PDELHL +RYS+I++   +EM  K+
Sbjct: 784 KSAILLGSSSPDELHLCSRYSSIIMCFYKEMSEKN 818

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 25/30 (83%)

Query: 863  NWFTTSGNIGLEFVEPWTEMIEQMYLQSGD 892
            +WF+ SG+IGLEFVE WTEM+EQ Y++  D
Sbjct: 983  DWFSASGDIGLEFVESWTEMLEQRYMKDDD 1012

>CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421w
           positive transcription regulator of ARO9 and ARO10
          Length = 928

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/928 (39%), Positives = 530/928 (57%), Gaps = 74/928 (7%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGT---- 74
           K K  + AC  CK +K+KCD+GP + P  PPCA CRR    C F   K +   LG     
Sbjct: 30  KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKLGNILDS 89

Query: 75  --------------SKIPSTTPTLKP----NSGNSVSKKRLDSSTDLVNEVPVKIPKTSP 116
                         S + + T +L+     N   ++    L +   L N+    +   SP
Sbjct: 90  QGLQSSQSTSPTSASMLNAITQSLQNHRAMNGNQNMHLNNLSNLVGLKNQNLEGVSLNSP 149

Query: 117 SNPI--------SPTKWKIGLTSMQNSLEFLAKAAGNVGFLSAPSAHSAREELNSAVVPK 168
           +  +        S T WK+ LTSMQ++LEFLAKA          + +   E   S     
Sbjct: 150 NTALIEACDRVKSDTAWKLELTSMQSALEFLAKAT------KLRNDYKNNEPFGSTRSDA 203

Query: 169 ATSLPQEESLMNMTSSLHSD-LLNISPIGKLQHKSLPLIDKLNIVRPTPRRKLTDIDYIG 227
           A++  +   L    +   SD   N +        S P I+ +    PTP     + D +G
Sbjct: 204 ASTTSETRDLSEKDNGNESDSTTNSTSKDTSTRSSYPSIEAIKPEVPTPSNH--NYDLLG 261

Query: 228 PNRLLSESDAIELIDLFFLTMFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHSFDT 287
             +L++  +A  L+++FF  M PF+P IPL LQ+  EL +YP+LL  IL IS+RY+ FD 
Sbjct: 262 DGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLLLHCILAISARYNPFDK 321

Query: 288 FADSINNGQNNKRRHIDVHEKLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNPRAI 347
                +NG    R  I +H KLW +CQ+L+SQT+W++ASTRSIGT LAF++FTEWNPRAI
Sbjct: 322 VG--FDNGIEGNRNVI-IHNKLWTHCQQLLSQTVWSQASTRSIGTTLAFLLFTEWNPRAI 378

Query: 348 HWNWSDYASDPALNDISKRNMEPQIIKREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDT 407
           HW  SD A   + N++S    +P       +GL GI  ++RSDRMAWM +GTA+RLAQ+ 
Sbjct: 379 HWEVSDTAHYLSDNNVSSSKEDP-------DGLGGIATVKRSDRMAWMFTGTAIRLAQEM 431

Query: 408 GLIRTNTKVAIATHISDTHTAMNMNQRSALSHSFNSDFFDHLSKSRYIGKDSTQ--VVNE 465
            ++  N K+  A +I++   A NMN +  L  S  S   D   K   I    +Q  + NE
Sbjct: 432 DILENNAKIYTAANIAEICYASNMNLKPTLGESLVS--IDGGMKEFEIDNPKSQDDIENE 489

Query: 466 NF--YLTQILQNKESKERWKKISATFQKDNEETVGQLSDMEYEFLNDEYALYFSKEDNDS 523
           +   ++  + QNKES ++W    A   K  EE    + D+E EFLNDEY++ +  E N S
Sbjct: 490 DLLKFVQLVAQNKESTKKWAIHKAYSDKLKEENPDLIIDLETEFLNDEYSINYLDE-NSS 548

Query: 524 SQRPPLPLKFTFVQRAKLELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLID 583
             + P+P  +T  Q+A+LELLRIVT+ Y+TIYYE  ++R+ S DQ++NL +L++LSP+++
Sbjct: 549 FLKNPIP--YTTYQKAQLELLRIVTITYQTIYYEKMKKRVSSVDQKKNLMILDVLSPILN 606

Query: 584 SWYSNYNSLLK-TDAVRPVSPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQV 642
           +WY NY  L+K     +PV   +    +  FK + NI GE+ ISDYYYCQLY FSLALQV
Sbjct: 607 AWYLNYYKLMKPVSDEKPVIISLDDLSK--FKRTANIRGESFISDYYYCQLYTFSLALQV 664

Query: 643 DVGQNKLKLNEITRCAIYVEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFI 702
           +V ++KL LNE+ + A +VE+AY AAKEIL+SA RVHK+ MLKYMPV+WVMRIVRS +FI
Sbjct: 665 EVKESKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKVDMLKYMPVRWVMRIVRSASFI 724

Query: 703 VKCYLTLTSGSFSSNPEARTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAI 762
           VKCY+TL   S ++N EA++IL LS I VD+T+  I+  A+ILKE+ PDELHL++++S I
Sbjct: 725 VKCYITLCDHSMATNSEAKSILKLSGILVDDTVHMIRQAAVILKESTPDELHLASKFSTI 784

Query: 763 LLYLCREM---KSKHESSQQSKGYDSKSSSNAPLSDDVITNQSGDKMSEDILLKSHAEVA 819
           L++LC+E+   K  +E+     G ++  S    L       +S +  + D +     E  
Sbjct: 785 LMFLCKEIDERKRDNENLMTGNGLNNDPS----LESQTTHKESLEASNHDTISSDAQEPP 840

Query: 820 AKDPRTSQENIELQMNKPNLDGKFASD--MDFTTDNLNELPGDVANWFTTSGNIGLEFVE 877
           +++  +     +   N     G  + D    FT      LP DV +WF+ S NIGL+FVE
Sbjct: 841 SENDSSHDTTTQGTANSTRKVGPNSIDEIGQFTA----YLPEDVIDWFSASNNIGLDFVE 896

Query: 878 PWTEMIEQMYLQSGDANTTFDDLYKEIC 905
           PWTE+IEQ Y+Q+ D    FD L+ E  
Sbjct: 897 PWTELIEQKYIQNKDGFQDFDQLFDEFA 924

>ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR421W
           (ARO80)
          Length = 944

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/969 (37%), Positives = 524/969 (54%), Gaps = 134/969 (13%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIP 78
           KW+R YKAC NC+ RKV+CD+GP++ P +PPC RC RE K C+F   +  +         
Sbjct: 24  KWRRIYKACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKECIFTELRRGRNRRIRVAKN 83

Query: 79  STTPTLKPNSGNSVSKKRLD--SSTDLVNEVPVKIPKTSPSNPISPT------------- 123
                 +P+ G  V+    D  S+T   +  P  +   S  +P S +             
Sbjct: 84  DRAGHAEPDGGICVANAHGDPSSATGRFSGEPTALSAGSDPSPDSASNRGRDDQSSNSDE 143

Query: 124 -----KWKIGL----TSMQNSLEFLAKAAGNVGFLSAPSAHSAREELNSAVVPKATSLPQ 174
                + ++ L    T++ N+LEFL KAAG+V      +  + R   +S  V K ++   
Sbjct: 144 PEFSERPELSLSSEFTTLHNTLEFLTKAAGSV------AKDNGRLLSSSTAVGKHSAAIC 197

Query: 175 EESLMNMTSSLHSDLLNISPIGKLQHKSLPLIDKLNIVRPTPRRK--------LTDIDYI 226
           E   + + + LH+        G    +++   D+    R TP+ +        L +I+Y+
Sbjct: 198 ESITLQLYNPLHNGQYASVVSGPRNPEAI--TDQAAASR-TPQEEPESTKYPLLRNIEYV 254

Query: 227 GPNRLLSESDAIELIDLFFLTMFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHSFD 286
           GPN  L+  + I L +LFF+T +PFFP+IPL +Q+P+ELA+YPILLC +L+IS+RYH F+
Sbjct: 255 GPNNTLTVEEVIRLTELFFVTHYPFFPHIPLHMQDPEELARYPILLCGVLSISARYHKFE 314

Query: 287 TFADSINNGQNNKRRHIDVHEKLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNPRA 346
               S N G  +  R+IDVHE LW YCQ++ISQT+W EASTRSIGT+L F+IFTEWNPRA
Sbjct: 315 DIGLS-NRG--SPTRNIDVHEYLWRYCQQMISQTVWTEASTRSIGTVLVFLIFTEWNPRA 371

Query: 347 IHWNWSDYASDPALND------------------ISKRNMEPQIIKREEEGLTGIDAIRR 388
           IH   +DYA+     +                   ++RN  P+     ++G +G+ A+RR
Sbjct: 372 IHRKCNDYANATDRQNEQSHSEKANTAHCGSGIPATERN-GPRRFVLADQGSSGLSAMRR 430

Query: 389 SDRMAWMLSGTAVRLAQDTGLIRTNTKVAIATHISDTHTAMNMNQRSALSHSFNSDFFDH 448
           S RMAWML G AVRLAQD   I T++K+ +ATH S+T+ AMNM Q S LSHS        
Sbjct: 431 SKRMAWMLVGNAVRLAQDMDFINTSSKIFVATHTSETNCAMNMGQNSTLSHS-------- 482

Query: 449 LSKSRYIGKDSTQVVNENFYLTQILQNKESKERWKKISATFQKDNEETVGQLSDMEYEFL 508
           L  +  IG +S+  +      +      E++ER+K +     K      G LS +  EFL
Sbjct: 483 LMNANIIGSESSTAI------SNPPMPSETEERYKSVLQRLGKHVPRGRG-LSQLYNEFL 535

Query: 509 NDEYALY---------------FSKEDNDSS----------QRPPLPLKFTFVQRAKLEL 543
            DE  LY                 +  N+ S          +R    +  +F QRAK+EL
Sbjct: 536 EDERILYGLGGGSEYVEAYCDSLDQTKNNVSIETAYESSLLERGGQQVFLSFAQRAKIEL 595

Query: 544 LRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLIDSWYSNYNSLLKTDAVRPVSP 603
           LRI+++GYETIY  +   +LV  ++   L+VL +LSP I++WY+ YNSLL      P +P
Sbjct: 596 LRIMSVGYETIY--SNHAKLVLREKHHILSVLGLLSPQIENWYTQYNSLLVPAGGAPFNP 653

Query: 604 GMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQVDVGQ----NKLKLNEITRCAI 659
                +     + + I  E++I DYYYCQLYI+SLAL VD  +    N   L+ + + A 
Sbjct: 654 TADFSRINPLDLVRRIDAESIICDYYYCQLYIYSLALTVDFRKPRHPNASWLDRLMKSAR 713

Query: 660 YVEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFIVKCYLTLTSGSFSSNPE 719
           YVE AY AA+E+L SA RVH+++MLKYMP +WV RIV +VAFIVKCYLT+ +   +++ E
Sbjct: 714 YVELAYNAAREVLRSAIRVHRIRMLKYMPTRWVERIVGAVAFIVKCYLTM-AAHLTASHE 772

Query: 720 ARTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAILLYLCREMKSKHESSQQ 779
           A  IL+LSAI  DE + TIQ  AI L+EA+PD++HL  +YS IL+YLC EMK ++     
Sbjct: 773 ASAILTLSAIPPDEVVNTIQRAAITLREASPDDVHLCNKYSTILMYLCSEMKLRN----- 827

Query: 780 SKGYDSKSSSNAPLSDDVITNQSGDKMSEDILLKSHAEVAAKDPRTSQENIELQMNK--- 836
                   +   PL   V    SG+ +   +  +  A  AA+         E Q      
Sbjct: 828 ------WPTPTPPLPRSV----SGEPIRVPV-FECSATPAARIFSPPHHPAESQTTGGTD 876

Query: 837 --PNLDGKFA--SDMDFTTDNLNELPGDVANWFTTSGNIGLEFVEPWTEMIEQMYLQSGD 892
             P  D   A  S      D  + LP ++ +W  TS  IGL+FVEPWT++IE++ ++SG 
Sbjct: 877 PPPLPDHTLAAPSSDPAPFDTTSHLPWELIDWLHTSDEIGLDFVEPWTDVIERL-MESGP 935

Query: 893 ANTTFDDLY 901
            N   + LY
Sbjct: 936 DNIDTNSLY 944

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
           YKL222C (REAL)
          Length = 688

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 58/140 (41%), Gaps = 32/140 (22%)

Query: 22  RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIPSTT 81
           +  KAC NC+ +K KCD         P C +CR     CV+L   G KAD  +  IP++ 
Sbjct: 11  KAIKACLNCRRKKQKCDQA------RPQCYQCRIRKTECVYL---GEKADKNSISIPNSI 61

Query: 82  PTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPISPTKW---------KIGLTSM 132
               P   N V  K  D+S            K+  +NP+  TK+           G+TSM
Sbjct: 62  LDTTPFDINHVGSK--DNSC-----------KSEEANPLVGTKFIFQKEDKWLACGVTSM 108

Query: 133 QNSLEFLAKAAGNVGFLSAP 152
           +        +  N G+ + P
Sbjct: 109 RTIFHLHCNSKIN-GYFTTP 127

>NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON}
           Anc_4.344 YML076C
          Length = 894

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 78/173 (45%), Gaps = 20/173 (11%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF-LTTKGRKADLGTSKI 77
           K KR   AC  C   K KC    + + +  PC RC R  + C F L+ + RK     S  
Sbjct: 54  KLKRNTFACVRCHSLKQKCVPSDVNDIYLKPCQRCSRNKQVCKFDLSKRTRKRKPKNSAT 113

Query: 78  PSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPISPTKWKIGLTSMQNSLE 137
           PS +PT  P SG        + ST L         + +PS P+ PT      T +    +
Sbjct: 114 PSRSPT--PLSGLKREPSMGEQSTKL---------QKTPS-PVKPT-LMTNQTVLPGIHQ 160

Query: 138 FLAKAAGNVGFLSAPSAHSAREELNSAVVPKATSLPQEESLMNMTSSLHSDLL 190
            L+   GN+G    P+++S     N+  +   T LP E ++ N  SS++S++L
Sbjct: 161 SLSDLWGNIG---QPTSNSEPHSYNTNSM--NTGLPSEVNIEN-PSSINSNIL 207

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 7/94 (7%)

Query: 21  KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLT----TKGRKADLGTSK 76
           +R  KAC  C+ RK KCD     +P+   C+ C + G  C+F+T     K + +  GT  
Sbjct: 172 RRAAKACEYCRKRKTKCDEV---SPYTNKCSNCSKAGVDCIFITEPTKKKRKSSSEGTKV 228

Query: 77  IPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVK 110
             S  P  K NS     KK+ D   + V++  V+
Sbjct: 229 NKSPKPAAKTNSTKHKVKKQSDGDNEPVHQNTVE 262

>YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}
           PDR3Transcriptional activator of the pleiotropic drug
           resistance network, regulates expression of ATP-binding
           cassette (ABC) transporters through binding to
           cis-acting sites known as PDREs (PDR responsive
           elements); post-translationally up-regulated in cells
           lacking a functional mitochondrial genome
          Length = 976

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 45/101 (44%), Gaps = 10/101 (9%)

Query: 26  ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIPSTT---P 82
           AC NC+ RK+KC  G        PC  C     TCVFL     + +  +  +P+T    P
Sbjct: 14  ACVNCRKRKIKC-TGKY------PCTNCISYDCTCVFLKKHLPQKEDSSQSLPTTAVAPP 66

Query: 83  TLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPISPT 123
           +   N   S   + LD++  L N+   K+       P+SP+
Sbjct: 67  SSHANVEASADVQHLDTAIKLDNQYYFKLMNDLIQTPVSPS 107

>TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {ON}
           Anc_8.423 YLR228C
          Length = 880

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 49/112 (43%), Gaps = 15/112 (13%)

Query: 13  KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADL 72
           KR  + K K G   C NCK R+VKCD G       P C +C      CV+L    R    
Sbjct: 95  KRKFHNKSKNG---CANCKRRRVKCDEG------KPTCQKCLNMKLQCVYLPVTARNK-- 143

Query: 73  GTSKIPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPISPTK 124
              KI S   TL PN     S   ++S+  + +E  +K+   S  N I P K
Sbjct: 144 --PKI-SQVETL-PNPSIMTSNSTINSNEKIKSESDIKVKDNSSQNTIFPNK 191

>TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON}
           Anc_4.344 YML076C
          Length = 1283

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 46/91 (50%), Gaps = 3/91 (3%)

Query: 21  KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIPST 80
           KR   AC +C   KVKC    L++ +  PC RC + GK C F  +K  K      +  ++
Sbjct: 116 KRNTFACVSCHSSKVKCIPSQLDDIYRKPCQRCLKNGKVCTFDLSKRTKRR--KQRNSNS 173

Query: 81  TPTLKPNSGNSVSKKRLDSSTDLVNEVPVKI 111
           T +L   +G+  S   + + T+ VN VP+ I
Sbjct: 174 TSSLVSMTGSFQSSVGMTNHTNTVN-VPIPI 203

>TDEL0D00820 Chr4 (151394..153451) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 64/276 (23%), Positives = 111/276 (40%), Gaps = 34/276 (12%)

Query: 17  NYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSK 76
           +Y+ K+  + C +CK +K+KC     +     PC RC + G  C F TT+ + A    S 
Sbjct: 3   SYESKKRTRPCVSCKRQKLKC-----QYKESLPCERCIKHGMACYFPTTQKQSATAKQSL 57

Query: 77  IPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPISPTKWKIGLTSMQNSL 136
             +  P  +       S   L S+    + VP  +PK       S T    GL +     
Sbjct: 58  HETVLPRYQ-------SPPPLQSNPPEASVVPNTLPKPRIREAKSTTVLPSGLPT----- 105

Query: 137 EFLAKAAGNVGFLSAPSAHSAREELNSAVVPKATSL--------PQEESLMNMTSSLHSD 188
                   N G L A S     + L +A+    T           Q + L N  +  +  
Sbjct: 106 ----SLLPNNGNLWAYSGEQRADFLQTALESMLTIFQHNQIQHEQQIKVLQNQVNQQNHV 161

Query: 189 LLNISPIGKLQHKSLPLIDKLNIVRPTPRRKLTDIDYIGPNRLLSESDAIELIDLFFLTM 248
           ++           +LP + ++ I    P+ ++TD   +G   ++S+++A EL+ +F   M
Sbjct: 162 VIRDQSRAGPSAVALPSVSEI-IDNGGPKEQVTDFRKLG---IISKTEAAELLHIFCTKM 217

Query: 249 FPFFPNIPLQLQNPKEL-AQYPILLCAILTISSRYH 283
                    +    +EL  Q P+LL +I T++  +H
Sbjct: 218 SGHMFGYSSEELTLEELWDQSPLLLASICTVACPHH 253

>Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar to
          Ashbya gossypii AER141C
          Length = 665

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 24/46 (52%), Gaps = 5/46 (10%)

Query: 18 YKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFL 63
          Y  KR  K C+NCK  KVKC+          PC+RC R G  C F+
Sbjct: 5  YDSKRRTKPCSNCKQNKVKCEYN-----EGLPCSRCTRNGLECYFI 45

>NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON}
           Anc_1.199
          Length = 875

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 49/96 (51%), Gaps = 15/96 (15%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRR--EGKTCVFLTTKGRKADLGTSK 76
           K  R    CTNCK RK KCD G        PC+ C R  +G  C++++  G ++ +  ++
Sbjct: 16  KRNRPTVVCTNCKKRKSKCDRG-------RPCSTCARLGDGDRCIYVSDTGSESPVPMNQ 68

Query: 77  -IPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKI 111
            +P     LKP++ ++  +     S D+V+   +++
Sbjct: 69  FMPKRVKVLKPSNRHAFPR-----SPDMVSNTSMQL 99

>Kwal_47.16862 s47 complement(147009..149240) [2232 bp, 743 aa]
          {ON} YML076C (WAR1) - ORF [contig 219] FULL
          Length = 743

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 21 KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          KR   ACTNC  +K KC    + + +  PC RCR+  K C F
Sbjct: 54 KRNTFACTNCHAQKSKCVPSDVLDIYRKPCVRCRKRNKLCTF 95

>TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3.109
           YOL089C
          Length = 1086

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query: 18  YKWKRGYKACTNCKLRKVKCD-MGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSK 76
           Y  KR  +AC +C+ RK+KCD + P+ N     C+ C +    CVF   + RKA    + 
Sbjct: 132 YSKKRATRACESCRKRKIKCDPVDPITN----KCSNCTKFHMICVF-DNRKRKATNANTN 186

Query: 77  IPSTTPTLKPNSGNS 91
                 T+ P S  S
Sbjct: 187 SNKLLKTMNPKSHES 201

>SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]
           {ON} similar to gnl|GLV|KLLA0A04169g Kluyveromyces
           lactis KLLA0A04169g and some similarites with YDR213W
           uniprot|Q12151 Saccharomyces cerevisiae YDR213W UPC2
           involved in sterol uptake zinc finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 754

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 44/98 (44%), Gaps = 10/98 (10%)

Query: 13  KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADL 72
           KR  + K K G   C NCK R+VKCD G       P C +C      CV+     RK  L
Sbjct: 43  KRKFHNKSKNG---CDNCKRRRVKCDEG------KPCCQKCINMKLECVYTPITQRKKRL 93

Query: 73  -GTSKIPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPV 109
            G + +   T   + + G +  +  ++ ST  + E PV
Sbjct: 94  NGETVVKYVTSNTEDDRGVTNRRNTVNGSTTEIEESPV 131

>NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {ON}
           Anc_1.199
          Length = 995

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 39/84 (46%), Gaps = 19/84 (22%)

Query: 16  PNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRR--EGKTCVFL-------TTK 66
           P+ K  R    CTNCK RK KCD          PC  C+R  +G +C ++        +K
Sbjct: 61  PSRKRHRSTVVCTNCKKRKSKCDRS-------RPCGTCKRLGDGNSCFYIPEVPKVKPSK 113

Query: 67  GRKADLGTSKIPSTTPTLKPNSGN 90
            RK+ +  S IP   P    NSG+
Sbjct: 114 SRKSSI--SNIP-INPVSNNNSGD 134

>Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {ON}
           YOL089C (REAL)
          Length = 1030

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 8/78 (10%)

Query: 21  KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF-----LTTKGRKADLGTS 75
           KR  KAC +C+ RK++CD     + +   C+ C +    C F     +  K RK ++  +
Sbjct: 130 KRVSKACDHCRKRKIRCDEV---DQYTKKCSNCVKFESPCTFKHRDEILKKKRKLEIKQN 186

Query: 76  KIPSTTPTLKPNSGNSVS 93
             P  +P  + N  NSVS
Sbjct: 187 SAPDKSPQAQNNVPNSVS 204

>Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON}
          similar to Ashbya gossypii ACL195C
          Length = 114

 Score = 40.4 bits (93), Expect = 0.003,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 12/69 (17%)

Query: 1  MCASLLENEVLQKRA---------PNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCA 51
          M A + +NE+  KR            +K K+  ++C  C+  KVKCD   +  P   PC+
Sbjct: 1  MAAGMSDNEIQHKRPGGHSEGYIHDTWKMKKPLRSCVRCRKNKVKCD-SAIRRPK--PCS 57

Query: 52 RCRREGKTC 60
           C ++G +C
Sbjct: 58 SCLKKGVSC 66

>NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa]
          {ON} 
          Length = 909

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 6/46 (13%)

Query: 17 NYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          NY+  R    C  C+ +KVKCD         P C RCR+  K CV+
Sbjct: 5  NYRKARPSFVCLVCRSKKVKCDKA------RPSCGRCRKTNKLCVY 44

>KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON} 
          Length = 881

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 41/89 (46%), Gaps = 19/89 (21%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF------LTTKGRKADL 72
           K KR    C  CK +K++C      N   P C+RC+R GK C +      LT      D 
Sbjct: 27  KSKRTVSVCIPCKSQKLRC------NKARPICSRCQRLGKHCHYGAHTQILTPAEELLDN 80

Query: 73  GT-------SKIPSTTPTLKPNSGNSVSK 94
           GT       S++PS   T +P+ G  +S+
Sbjct: 81  GTISLTNTSSQLPSFYLTPRPSDGTVLSR 109

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 41/89 (46%), Gaps = 24/89 (26%)

Query: 21  KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF--------LTTKGRKADL 72
           +R    C  CK +K++CD         P C+RCRR G+ CV+        +T  G K   
Sbjct: 25  QRRSHVCITCKNQKLRCDR------ERPSCSRCRRIGRDCVYESPTPEETMTNHGNKELS 78

Query: 73  GTSKIPSTTPTL---------KPNSGNSV 92
            TS I ST  +L         KPN+ N++
Sbjct: 79  VTSGI-STDGSLENNDEFHNEKPNNSNTL 106

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
           (REAL)
          Length = 926

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 58/135 (42%), Gaps = 13/135 (9%)

Query: 9   EVLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGR 68
           E  Q+   + K +R  +AC  C+ +KVKCD          PC  C      C +     R
Sbjct: 3   EQAQQGEQSVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKR 55

Query: 69  KADLGTSKIPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIP----KTSP--SNPISP 122
             + G S + +    + P+S   V+   L+ +  L +  P K P     T P  SN   P
Sbjct: 56  TQNSGNSGMLALGNAVGPSSSVVVATATLNPNKLLSSVKPEKSPLPGSSTIPGSSNMSKP 115

Query: 123 TKWKIGLTSMQNSLE 137
            ++K   T +Q++++
Sbjct: 116 RRYKTKSTRLQSTID 130

>KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co- inducer
          Length = 775

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 50/122 (40%), Gaps = 25/122 (20%)

Query: 21  KRGY--KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLT-TKGRK-------- 69
           KR Y    CT CK R++KCD G       P C +C R  + CV++  TK RK        
Sbjct: 141 KRKYSRNGCTECKRRRMKCDEG------KPTCWQCARLNRECVYIIRTKNRKRRPKSTEA 194

Query: 70  ------ADLGTSKIPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIP--KTSPSNPIS 121
                 AD    +  +   T  P+ G+  S    D  + L N +   +P    S S P  
Sbjct: 195 SKESAQADALVRESNAPGLTTNPSGGSPFSNTSTDLHSTLHNPLNTSLPVENLSSSMPEL 254

Query: 122 PT 123
           PT
Sbjct: 255 PT 256

>Smik_2.115 Chr2 (210321..213236) [2916 bp, 971 aa] {ON} YBL005W
           (REAL)
          Length = 971

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 41/102 (40%), Gaps = 14/102 (13%)

Query: 26  ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTT-----KGRKADLGTSKIPST 80
           AC NC+ RK+KC  G        PC  C     TCVFL       K     L T+ +P +
Sbjct: 14  ACVNCRKRKIKC-TGKY------PCTNCISYDCTCVFLKKNLTQEKDTSLPLATTTVPRS 66

Query: 81  TPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPISP 122
           +     N   S     LDS   L N+   K+       P+SP
Sbjct: 67  SS--HHNEKVSADAHHLDSVIKLDNQDYFKLVNEPIQTPVSP 106

>Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar to
          Ashbya gossypii AAL175W
          Length = 908

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 9/53 (16%)

Query: 8  NEVLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
          N V   R P  K    +  C  C++RKVKCD+G       P C RC + G +C
Sbjct: 30 NGVCTARRPRAK---TFTGCWTCRIRKVKCDLG------KPNCQRCEKSGLSC 73

>NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {ON} 
          Length = 978

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 38/83 (45%), Gaps = 9/83 (10%)

Query: 22  RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIPSTT 81
           R  +AC+NC+ RK+KC           PC  C   G  CVF    G    +  S  PS T
Sbjct: 13  RSSRACSNCRRRKIKCS-------GIQPCPNCEIYGCLCVFEPVNGM-TPMNFSSKPSET 64

Query: 82  PTLKPNSGNSVSKKRLDSSTDLV 104
                NS +SV K + + S DL+
Sbjct: 65  EFHHGNSMHSV-KPKTEPSHDLI 86

>NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.344
           YML076C
          Length = 989

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 17  NYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF-LTTKGRKADLGTS 75
           N K KR   AC  C   K KC      + +  PC RC R GK C F L+ + RK  L + 
Sbjct: 76  NGKIKRNTFACVRCHSLKQKCVPSDTNDIYRRPCERCLRTGKLCKFDLSKRTRKRRLKSD 135

Query: 76  KIP-STTPTLKPNSGNSVS 93
               S+TP    +SG++ +
Sbjct: 136 PTSRSSTPLTLLSSGDTTA 154

>SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON}
          similar to uniprot|Q03631 Saccharomyces cerevisiae
          YML076C WAR1 zinc finger transcription factor
          Length = 809

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 23/44 (52%)

Query: 19 KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          K KR   ACTNC   K KC    + N +  PC RC +  +TC F
Sbjct: 56 KPKRNTFACTNCHSLKQKCVPSDINNIYGRPCQRCMKCNRTCKF 99

>AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR228C (ECM22) and
           YDR213W (UPC2)
          Length = 866

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 29/57 (50%), Gaps = 9/57 (15%)

Query: 13  KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRK 69
           KR  + K K G   C NCK R+VKCD G       P C +C +   +CV+   K RK
Sbjct: 78  KRKFHNKSKNG---CDNCKRRRVKCDEG------KPGCQKCLKMRLSCVYTPAKPRK 125

>SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 801

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 54/131 (41%), Gaps = 37/131 (28%)

Query: 21  KRGY--KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFL--------------- 63
           KR Y    CT CK R++KCD G       P C +C R  + CV++               
Sbjct: 156 KRKYSRNGCTECKKRRMKCDEG------KPSCWQCTRLNRECVYILNPKNKKRKPRVGRN 209

Query: 64  ---TTKGRKADLGTSKIPSTTPTLKPNS----------GNSVSKKRLDSSTDLVNEVPVK 110
              +TK   A   T+K    +PTL+  S           NS  +  + S+TDL +     
Sbjct: 210 AGNSTKHSAAKQKTAKHKCASPTLESTSVQAHCHSSHISNSPLEASIASATDLSSGKTTP 269

Query: 111 IPKTS-PSNPI 120
            P +S P+N +
Sbjct: 270 APTSSLPANEL 280

>KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly
          similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064W
          Length = 657

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 6/48 (12%)

Query: 15 APNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
           P  K  R    C NC+ RK KCD G       P C+ C + G+TCV+
Sbjct: 9  VPVKKRHRPTLVCLNCRRRKTKCDRG------KPSCSNCLKLGETCVY 50

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
          similar to uniprot|P50104 Saccharomyces cerevisiae
          YMR019W STB4 Protein that binds Sin3p in a two- hybrid
          assay
          Length = 912

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 10/57 (17%)

Query: 22 RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGR---KADLGTS 75
          R  KAC  CK RKVKCD          PCA C + G+ C +++   R   + D+G S
Sbjct: 12 RVRKACEICKRRKVKCD-------GSQPCANCVKHGQECKYISGTVRRRYRRDIGNS 61

>NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {ON} 
          Length = 980

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 10/100 (10%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRK-ADLGTSKI 77
           K  R  +AC NC+ RK+KC         + PC+ C      C F   K +  +D G  +I
Sbjct: 10  KKTRSSRACENCRARKIKC-------SGNQPCSNCEIYNCPCAFTPIKRKNLSDKGIERI 62

Query: 78  PSTTPTLKPNSGNSVSKKRLD-SSTDLVNEVPVKIPKTSP 116
            +     + N+ ++ +  R D  ST+  N+ P    + SP
Sbjct: 63  ANNDHLFQENNASTTTNIRSDFESTNDANK-PASSSEVSP 101

>Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {ON}
           YDR034C (LYS14) - 1:1 [contig 183] FULL
          Length = 775

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 9/52 (17%)

Query: 21  KRGY--KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF-LTTKGRK 69
           KR Y    CT CK R++KCD G       P C +C R  + CV+ + TK RK
Sbjct: 141 KRKYSRNGCTECKRRRMKCDEG------KPTCWQCARLNRECVYVIRTKNRK 186

>Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON}
           YGR288W (REAL)
          Length = 143

 Score = 39.7 bits (91), Expect = 0.008,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 39/89 (43%), Gaps = 11/89 (12%)

Query: 25  KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIPSTTPTL 84
           +AC  C++R+VKCD          PC RC +    C +L    ++   G   I S +   
Sbjct: 39  QACDCCRVRRVKCD-------GKGPCGRCLQRDLNCTYLQPLRKR---GPKSIRSRSLK- 87

Query: 85  KPNSGNSVSKKRLDSSTDLVNEVPVKIPK 113
           K      VS+    SST    E P K+PK
Sbjct: 88  KIACVQRVSENNGTSSTMTAPEAPAKVPK 116

>AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic
          homolog of Saccharomyces cerevisiae YML099C (ARG81)
          Length = 883

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 11/58 (18%)

Query: 8  NEVLQKR-----APNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
          +E LQK+     A      + +  C  C+LRKVKCD+G       P C RC + G  C
Sbjct: 20 DEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLG------KPSCQRCEKSGLDC 71

>TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa] {ON}
           Anc_1.199 YKR064W
          Length = 827

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 46/104 (44%), Gaps = 14/104 (13%)

Query: 12  QKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREG--KTCVFLT-TKGR 68
           Q + P  K  R    C+NC+ RK KCD          PC  C R G   TCV++   KG 
Sbjct: 7   QSQQPVRKRNRLTVVCSNCRRRKSKCD-------RQTPCGNCVRLGDKDTCVYIKEAKGD 59

Query: 69  KADLGTSKIPSTTPTLKPNSGNSVSKKRLDSSTDLVNE-VPVKI 111
           +  +   +I    PT K    NSV+  +   S D V E VP  I
Sbjct: 60  RNSMDL-RITKKLPTSK--RKNSVTNTKKSVSFDSVQEYVPEYI 100

>KNAG0E04100 Chr5 (814663..817374) [2712 bp, 903 aa] {ON} Anc_4.344
           YML076C
          Length = 903

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 31/72 (43%), Gaps = 1/72 (1%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF-LTTKGRKADLGTSKI 77
           K KR   AC  C   K KC      + +  PC RC R+ K C F L+ + RK   G S  
Sbjct: 51  KNKRNTFACVGCHSLKQKCVPSDFNDIYRKPCVRCFRQRKKCKFDLSKRTRKRRRGNSNS 110

Query: 78  PSTTPTLKPNSG 89
                TL   SG
Sbjct: 111 EREQSTLSSPSG 122

>Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON}
          (44110..46518) [2409 nt, 803 aa]
          Length = 802

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 41/88 (46%), Gaps = 25/88 (28%)

Query: 7  ENEVLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREG--KTCVFLT 64
          EN+V +KR       R    CTNCK RK KCD G        PC+ C R G   +C+++ 
Sbjct: 5  ENKVRKKR------HRITVVCTNCKKRKSKCDRG-------KPCSNCTRIGIENSCLYIK 51

Query: 65 --------TKGRKADLGTS--KIPSTTP 82
                  + G  ADL  S  +IP+  P
Sbjct: 52 DTPSLPIDSIGSVADLTASELQIPNFIP 79

>NCAS0A12580 Chr1 complement(2481447..2483561) [2115 bp, 704 aa]
          {ON} 
          Length = 704

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 13 KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          +R+ N K K+  +AC  C  R++KCD     NP    C+ C +  + C+F
Sbjct: 30 ERSYNRKRKKASRACDQCHHRRIKCDF----NPETRNCSGCEKTEEKCLF 75

>Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W
           (REAL)
          Length = 918

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 49/114 (42%), Gaps = 13/114 (11%)

Query: 13  KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTT---KGRK 69
           KR  + K K G   C NCK R+VKCD G       P C +C      CV+      KGR 
Sbjct: 40  KRKFHNKSKNG---CDNCKRRRVKCDEG------KPACKKCTNMKLECVYTPIHLRKGRG 90

Query: 70  ADLGTSKIPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPISPT 123
           A +          +++P+S  ++S       T   N+VP  +  +  SN   P+
Sbjct: 91  ATVVKYVTRKADGSVEPDSSVNLSTAVKKEQTPF-NDVPSAVKASESSNDSFPS 143

>Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}
           complement(9551..12121) [2571 nt, 857 aa]
          Length = 856

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF-LTTKGRK 69
           K KR   AC +C   K KC    L++    PC RC R  K C F L+ + RK
Sbjct: 59  KRKRNTFACISCHASKQKCVPSDLDDIFLKPCQRCFRSKKICAFDLSKRTRK 110

>NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON}
           Anc_8.423
          Length = 948

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 42/96 (43%), Gaps = 14/96 (14%)

Query: 13  KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADL 72
           KR  + K K G   C NCK R+VKCD         P C +C     TCV+   + RK   
Sbjct: 52  KRKFHNKSKNG---CDNCKKRRVKCDE------VKPSCKKCTNMQLTCVYSPLQPRKRPK 102

Query: 73  GTSKIPSTTPTLK-----PNSGNSVSKKRLDSSTDL 103
           G   +     + K     PN+G  V+ KR  S  +L
Sbjct: 103 GPPVLKHVATSEKIMAGSPNNGIDVAIKRERSEMNL 138

>KLTH0D16852g Chr4 (1392572..1395007) [2436 bp, 811 aa] {ON} similar
           to uniprot|Q03631 Saccharomyces cerevisiae YML076C WAR1
           zinc finger transcription factor
          Length = 811

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
           K KR   ACTNC  +K KC    + + +  PC RC +  K C F
Sbjct: 104 KPKRNTFACTNCHSQKSKCVPSDVSDIYRKPCVRCHKRRKLCKF 147

>NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa]
          {ON} Anc_4.113
          Length = 1118

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 7/45 (15%)

Query: 25 KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRK 69
          KAC NC+ RK+KC           PCA C      C++ T +GRK
Sbjct: 61 KACDNCRRRKIKCT-------GKTPCATCEAYQCLCIYSTQRGRK 98

>TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8.423
           YLR228C
          Length = 1259

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 25/51 (49%), Gaps = 9/51 (17%)

Query: 13  KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFL 63
           KR  + K K G   C NCK R+VKCD G       P C +C      CV+L
Sbjct: 192 KRKFHNKSKNG---CVNCKRRRVKCDEGK------PTCKKCLNMKLDCVYL 233

>KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON}
          Anc_2.547 YKL038W
          Length = 1088

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 1  MCASLLENEVLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
          M ++  E     + + N +  +  +AC  C+ +KVKCD G   +     C  C+R G+ C
Sbjct: 37 MTSNTEEANNASRSSSNKRRTKASRACDQCRKKKVKCDNGDDRS----VCTNCQRNGEKC 92

Query: 61 VF 62
           F
Sbjct: 93 TF 94

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 848

 Score = 40.8 bits (94), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 22 RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
          + +  C  C+ RKVKCD+G       P C RC R G  C
Sbjct: 15 KTFTGCWTCRSRKVKCDLG------RPSCKRCERSGFEC 47

>Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {ON}
           YDR213W (UPC2) - zinc finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 249]
           FULL
          Length = 788

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 14/71 (19%)

Query: 21  KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF--LTTKGRKADLGTSKIP 78
           K+    C NCK R+VKCD         P C +C      CV+  +T++ RK+  G     
Sbjct: 44  KKSKNGCDNCKRRRVKCD------EDKPSCQKCLNMKLECVYTPVTSRKRKSSSGAH--- 94

Query: 79  STTPTLKPNSG 89
              PT +P +G
Sbjct: 95  ---PTQQPAAG 102

>SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON}
          conserved hypothetical protein
          Length = 770

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 31/68 (45%), Gaps = 5/68 (7%)

Query: 13 KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF---LTTKGRK 69
          KR    K KR  +AC +C+  K +C   PL  P++  C RC      C F   L   G  
Sbjct: 16 KRQLRAKGKRALRACDSCRRLKTRCIPSPL--PNEIQCLRCDSLKLRCSFQDLLENSGSP 73

Query: 70 ADLGTSKI 77
           D  TSKI
Sbjct: 74 GDAPTSKI 81

>ZYRO0D08316g Chr4 (719929..721971) [2043 bp, 680 aa] {ON}
          conserved hypothetical protein
          Length = 680

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 34/78 (43%), Gaps = 5/78 (6%)

Query: 10 VLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGR- 68
          V + R   +K KR  +AC  C+  K +C + P+  P++  C RC      C F    GR 
Sbjct: 16 VHKPRKKEFKGKRAVRACDTCRRLKTRCILSPI--PNEFYCLRCESLKIHCSFQDMFGRP 73

Query: 69 --KADLGTSKIPSTTPTL 84
            KAD      P T   L
Sbjct: 74 ESKADEPEGSDPETLKML 91

>ZYRO0B14476g Chr2 complement(1175759..1177882) [2124 bp, 707 aa]
          {ON} conserved hypothetical protein
          Length = 707

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 37/81 (45%), Gaps = 18/81 (22%)

Query: 17 NYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF----LTTKGRKADL 72
          NY+ +R  K C +CK R++KC     +     PC RC + G  C +    L +K ++   
Sbjct: 3  NYESRRRTKPCASCKQRRLKC-----QYQETLPCERCVKHGIACFYPDENLRSKAQEPSG 57

Query: 73 GTS---------KIPSTTPTL 84
           TS         K PST P L
Sbjct: 58 VTSSASDPLLRHKQPSTVPLL 78

>TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3.109
           YOL089C
          Length = 1046

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 21  KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
           +R  KAC NC+ RK+KCD     +P    C+ C +  K C F
Sbjct: 157 RRVVKACYNCRRRKIKCDAI---DPSKNKCSNCLKLNKICSF 195

>KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa]
          {ON} 
          Length = 860

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 13/51 (25%)

Query: 12 QKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          +K+ P+Y        C  C+ RK+KCD         P C RC+++GK C +
Sbjct: 7  RKQRPSY-------VCLECRSRKLKCDKAR------PYCNRCKKDGKVCAY 44

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 53/117 (45%), Gaps = 5/117 (4%)

Query: 5   LLENEVLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLT 64
           L +N++     P    KR  +AC +C+ RK+KCD     +P+   C+ C +    C F  
Sbjct: 231 LQKNDLKPYDNPRSAKKRVSRACDHCRKRKIKCDEK--RDPNTNKCSNCIKYNSECTFKN 288

Query: 65  TKGRKADLGTSKIPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPIS 121
            +   A    + I  +T   +P   + V K + ++  + ++ V    P T+  + +S
Sbjct: 289 WEQNDAIAAANSIQRSTIKQEP---HGVHKIKKNTKVEDISPVSYSSPDTTSKSSVS 342

>Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar to
           Ashbya gossypii ABL099W
          Length = 770

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 8/45 (17%)

Query: 21  KRGY--KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFL 63
           KR Y    CT CK R++KCD G       P C +C R  ++CV++
Sbjct: 142 KRKYSRNGCTECKRRRMKCDEG------KPVCWQCSRLNRSCVYI 180

>KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {ON}
           Anc_8.423 YLR228C
          Length = 1013

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 9/52 (17%)

Query: 13  KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLT 64
           KR  + K K G   C NCK R+VKCD G       P C +C     +CV+++
Sbjct: 86  KRKFHNKSKTG---CINCKKRRVKCDEG------KPACKKCTNMSLSCVYIS 128

>Skud_2.277 Chr2 complement(508677..511877) [3201 bp, 1066 aa] {ON}
           YBR150C (REAL)
          Length = 1066

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 55/128 (42%), Gaps = 17/128 (13%)

Query: 22  RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFL---TTKGRKADLGTSKIP 78
           R  KAC  C+ RK++C      +P    C  C +  K C F      K R+ +   +K  
Sbjct: 90  RVTKACDYCRKRKIRCTEI---DPTYGKCGNCIKYNKDCTFHFHEELKRRREEALNNK-- 144

Query: 79  STTPTLKPNSGNSVSKKRLDSSTDLVNEV-PVKIPKTSPSNPISPTKWKIGLTSMQNSLE 137
                    +G SV K + D    L +EV  V  P ++ S+  SP K +   +S +N+  
Sbjct: 145 --------ETGKSVKKPKSDKENALEDEVFDVTAPSSNTSSTDSPPKLQKSTSSQENAEV 196

Query: 138 FLAKAAGN 145
           F A+   +
Sbjct: 197 FPARRTSD 204

>CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa]
          {ON} similar to uniprot|Q12151 Saccharomyces cerevisiae
          YDR213w UPC2
          Length = 922

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 6/44 (13%)

Query: 21 KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLT 64
          K+    C NCK R+VKCD G       P C +C      CV+ T
Sbjct: 42 KKSKTGCDNCKRRRVKCDEG------KPGCKKCSNLNLVCVYST 79

>Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {ON}
           YLR228C (REAL)
          Length = 812

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 40/90 (44%), Gaps = 17/90 (18%)

Query: 13  KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKG-RKAD 71
           KR  + K K G   C NCK R+VKCD G       P C +C      CV+   +  R+ D
Sbjct: 33  KRKFHNKSKTG---CDNCKRRRVKCDEG------KPFCKKCTNMKLDCVYSPIQPRRRKD 83

Query: 72  LGTSKIPSTTPTLKPNSGNSVSKKRLDSST 101
             TSK   T       + + V KK L  ST
Sbjct: 84  SSTSKFSIT-------AQDRVGKKHLSDST 106

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
           PDR1Zinc cluster protein that is a master regulator
           involved in recruiting other zinc cluster proteins to
           pleiotropic drug response elements (PDREs) to fine tune
           the regulation of multidrug resistance genes
          Length = 1068

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 34/69 (49%), Gaps = 9/69 (13%)

Query: 25  KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKG--RKADLGTSKIPSTTP 82
           KAC NC+ RK+KC+ G        PCA C      C F T +G  R  +L  + +  TT 
Sbjct: 44  KACDNCRKRKIKCN-GKF------PCASCEIYSCECTFSTRQGGARIKNLHKTSLEGTTV 96

Query: 83  TLKPNSGNS 91
            +K  + +S
Sbjct: 97  QVKEETDSS 105

>NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON} 
          Length = 656

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 8/52 (15%)

Query: 11 LQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          +QK++   + +R    C  C+ +K++C      N   P C+RC+R G+TCV+
Sbjct: 1  MQKKS--IRGQRPTHVCAACRTQKLRC------NRERPSCSRCQRIGRTCVY 44

>Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar to
          Ashbya gossypii AFR171W
          Length = 637

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 6/43 (13%)

Query: 26 ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGR 68
           C+ CK RKVKCD         P C +C   GK CV+L    +
Sbjct: 31 GCSECKRRKVKCDEAK------PACWQCSHLGKRCVYLMNTAK 67

>Ecym_1135 Chr1 complement(276229..278697) [2469 bp, 822 aa] {ON}
          similar to Ashbya gossypii AER153W
          Length = 822

 Score = 40.0 bits (92), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%)

Query: 8  NEVLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          N V Q+   N K KR   AC++C   K +C      + +  PC RC +  K CVF
Sbjct: 24 NPVSQEIGSNGKPKRNTFACSSCHAVKQRCIPTDANDIYRKPCTRCLKFKKLCVF 78

>KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {ON}
           Anc_3.264 YDR034C
          Length = 736

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 42/105 (40%), Gaps = 21/105 (20%)

Query: 21  KRGY--KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFL---TTKGRKADLGTS 75
           KR Y    CT CK R++KCD         P C +C R  + CV++     K RK    +S
Sbjct: 147 KRKYSRNGCTECKRRRMKCD------ETKPSCWQCARLNRECVYVLNPKNKKRKTQSTSS 200

Query: 76  KIPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPI 120
            I +       N  + V          + N   ++IP   P N I
Sbjct: 201 SIHTKIKEPPTNKADEV----------VANADDIRIPSFEPLNDI 235

>NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa]
          {ON} Anc_2.565
          Length = 803

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 10/67 (14%)

Query: 22 RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIPSTT 81
          R  +AC  CK RKVKCD          PC+ C +  K C + TT  +  ++  S  PS +
Sbjct: 20 RVQRACAICKKRKVKCDGM-------KPCSNCIKRSKDCTY-TTAYKIPNMKYS--PSLS 69

Query: 82 PTLKPNS 88
          P+ K +S
Sbjct: 70 PSSKTHS 76

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 979

 Score = 40.0 bits (92), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 4/38 (10%)

Query: 25 KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          +AC  C+ +K +CD     +   P C+ C+R GKTC F
Sbjct: 33 RACDQCREKKTRCDF----SDERPICSACQRMGKTCTF 66

>SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]
          {ON} similar to uniprot|Q754A1 Ashbya gossypii AFR171W
          AFR171Wp and some similarites with YDR034C
          uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
          Transcriptional activator involved in regulation of
          genes of the lysine biosynthesis pathway requires
          2-aminoadipate semialdehyde as co-inducer
          Length = 645

 Score = 39.7 bits (91), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 22/44 (50%), Gaps = 8/44 (18%)

Query: 21 KRGYK--ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          KR Y    CT CK RKVKCD         P C +C   GK CV+
Sbjct: 13 KRKYSKLGCTECKRRKVKCD------ETKPMCWQCSHLGKNCVY 50

>Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]
          {ON} YDL170W (UGA3) - zinc-finger transcription factor
          of the Zn(2)-Cys(6) binuclear cluster domain type
          [contig 161] FULL
          Length = 643

 Score = 39.7 bits (91), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 8/55 (14%)

Query: 17 NYKWKRGYK--ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRK 69
          N   KR ++   C  CK+RK +C      + H P C  C R G TCV+L  K  +
Sbjct: 15 NTVGKRTHRKTGCIPCKIRKKRC------SEHKPTCTDCERLGFTCVYLPEKSTR 63

>ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 850

 Score = 39.7 bits (91), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 23/44 (52%), Gaps = 8/44 (18%)

Query: 19 KWKRG--YKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
          K KRG  +  C  C+ RKVKCD   L  PH   C RC + G  C
Sbjct: 30 KSKRGKTFTGCWTCRSRKVKCD---LRRPH---CQRCEKSGLVC 67

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON}
          Anc_6.60 YLR266C
          Length = 795

 Score = 39.7 bits (91), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 19 KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIP 78
          K ++  KAC  C+ RK+KCD+        P C +C      C++  T     DL  +++ 
Sbjct: 6  KRRKIIKACVFCRKRKLKCDLTK------PKCKQCSSRNLNCIY--TNQYNFDLSDAELF 57

Query: 79 STTPTLK 85
          +  P ++
Sbjct: 58 ANQPNIQ 64

>NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}
          Anc_7.512
          Length = 906

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 4/46 (8%)

Query: 17 NYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          N+K KR + AC  C+ +K KCD    E   DP C +C+++G  CV 
Sbjct: 37 NHKRKRKF-ACVECRQQKSKCDA--YEKAPDP-CTKCQKKGVPCVL 78

>TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {ON}
           Anc_3.264 YDR034C
          Length = 770

 Score = 39.7 bits (91), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 11/64 (17%)

Query: 21  KRGY--KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFL---TTKGRKADLGTS 75
           KR Y    CT CK R++KCD         P C +C R  + CV++     K R  DL  +
Sbjct: 132 KRKYSRNGCTECKRRRMKCDETK------PTCWQCSRLNRHCVYVFNPKNKKRNKDLLAT 185

Query: 76  KIPS 79
            + S
Sbjct: 186 ALSS 189

>Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W
           (REAL)
          Length = 1010

 Score = 39.7 bits (91), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 50/125 (40%), Gaps = 10/125 (8%)

Query: 1   MCASLLENEVLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
           +C  +  + V+  +       +   AC NC+ RK+KC        H  PC  C     TC
Sbjct: 30  LCFIVSSHRVISMKVKKSTRSKVSTACVNCRKRKIKC-----TGKH--PCTNCISYDCTC 82

Query: 61  VFLTT---KGRKADLGTSKIPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPS 117
           VFL     +G+ A        + + +  P+   S    +L++   L N+   K+      
Sbjct: 83  VFLKRYLPQGKDAPQPFPAATAPSSSSHPDVDLSTDMHQLNTVIKLDNQDYFKLMNEPIQ 142

Query: 118 NPISP 122
            P+SP
Sbjct: 143 TPVSP 147

>KLLA0C08657g Chr3 (757100..759268) [2169 bp, 722 aa] {ON} some
          similarities with YDR520c
          Length = 722

 Score = 39.7 bits (91), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 11 LQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          + K+ P  +  RG KAC  CK  K KC   P+  P +  C RC    + C F
Sbjct: 8  IAKKTPAKRGTRGVKACDYCKKLKAKCVPSPV--PGEVRCLRCDSLKRHCSF 57

>KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa]
          {ON} Anc_8.423 YLR228C
          Length = 730

 Score = 39.7 bits (91), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 27/57 (47%), Gaps = 9/57 (15%)

Query: 13 KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRK 69
          KR  + K K G   C NCK R+VKCD G       P C +C      CVF   + R+
Sbjct: 23 KRKFHNKSKNG---CDNCKRRRVKCDEG------KPFCQKCANMRLECVFTPPQPRR 70

>ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]
          {ON} similar to uniprot|Q754A1 Ashbya gossypii AFR171W
          AFR171Wp and some similarites with YDR034C
          uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
          Transcriptional activator involved in regulation of
          genes of the lysine biosynthesis pathway requires
          2-aminoadipate semialdehyde as co-inducer
          Length = 653

 Score = 39.3 bits (90), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 25/55 (45%), Gaps = 8/55 (14%)

Query: 10 VLQKRAPNYKWKRGYK--ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          V  K+    + KR Y    C  CK RKVKCD         P C +C   GK CV+
Sbjct: 2  VEDKKTVTIRKKRKYSKLGCNECKKRKVKCD------EQKPECWQCSHLGKKCVY 50

>ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YKR064W
          Length = 795

 Score = 39.7 bits (91), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 32/68 (47%), Gaps = 9/68 (13%)

Query: 16 PNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREG--KTC-VFLTTKGRKADL 72
          P  K +R    C+NCK RK +CD G       P C  C R G  +TC  F++   +  D 
Sbjct: 3  PLKKRQRQTLVCSNCKRRKSRCDRG------KPACGNCIRLGNRETCHYFISPSEKGGDG 56

Query: 73 GTSKIPST 80
          G S   ST
Sbjct: 57 GDSPGEST 64

>KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON}
          similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 865

 Score = 39.7 bits (91), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 7/45 (15%)

Query: 19 KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFL 63
          K KR   ACT C+ R +KC       P   PC++C + G  C ++
Sbjct: 38 KVKRSSLACTRCRRRHIKC-------PGGNPCSKCLKAGVACEYV 75

>NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3.109
           YBR150C
          Length = 1001

 Score = 39.7 bits (91), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 40/93 (43%), Gaps = 8/93 (8%)

Query: 21  KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIPST 80
           KR  KAC  C+ RK+KCD     +     C+ C +    C F     RK DL    I   
Sbjct: 97  KRASKACDLCRRRKIKCDAF---DDRLKKCSNCIKYHSECTFSNQNKRKGDL----IEKA 149

Query: 81  TPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPK 113
             + +  S   ++   L  ST+   +  V+IP+
Sbjct: 150 EESKRSRSKADIASA-LMQSTEFAPQASVEIPQ 181

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 39.7 bits (91), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 10/77 (12%)

Query: 21  KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF-----LTTKGRKADLGTS 75
           KR  KAC +C+ RK++CD     +P    C+ C +    C F     +  K RK  L T 
Sbjct: 127 KRVSKACDHCRKRKIRCDEV---DPQTNKCSNCVKFQSACTFKHRDEILRKKRK--LETK 181

Query: 76  KIPSTTPTLKPNSGNSV 92
           +    +P  + N  N V
Sbjct: 182 QNSDKSPQAQSNGSNHV 198

>KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa]
           {ON} 
          Length = 968

 Score = 39.7 bits (91), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 50/116 (43%), Gaps = 22/116 (18%)

Query: 16  PNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLT-------TKGR 68
           P ++ ++   ACTNC+ RK+KC           PC+ C      C ++          G 
Sbjct: 17  PAHRRRKTVLACTNCRRRKIKCT-------GKWPCSNCEAYSCVCEYVDKAAQVKFAGGS 69

Query: 69  KADLGTSKIPSTTPTLKPNSGNSVSKKRLDSSTDLVNEV-----PVKIPKTSPSNP 119
              +GT  + S +P+L   +  + +   + +   LVNEV     P+  P T+  +P
Sbjct: 70  GNSVGTVAVSSESPSLPTATAATTTTPTIST---LVNEVELTSPPLAGPTTAVVSP 122

>TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON}
          Anc_8.879 YML099C
          Length = 852

 Score = 39.3 bits (90), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 14 RAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
          R  + K  + ++ C  C+LRK+KCD+        P C +CR    +C
Sbjct: 10 RDADNKRAKTFEGCWTCRLRKIKCDLKK------PKCDKCRSSAISC 50

>ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 736

 Score = 39.3 bits (90), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 9/63 (14%)

Query: 21  KRGY--KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF-LTTKGRKADLGTSKI 77
           KR Y    CT CK R++KCD         P C +C R  + CV+ L  K +K     ++I
Sbjct: 112 KRKYSRNGCTECKRRRMKCD------ETKPTCWQCARLNRECVYILNAKNKKRKPREARI 165

Query: 78  PST 80
            ST
Sbjct: 166 KST 168

>YKR064W Chr11 (562547..565138) [2592 bp, 863 aa] {ON}
          OAF3Putative transcriptional repressor with
          Zn(2)-Cys(6) finger; negatively regulates transcription
          in response to oleate levels, based on mutant phenotype
          and localization to oleate-responsive promoters; the
          authentic, non-tagged protein is detected in highly
          purified mitochondria in high-throughput studies
          Length = 863

 Score = 39.3 bits (90), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 29/61 (47%), Gaps = 17/61 (27%)

Query: 26 ACTNCKLRKVKCDMGPLENPHDPPCARCRREG--KTCVFLTTKGRKADLGTSKIPSTTPT 83
           CTNCK RK KCD          PC  C R G   +CV+LT         +S  P ++P+
Sbjct: 18 VCTNCKKRKSKCD-------RTKPCGTCVRLGDVDSCVYLT--------DSSGQPESSPS 62

Query: 84 L 84
          L
Sbjct: 63 L 63

>AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; No
           homolog in Saccharomyces cerevisiae
          Length = 612

 Score = 39.3 bits (90), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 18/90 (20%)

Query: 26  ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLT--TKGRKADL------GTSKI 77
            C+ CK RKVKCD         P C +C   GK CV++   +K R  ++      G  ++
Sbjct: 21  GCSECKRRKVKCD------ETKPACWQCSHLGKRCVYMVNNSKIRFKEINVLSLRGRERV 74

Query: 78  PSTTPTLKPNSGNS----VSKKRLDSSTDL 103
                  +  +G+S    V+ + +D+  DL
Sbjct: 75  TDKKACARNGTGSSDPARVTMREVDNRMDL 104

>KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3.109
           YOL089C
          Length = 1006

 Score = 39.3 bits (90), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 21  KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
           +R  KAC +C+ RK+KC  GP+ NP    C  C +    C F
Sbjct: 97  RRVSKACDHCRKRKIKC--GPI-NPAKNKCDNCIKYSSACTF 135

>Kwal_47.16939 s47 (180147..182156) [2010 bp, 669 aa] {ON} [contig
          219] FULL
          Length = 669

 Score = 39.3 bits (90), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 8/72 (11%)

Query: 21 KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKI--- 77
          ++  K C+NCK  KVKC     E     PC RC R    C +L  +  +    +S +   
Sbjct: 7  RKRTKPCSNCKKNKVKC-----EYLSSLPCQRCARHSLKCYYLDGRPPRNAEASSSLETN 61

Query: 78 PSTTPTLKPNSG 89
          P+T   + P+S 
Sbjct: 62 PNTVEAILPSSS 73

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
           cluster protein proposed to function as a
           transcriptional regulator involved in the stress
           response; null mutants have a respiratory deficiency,
           calcofluor white sensitivity and slightly increased
           cycloheximide resistance
          Length = 964

 Score = 39.3 bits (90), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 55/136 (40%), Gaps = 14/136 (10%)

Query: 9   EVLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGR 68
           E  Q+   + K +R  +AC  C+ +KVKCD          PC  C      C +     R
Sbjct: 3   EQAQQGEQSVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKR 55

Query: 69  KADLGTSKIPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVK---IPKTS----PSNPIS 121
             + G S + +        S ++V      +   L++ +  +   +P  S     +NP  
Sbjct: 56  TQNSGNSGVLTLGNVTTGPSSSTVVAAAASNPNKLLSNIKTERAILPGASTIPASNNPSK 115

Query: 122 PTKWKIGLTSMQNSLE 137
           P K+K   T +Q+ ++
Sbjct: 116 PRKYKTKSTRLQSKID 131

>KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]
          {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
          YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
          fungal- type binuclear cluster domain DNA-binding
          transcriptional activator or CHA1 and some similarities
          to YOR337W uniprot|P47988 Saccharomyces cerevisiae
          YOR337W TEA1 Mutants are defective in Ty1
          Enhancer-mediated Activation Ty1 enhancer activator
          Length = 603

 Score = 39.3 bits (90), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 7/48 (14%)

Query: 21 KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGR 68
          ++ + AC NC++++ KCDM       + PC+ C + G  C+ +    R
Sbjct: 11 RKAHLACQNCRIKRRKCDM-------ERPCSNCLKYGIECITVNNDKR 51

>Kwal_33.13934 s33 complement(456687..459080) [2394 bp, 797 aa]
          {ON} YKR064W - Hypothetical ORF [contig 108] FULL
          Length = 797

 Score = 39.3 bits (90), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 35/80 (43%), Gaps = 19/80 (23%)

Query: 7  ENEVLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREG--KTCVFLT 64
          ENE+  K     K +R    CTNCK RK KCD         P C  C R G   TCV+  
Sbjct: 8  ENELRTK-----KRRRPTVVCTNCKRRKSKCDR------LKPICGNCSRLGDQATCVY-- 54

Query: 65 TKGRKADLGTSKIPSTTPTL 84
                +LG   + S +P L
Sbjct: 55 ----GPELGNKPVKSESPRL 70

>NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON}
          Anc_8.423
          Length = 775

 Score = 39.3 bits (90), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 27/58 (46%), Gaps = 9/58 (15%)

Query: 13 KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKA 70
          KR  + K K G   C NCK R+VKCD         P C +C      CV+   K RKA
Sbjct: 47 KRKFHNKSKNG---CDNCKRRRVKCD------ELKPTCQKCINMNLECVYSMPKPRKA 95

>Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON}
          (126243..128966) [2724 nt, 908 aa]
          Length = 907

 Score = 39.3 bits (90), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 6/40 (15%)

Query: 21 KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
          ++ +  C  C+ RKVKCD+      + P C RC R G  C
Sbjct: 11 RKSFNGCWTCRSRKVKCDL------NRPKCQRCDRLGIIC 44

>KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some
           similarities with uniprot|P38141 Saccharomyces
           cerevisiae YBR240C THI2 Zinc finger protein of the
           Zn(II)2Cys6 type probable transcriptional activator of
           thiamine biosynthetic genes
          Length = 348

 Score = 38.9 bits (89), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 49/114 (42%), Gaps = 25/114 (21%)

Query: 22  RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIPSTT 81
           R +  C  C+ +K KCD         P C+ C + G  C +        D+  S +P   
Sbjct: 5   RNFTGCWACRFKKRKCD------ERKPICSLCLKHGVECCY--------DVRLSWLPENM 50

Query: 82  PTLKPN-----SGNS---VSKKRLDSSTDLVNEVPVKIPKTSPSNPISPTKWKI 127
             +K N     SGNS   +SK++    T+L  + P+     S S  IS  ++K+
Sbjct: 51  YVVKDNELGVISGNSNRRMSKEKFKELTNLKYDSPI---SESASFTISARRFKV 101

>Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}
          YML099C (ARG81) - zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type [contig
          336] FULL
          Length = 841

 Score = 39.3 bits (90), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 6/37 (16%)

Query: 24 YKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
          +  C  C+ RKVKCD+G       P C RC + G  C
Sbjct: 20 FTGCWTCRSRKVKCDLG------KPNCQRCEKSGLEC 50

>NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON} 
          Length = 914

 Score = 39.3 bits (90), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 42/99 (42%), Gaps = 10/99 (10%)

Query: 21  KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIPST 80
           KR  KAC +C+ RK+KCD     +P    C+ C +    C F   +GR   L   +    
Sbjct: 100 KRVSKACDHCRKRKIKCDKV---DPSTGKCSNCLKYNANCTF--KRGRDNVLNNRRTSDD 154

Query: 81  TPTLKPNSG---NSVSKKRLDSSTDLVNEVPVKIPKTSP 116
           T +   + G   N+V         D+   +   +P+ SP
Sbjct: 155 TTSSALSKGFALNNVMSPSFSGINDI--RISSNLPQPSP 191

>TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.109
           YOL089C
          Length = 996

 Score = 39.3 bits (90), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 21  KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
           KR  +AC +C+ RK+KCD  P+ NP    C+ C +    C F
Sbjct: 112 KRVARACDHCRRRKIKCD--PV-NPQTNKCSNCTKYDANCTF 150

>KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa]
          {ON} Anc_8.423 YLR228C
          Length = 794

 Score = 38.9 bits (89), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 28/57 (49%), Gaps = 9/57 (15%)

Query: 13 KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRK 69
          KR  + K K G   C NCK R+VKCD         P CA+C     TCV+   + RK
Sbjct: 45 KRKFHNKSKTG---CDNCKRRRVKCD------ETKPMCAKCCNMKLTCVYSPPQPRK 92

>Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {ON}
           YGL013C (REAL)
          Length = 1069

 Score = 39.3 bits (90), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 35/76 (46%), Gaps = 21/76 (27%)

Query: 25  KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKG-------RKADLGTSKI 77
           KAC NC+ RK+KC+ G        PCA C      C F T +G       +KA+L  + +
Sbjct: 41  KACDNCRKRKIKCN-GKF------PCASCEIYSCECTFTTRQGGNRIKNLQKANLEGTIV 93

Query: 78  -------PSTTPTLKP 86
                   S+TP  KP
Sbjct: 94  QGKEETDSSSTPLPKP 109

>KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON}
          conserved hypothetical protein
          Length = 1109

 Score = 38.9 bits (89), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query: 19 KWKRGYKACTNCKLRKVKCDMGPLENPHDPP--CARCRREGKTCVFLTTK--GRKA 70
          K K   +AC  C+ RK+KCD     +P   P  C  C R    CVF+ +   GR+ 
Sbjct: 19 KRKVAKRACLACRERKIKCDGEANPDPSGGPGKCTNCVRSTLECVFVASNRGGRRV 74

>Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON}
           (11943..14819) [2877 nt, 959 aa]
          Length = 958

 Score = 38.9 bits (89), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 4/42 (9%)

Query: 21  KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
           K+  +AC  C+ RK+KCD    +N     C+ C R G  C F
Sbjct: 69  KKATRACDQCRKRKIKCDYDNDKN----VCSSCNRNGDRCQF 106

>TPHA0B01585 Chr2 complement(352396..354834) [2439 bp, 812 aa] {ON}
          Length = 812

 Score = 38.9 bits (89), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 3/77 (3%)

Query: 26  ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTK---GRKADLGTSKIPSTTP 82
           AC  C   K KC    L + +  PC++C+R    CVF  TK    RK +   +       
Sbjct: 48  ACVRCHRLKQKCLPSDLADIYRKPCSKCKRMRLKCVFDLTKRKRNRKRNSNITDYKQDGL 107

Query: 83  TLKPNSGNSVSKKRLDS 99
           ++  N  +SV  K+ D+
Sbjct: 108 SIDINIDDSVRLKKYDT 124

>Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {ON}
           YLR228C (REAL)
          Length = 813

 Score = 38.9 bits (89), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 43/94 (45%), Gaps = 17/94 (18%)

Query: 13  KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKG-RKAD 71
           KR  + K K G   C NCK R+VKCD G       P C +C      CV+   +  R+ D
Sbjct: 32  KRKFHNKSKTG---CDNCKRRRVKCDEG------KPFCKKCTNMKLECVYSPIQPRRRKD 82

Query: 72  LGTSKIPSTTPTLKPNSGNSVSKKRLDSSTDLVN 105
             TSK  +          + + +K L+ +T L++
Sbjct: 83  SSTSKFATIVE-------DGIDRKHLNGNTILLH 109

>KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 833

 Score = 38.9 bits (89), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 6/37 (16%)

Query: 24 YKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
          +  C  C+ RKVKCD+G       P C RC + G  C
Sbjct: 20 FTGCWTCRSRKVKCDLG------KPTCQRCDKSGLEC 50

>Smik_11.326 Chr11 (552455..555052) [2598 bp, 865 aa] {ON} YKR064W
          (REAL)
          Length = 865

 Score = 38.9 bits (89), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 9/52 (17%)

Query: 26 ACTNCKLRKVKCDMGPLENPHDPPCARCRREG--KTCVFLTTKGRKADLGTS 75
           CTNCK RK KCD          PC  C R G   +C++L     K + G++
Sbjct: 18 VCTNCKKRKSKCD-------RTKPCGTCTRLGDADSCIYLNDNAGKLESGST 62

>CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa]
           {ON} similar to uniprot|P40971 Saccharomyces cerevisiae
           YDR034c LYS14 transcriptional activator of lysine
           pathway genes
          Length = 831

 Score = 38.9 bits (89), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 11/70 (15%)

Query: 13  KRAPNYKWKRGY--KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFL---TTKG 67
           K A     KR Y    C  CK R++KCD         P C +C R  + CV++     K 
Sbjct: 188 KDAEGNTVKRKYSRNGCAECKRRRMKCDESK------PKCWQCTRLNRDCVYILNPKNKK 241

Query: 68  RKADLGTSKI 77
           RK   G+ ++
Sbjct: 242 RKTSKGSDRV 251

>TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa]
          {ON} Anc_8.423 YLR228C
          Length = 886

 Score = 38.9 bits (89), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 31/68 (45%), Gaps = 9/68 (13%)

Query: 10 VLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRK 69
          +L KR  + K K G   C +CK R+VKCD         P CA C+     C +   K RK
Sbjct: 40 LLGKRKFHKKSKSG---CDHCKRRRVKCDEA------KPFCANCQHMKLDCFYSPIKPRK 90

Query: 70 ADLGTSKI 77
              + KI
Sbjct: 91 KKTVSKKI 98

>NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]
           {ON} Anc_7.17
          Length = 1059

 Score = 38.9 bits (89), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 14/79 (17%)

Query: 7   ENEVLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTK 66
           E E+ Q++   Y+       C  C+  K KCD         P C+RC + G TC++   K
Sbjct: 36  EEELAQRKKKRYRLSF---VCQECRKSKTKCD------KEKPSCSRCLKIGITCIYDVAK 86

Query: 67  GRKADLGTSKIPSTTPTLK 85
                    K P+ + TLK
Sbjct: 87  QEPP-----KRPNKSATLK 100

>TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.264
           YDR034C
          Length = 724

 Score = 38.9 bits (89), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 6/47 (12%)

Query: 17  NYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFL 63
           N K K     CT CK R++KCD         P C +C R  + C+++
Sbjct: 113 NVKRKYSRNGCTECKRRRIKCD------ETKPTCWQCARLNRECIYV 153

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
          {ON} some similarities with uniprot|P52960
          Saccharomyces cerevisiae YOR363C PIP2 peroxisome
          induction pathway 2 (PIP2) transcriptional activator of
          peroxisome proliferation may form heterodimer with Oaf1
          to activate oleate-inducible gene expression activator
          of peroxisome proliferation
          Length = 619

 Score = 38.5 bits (88), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 6/44 (13%)

Query: 19 KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          K  R    C  C++RK+KCD         P C+RC + G  C++
Sbjct: 7  KRNRRLHVCDACRIRKLKCDKA------KPNCSRCAKHGLECIY 44

>CAGL0D03850g Chr4 (384689..387193) [2505 bp, 834 aa] {ON} weakly
          similar to uniprot|Q06639 Saccharomyces cerevisiae
          YDR303c RSC3 or uniprot|P38781 Saccharomyces cerevisiae
          YHR056c
          Length = 834

 Score = 38.9 bits (89), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 6/37 (16%)

Query: 26 ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          AC  C+ RK+ CD G       P C  C ++GKT  F
Sbjct: 15 ACQQCRRRKIGCDRGK------PICGNCLKQGKTDCF 45

>KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON}
          Anc_8.879 YML099C
          Length = 882

 Score = 38.9 bits (89), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 6/39 (15%)

Query: 22 RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
          + +  C  C+ RKVKCD+        P C RC R G  C
Sbjct: 17 KTFTGCWTCRARKVKCDLT------RPSCTRCERSGLKC 49

>Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON}
          YBL066C (REAL)
          Length = 1159

 Score = 38.9 bits (89), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 5/40 (12%)

Query: 22 RGYKACTNCKLRKVKCDMGPLEN-PHDPPCARCRREGKTC 60
          R   +CT+C+  K+KCD    +N PH  PC+RC++ G  C
Sbjct: 48 RPVTSCTHCRQHKIKCDAS--QNFPH--PCSRCQKIGLHC 83

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 38.5 bits (88), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 6/39 (15%)

Query: 22 RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
          R Y  C  C+ RKVKCD         P C RC++ G  C
Sbjct: 15 RSYSGCWTCRARKVKCDT------QRPKCCRCKQLGIEC 47

>NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56
          Length = 718

 Score = 38.5 bits (88), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 7/59 (11%)

Query: 21 KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIPS 79
          KR   AC+NC+ R+ KCD+       + PCA C R G  C       RK    +S + S
Sbjct: 31 KRKRLACSNCRRRRKKCDL-------NFPCANCIRLGLNCNVNEEDMRKKRYTSSYVKS 82

>Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON}
          YBL066C (REAL)
          Length = 1155

 Score = 38.5 bits (88), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 5/40 (12%)

Query: 22 RGYKACTNCKLRKVKCDMGPLEN-PHDPPCARCRREGKTC 60
          R   +CT+C+  K+KCD    +N PH  PC+RC + G  C
Sbjct: 53 RPVTSCTHCRQHKIKCDAS--QNFPH--PCSRCEKIGLHC 88

>TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON}
          Anc_8.423 YLR228C
          Length = 810

 Score = 38.5 bits (88), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 9/57 (15%)

Query: 13 KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRK 69
          KR  + K K G   C NCK R+VKCD G       P C +C      CV+   + +K
Sbjct: 39 KRKFHNKSKNG---CDNCKRRRVKCDEG------KPACQKCLNMKLDCVYTPVQPKK 86

>ZYRO0B14718g Chr2 (1196539..1199646) [3108 bp, 1035 aa] {ON}
           similar to uniprot|Q03631 Saccharomyces cerevisiae
           YML076C WAR1 zinc finger transcription factor
          Length = 1035

 Score = 38.5 bits (88), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 21/44 (47%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
           K KR   AC +C   K KC      + +  PC RC + GK C F
Sbjct: 100 KLKRNSFACISCHSLKQKCVPSDFNDIYRKPCIRCLKNGKLCRF 143

>NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON}
           Anc_3.264
          Length = 741

 Score = 38.5 bits (88), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 8/51 (15%)

Query: 21  KRGY--KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRK 69
           KR Y    C  CK R++KCD         P C +C R  + CV++   G K
Sbjct: 124 KRKYSRNGCAECKRRRMKCD------ETKPICWQCARLSRECVYIVKSGNK 168

>YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}
          SEF1Putative transcription factor, has homolog in
          Kluyveromyces lactis
          Length = 1148

 Score = 38.5 bits (88), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 5/40 (12%)

Query: 22 RGYKACTNCKLRKVKCDMGPLEN-PHDPPCARCRREGKTC 60
          R   +CT+C+  K+KCD    +N PH  PC+RC + G  C
Sbjct: 52 RPVTSCTHCRQHKIKCDAS--QNFPH--PCSRCEKIGLHC 87

>Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089C
          (HAL9) - 1:1 [contig 184] FULL
          Length = 865

 Score = 38.5 bits (88), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 21 KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          KR  KAC +C+ RK+KC  GP+ NP    C  C +   +C F
Sbjct: 23 KRVPKACDHCRKRKIKC--GPV-NPITGTCENCNKFNTSCTF 61

>KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON}
          uniprot|Q7Z8R2 Kluyveromyces lactis Sip4 protein
          Length = 717

 Score = 38.5 bits (88), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 6/42 (14%)

Query: 19 KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
          K KR  +AC  C+L+K+KCD         P C+ C++ G  C
Sbjct: 55 KVKRFSQACDRCRLKKIKCD------GIKPSCSNCKKIGYHC 90

>CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa]
          {ON} some similarities with uniprot|P05085
          Saccharomyces cerevisiae YML099c ARG81
          Length = 702

 Score = 38.5 bits (88), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 6/39 (15%)

Query: 22 RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
          + Y  C  C+ RKVKCD+        P C RCRR    C
Sbjct: 10 KTYSGCWTCRARKVKCDLV------RPSCLRCRRSKVQC 42

>Ecym_5183 Chr5 complement(385669..388101) [2433 bp, 810 aa] {ON}
          similar to Ashbya gossypii ACR241C
          Length = 810

 Score = 38.5 bits (88), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 27/63 (42%), Gaps = 9/63 (14%)

Query: 26 ACTNCKLRKVKCDMGPLENPHDPPCARCRREG--KTC-VFLTTKGRKADLGTSKIPSTTP 82
           CTNCK RK +CD G       P C  C R G  +TC  F    G + +     I S   
Sbjct: 13 VCTNCKRRKSRCDRGK------PACGNCIRLGNRETCQYFPAALGTEGEFDEVSIDSNVS 66

Query: 83 TLK 85
           L+
Sbjct: 67 CLQ 69

>Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}
          similar to Ashbya gossypii AGL091W
          Length = 840

 Score = 38.5 bits (88), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 6/49 (12%)

Query: 21 KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRK 69
          K+    C NCK R+VKCD    EN   P C +C +    C++   K R+
Sbjct: 51 KKSKNGCDNCKRRRVKCD----EN--KPCCQKCFKMKLHCIYTPAKPRR 93

>SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON}
          weakly similar to uniprot|P50104 Saccharomyces
          cerevisiae YMR019W STB4 Protein that binds Sin3p in a
          two- hybrid assay
          Length = 687

 Score = 38.1 bits (87), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 31/76 (40%), Gaps = 19/76 (25%)

Query: 22 RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIPSTT 81
          R  KAC  CK RK+KCD          PC  C +    CV+  T             + +
Sbjct: 23 RVRKACEICKKRKIKCD-------GHQPCTSCTKNSVQCVYKFTD------------TAS 63

Query: 82 PTLKPNSGNSVSKKRL 97
          P  KP  G S+ K+ +
Sbjct: 64 PISKPKPGRSLDKESI 79

>KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} similar
          to uniprot|P53749 Saccharomyces cerevisiae YNR063W
          Hypothetical ORF
          Length = 612

 Score = 38.1 bits (87), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 7/39 (17%)

Query: 19 KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREG 57
          K K G +AC  CKL+K+KCD        + PC RC + G
Sbjct: 8  KRKVGRRACMLCKLKKLKCD-------GNYPCGRCAKSG 39

>NCAS0B02860 Chr2 complement(488982..491591) [2610 bp, 869 aa]
          {ON} Anc_8.423
          Length = 869

 Score = 38.5 bits (88), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 9/62 (14%)

Query: 13 KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADL 72
          KR  + K K+G   CT+CK R+VKCD         P C RC      CV+   + +K  +
Sbjct: 44 KRKFHNKSKQG---CTHCKRRRVKCD------ELKPACRRCLNWNVPCVYPVVQPKKRKV 94

Query: 73 GT 74
           T
Sbjct: 95 ST 96

>TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON} 
          Length = 873

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 21 KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          KR   AC  C+ +K KCD   LE   + PC +C ++G +CV 
Sbjct: 26 KRKKFACVECRQQKSKCD--ALEKAPE-PCTKCSKKGVSCVL 64

>TDEL0G04890 Chr7 (903504..903581,903640..905316) [1755 bp, 584
          aa] {ON} 
          Length = 584

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 6/43 (13%)

Query: 24 YKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTK 66
          +  C  CK RK+KCD G       P C  C R  K+C +L  K
Sbjct: 14 HNGCKECKRRKIKCDEG------KPVCWHCDRLEKSCQYLQVK 50

>Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON}
           YBL066C (REAL)
          Length = 1150

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 36/76 (47%), Gaps = 12/76 (15%)

Query: 22  RGYKACTNCKLRKVKCDMGPLEN-PHDPPCARCRREGKTC----VFLTTKGRKADL---G 73
           R   +CT+C+  K+KCD    +N PH  PC+RC + G  C     F   KG +  L    
Sbjct: 56  RPVTSCTHCRQHKIKCDAS--QNFPH--PCSRCEKIGLHCEINPQFRPKKGSQLQLLRQD 111

Query: 74  TSKIPSTTPTLKPNSG 89
             +I S   TL  N G
Sbjct: 112 VDEIKSKLDTLLANDG 127

>NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2.547
          Length = 1141

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
           K  +  +AC  C+ +K+KCD    +      C+ C+R G+ C F
Sbjct: 67  KRTKASRACDQCRKKKIKCDFSEEKT----LCSNCQRNGEKCTF 106

>KAFR0I00280 Chr9 complement(57061..59871) [2811 bp, 936 aa] {ON}
           Anc_4.344 YML076C
          Length = 936

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 41/89 (46%), Gaps = 6/89 (6%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTK--GRKADLGTSK 76
           K KR   AC  C   K KC      + +  PC RC R+   C F  +K   +K  +G + 
Sbjct: 46  KTKRHAFACVRCHSLKQKCVPSDSNDIYRKPCQRCLRQKIVCKFDLSKRIRKKRKMGMAS 105

Query: 77  IPS---TTPTLKPNS-GNSVSKKRLDSST 101
           I +   T+P +  NS  NSV    L +S+
Sbjct: 106 IDNSAKTSPAVIDNSPSNSVVNDILSNSS 134

>KNAG0C01160 Chr3 complement(226939..229446) [2508 bp, 835 aa] {ON}
           Anc_1.199 YKR064W
          Length = 835

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 96/256 (37%), Gaps = 50/256 (19%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGK--TCVFLTTKGRKAD---LG 73
           K KR    CTNC+ RK +CD        + PC  C R G   +CV+L +     +   L 
Sbjct: 14  KRKRPTVVCTNCRRRKSRCD-------RERPCNTCTRFGNADSCVYLDSSPSSNEPQILL 66

Query: 74  TSKIPST--------TPTLKPNSGNSVSKKRLDSSTDLVNEVPVKI---PKTSPSNPISP 122
           TS   S         T +  P+ G    K  +D     +N +P       K S  N  SP
Sbjct: 67  TSSRRSNSSKSHDFRTVSSVPDVGYQKDKTLMDLGPRYINIIPAGFYVAAKRSAVNIFSP 126

Query: 123 TKWKIGLTSMQNSLEFLAKAAGNVGFLSAPSAHSAREELN-SAVVPKATSLPQEESLMNM 181
               +G+      L FL +       +S     +  +  N + ++P   +LP+    ++ 
Sbjct: 127 FT-DVGMEHRDPYLSFLVRFRS----ISIRKMMTKYKRNNTTTIIP---NLPRSFMPLST 178

Query: 182 TSSLHSDLLNISPIGKL-QHKSLPLIDKLNIVRPTPRRKLT----DIDYIGPNRLLSESD 236
                 + L+        QHKS  L +K    R    +K T    D+ Y  P +      
Sbjct: 179 FDFDEGNYLDARAQYYFRQHKS--LFNKFAKFRENDSKKFTDTNIDVKYYMPGK------ 230

Query: 237 AIELIDLFFLTMFPFF 252
                D+F   +FPFF
Sbjct: 231 -----DVFLKHIFPFF 241

>KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON}
          weakly similar to uniprot|P25611 Saccharomyces
          cerevisiae YCR106W RDS1 Regulator of drug sensitivity
          transcriptional regulator
          Length = 934

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 6/45 (13%)

Query: 26 ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKA 70
           C  C+ RK+KCD         P C+RC   G  C +L +  R A
Sbjct: 18 VCQECRRRKIKCD------KKRPRCSRCVDTGLPCTYLASGSRSA 56

>KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 866

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 49/121 (40%), Gaps = 18/121 (14%)

Query: 3   ASLLENEVLQKRAPN---YKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKT 59
           A+  E  V +KR P        R   AC  C++RKVKCD         P C+RC    + 
Sbjct: 11  AANAEESVDRKRRPTSAIMGISRSIAACKRCRVRKVKCDQ------KFPSCSRCVTANEP 64

Query: 60  CVFLTTKGRKADLGTSK-IPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSN 118
           CV         D  T + +P +      +   +++K+  +   D   EV   IP TS   
Sbjct: 65  CV-------SVDPATGRDVPRSYVIFLEDRLEALTKRLREYGVDAA-EVQGNIPATSDDC 116

Query: 119 P 119
           P
Sbjct: 117 P 117

>KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly
          similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051W OAF1 Oleate-activated transcription factor acts
          alone and as a heterodimer with Pip2p activates genes
          involved in beta-oxidation of fatty acids and
          peroxisome organization and biogenesis
          Length = 880

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 9/49 (18%)

Query: 17 NYKWKRGYK---ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          N K K+ YK    C  C+  K KCD         P CARC+R  K C++
Sbjct: 8  NLKAKKRYKLSFVCQLCRKSKTKCD------RKKPSCARCQRLNKPCIY 50

>NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON}
           Anc_2.547
          Length = 1210

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
           K  +  +AC  C+ +K+KCD    +N     C+ C+R  + C F
Sbjct: 83  KRTKASRACDQCRKKKIKCDFTEAKN----ICSNCQRNAEKCTF 122

>KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]
          {ON} Anc_2.547 YKL038W
          Length = 1286

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query: 19 KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          K  +  +AC  C+ +K+KCD   + N     C  C+R G+ C F
Sbjct: 47 KRTKASRACDQCRRKKIKCDYNDMRN----ICTNCQRIGERCSF 86

>YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}
           LYS14Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway; requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 790

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 7/61 (11%)

Query: 10  VLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF-LTTKGR 68
           V  K+    K K     C+ CK R++KCD         P C +C R  + CV+ L  K +
Sbjct: 142 VTDKKGNTVKRKYSRNGCSECKRRRMKCD------ETKPTCWQCARLNRQCVYVLNPKNK 195

Query: 69  K 69
           K
Sbjct: 196 K 196

>YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON}
          ECM22Sterol regulatory element binding protein,
          regulates transcription of sterol biosynthetic genes;
          contains Zn[2]-Cys[6] binuclear cluster; homologous to
          Upc2p; relocates from intracellular membranes to
          perinuclear foci on sterol depletion
          Length = 814

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 32/68 (47%), Gaps = 10/68 (14%)

Query: 13 KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKG-RKAD 71
          KR  + K K G   C NCK R+VKCD G       P C +C      CV+   +  R+ D
Sbjct: 33 KRKFHNKSKTG---CDNCKRRRVKCDEG------KPFCKKCTNMKLDCVYSPIQPRRRKD 83

Query: 72 LGTSKIPS 79
            +SK  S
Sbjct: 84 SSSSKFAS 91

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa]
          {ON} conserved hypothetical protein
          Length = 370

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 7/42 (16%)

Query: 21 KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          +R  KAC  C+  K KCD        + PC+RC +E K C +
Sbjct: 16 RRVSKACDACRKSKTKCD-------GERPCSRCLKENKLCTY 50

>Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa]
          {ON} YKL038W (RGT1) - 1:1 [contig 55] FULL
          Length = 970

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 4/38 (10%)

Query: 25 KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          +AC  C+ +K +CD     +  +P C  C+R  KTC F
Sbjct: 37 RACDQCRGKKTRCDF----SDENPVCTSCQRMSKTCTF 70

>Skud_13.66 Chr13 complement(111847..114666) [2820 bp, 939 aa] {ON}
           YML076C (REAL)
          Length = 939

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 1/54 (1%)

Query: 17  NYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF-LTTKGRK 69
           N K KR   AC  C   K KC+     + +  PC RC +  K C F L+ + RK
Sbjct: 65  NGKIKRNSFACVCCHSLKQKCEPSDTNDIYRKPCQRCLKHKKLCKFDLSKRTRK 118

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1207

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 44/97 (45%), Gaps = 21/97 (21%)

Query: 25  KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTK--GRKADLGTSKIP---- 78
           KAC NC+ RK+KC         + PCA C+     C+F  +    R + +  +KI     
Sbjct: 15  KACDNCRRRKIKC-------SGERPCAGCKTYNCECIFSVSAPTPRASKVKKNKIAGIVN 67

Query: 79  ------STTPTL--KPNSGNSVSKKRLDSSTDLVNEV 107
                 S +PT    PNS N ++   + ++  L++ V
Sbjct: 68  HSPKNGSISPTTGNNPNSNNILTDDSISNNDSLLSPV 104

>Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}
           complement(38664..41510) [2847 nt, 949 aa]
          Length = 948

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 6/49 (12%)

Query: 21  KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRK 69
           K+    C NCK R+VKCD         P C +C      CV+   + RK
Sbjct: 105 KKSKNGCDNCKRRRVKCD------ESKPICQKCINMKLNCVYTPVQPRK 147

>KLLA0B04840g Chr2 (439864..442179) [2316 bp, 771 aa] {ON}
          conserved hypothetical protein
          Length = 771

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 5/43 (11%)

Query: 21 KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFL 63
          K+  K C +CKL KVKC     E     PC RC + G  C F+
Sbjct: 6  KKRTKPCISCKLSKVKC-----EYTEALPCKRCLKLGIHCQFV 43

>Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa]
          {ON} YLR228C (REAL)
          Length = 814

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 9/57 (15%)

Query: 13 KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRK 69
          KR  + K K G   C NCK R+VKCD G       P C +C      CV+   + R+
Sbjct: 34 KRKFHNKSKTG---CDNCKRRRVKCDEG------KPFCKKCTNMKLDCVYSPIQPRR 81

>CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON}
          similar to uniprot|P08638 Saccharomyces cerevisiae
          YLR451w LEU3 transcription factor
          Length = 940

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 9/40 (22%)

Query: 26 ACTNCKLRKVKCDMGPLENPHDP---PCARCRREGKTCVF 62
          AC  C+ +K KCD       HD    PC RC+++G  CV 
Sbjct: 57 ACVECRQQKSKCDA------HDKAPEPCTRCQKKGVPCVL 90

>SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]
           {ON} conserved hypothetical protein
          Length = 971

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 41/95 (43%), Gaps = 15/95 (15%)

Query: 18  YKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFL----TTKGRKADLG 73
           +K +R   +C  C  RK+KC          P C+ C +    CV+      +KGR   + 
Sbjct: 26  HKRQRKILSCVPCHQRKIKCSRD------QPACSNCLKNNWDCVYFLNDRISKGRGTPIA 79

Query: 74  TSKIPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVP 108
           ++ +P T      ++G++ +       TD   EVP
Sbjct: 80  STIVPPTD-----DAGDTHTDTDAQIKTDRPFEVP 109

>KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa] {ON}
           Anc_8.283 YLR098C
          Length = 664

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 39/90 (43%), Gaps = 16/90 (17%)

Query: 26  ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIPSTTPTLK 85
           AC  C+ R+ KCDM         PC+ C + G  CVF     RK+    S + +    + 
Sbjct: 18  ACITCRQRRRKCDM-------QEPCSICIKFGTRCVFTGEDLRKSRHSASYVKTLENRIA 70

Query: 86  PNSGNSVSKKRLDSST------DLVNEVPV 109
                  S +RL  ST      +++N VP+
Sbjct: 71  LLES---SFRRLKESTNEEEKMNIINSVPL 97

>KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} similar
          to uniprot|P26370 Saccharomyces cerevisiae YDL170W UGA3
          Transcriptional activator necessary for gamma-
          aminobutyrate (GABA)-dependent induction of GABA genes
          (such as UGA1 UGA2 UGA4) zinc- finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type localized to the nucleus
          Length = 623

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 8/51 (15%)

Query: 21 KRGYK--ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRK 69
          KR ++   C  CK+RK +C      + H P C  C+R G  CV+L  K  K
Sbjct: 19 KRTHRKTGCVPCKIRKKRC------SEHKPVCTDCQRLGFYCVYLPEKCPK 63

>KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa]
          {ON} 
          Length = 632

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 7/37 (18%)

Query: 26 ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          AC +C+ ++ KC+M         PC+ C+R G  C+F
Sbjct: 20 ACLHCRHKRKKCNM-------KSPCSNCQRAGMKCIF 49

>KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON}
          Anc_1.277 YJL089W
          Length = 725

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 6/49 (12%)

Query: 22 RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKA 70
          R  +AC  C+L+K+KCD         P C+ C++    C   T   R+ 
Sbjct: 11 RVSQACDRCRLKKIKCD------GQKPRCSNCKKINFNCAISTKLSRRG 53

>KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 820

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 7/48 (14%)

Query: 21 KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGR 68
          +R  +AC NC+ RKVKC           PCA CR     C +  ++ +
Sbjct: 12 ERAARACLNCRRRKVKCS-------GQSPCANCRNYNCACTYAVSEAQ 52

>KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} some
           similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1007

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 3/40 (7%)

Query: 25  KACTNCKLRKVKCDM--GPLENPHDPPCARCRREGKTCVF 62
           +AC  C+ +K+KCD   G   NP D  C  CR+ G+ C F
Sbjct: 115 RACDQCRKKKIKCDFIEGHDINP-DQSCTGCRKIGEKCSF 153

>Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W
          (REAL)
          Length = 918

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 28/61 (45%), Gaps = 12/61 (19%)

Query: 13 KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTT---KGRK 69
          KR  + K K G   C NCK R+VKCD G       P C +C      C++      KGR 
Sbjct: 40 KRKFHNKSKNG---CDNCKRRRVKCDEG------KPACKKCTNMKLECLYTPIHLRKGRG 90

Query: 70 A 70
          A
Sbjct: 91 A 91

>Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON}
           YDR034C (REAL)
          Length = 784

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 7/67 (10%)

Query: 4   SLLENEVLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF- 62
           S + + V  K+    K K     C+ CK R++KCD         P C +C R  + CV+ 
Sbjct: 130 SAVTSTVTDKKGNTVKRKYSRNGCSECKRRRMKCD------ETKPTCWQCARLNRQCVYV 183

Query: 63  LTTKGRK 69
           L  K +K
Sbjct: 184 LNPKNKK 190

>TBLA0I01890 Chr9 complement(423851..426328) [2478 bp, 825 aa] {ON}
           Anc_3.264 YDR034C
          Length = 825

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 8/45 (17%)

Query: 21  KRGY--KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFL 63
           KR Y    CT CK R++KCD         P C +C R  ++C+++
Sbjct: 155 KRKYSRNGCTECKKRRMKCD------ETKPICWQCSRLNRSCIYI 193

>NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa]
          {ON} 
          Length = 1108

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 7/46 (15%)

Query: 21 KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTK 66
          K+  KAC NC+ RK+KC  G        PC+ C      CVF  TK
Sbjct: 11 KKVVKACLNCRRRKIKC-TGTF------PCSNCAAYQCECVFDETK 49

>Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W
          (REAL)
          Length = 913

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 28/61 (45%), Gaps = 12/61 (19%)

Query: 13 KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTT---KGRK 69
          KR  + K K G   C NCK R+VKCD G       P C +C      C++      KGR 
Sbjct: 40 KRKFHNKSKNG---CDNCKRRRVKCDEG------KPACKKCTNMKLECLYTPIHLRKGRG 90

Query: 70 A 70
          A
Sbjct: 91 A 91

>Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar
          to Ashbya gossypii AGL233C
          Length = 926

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 15/80 (18%)

Query: 7  ENEVLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREG-KTCVFLTT 65
          +N+V++ R      ++  K+C  C+ R+VKCD         P C+ C  +G   CV+L+ 
Sbjct: 5  DNKVVKTR------RKVSKSCVFCRKRRVKCDKA------RPKCSTCVSKGLPECVYLSE 52

Query: 66 KGRKADLGTSKIPSTTPTLK 85
               D+ + ++ S+TP +K
Sbjct: 53 FTH--DVNSRELFSSTPNVK 70

>KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON} 
          Length = 800

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 9/71 (12%)

Query: 21 KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREG-KTCVFLTTKGR--KADLGTSKI 77
          ++  K+C  C+ RK+KCD         P C+ CR  G  +CV+   K       +    +
Sbjct: 16 RKPVKSCAFCRQRKLKCDH------QRPLCSSCRARGLSSCVYALNKFEDCAGPVTPDPV 69

Query: 78 PSTTPTLKPNS 88
          PS  P L  NS
Sbjct: 70 PSNVPELLDNS 80

>TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa]
          {ON} Anc_7.17 YOR363C
          Length = 892

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 6/44 (13%)

Query: 19 KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          K  R  K C  C+ RKVKCD         P C RC +    C +
Sbjct: 7  KKPRPSKVCLTCRRRKVKCDQ------QHPSCMRCIKSSTLCTY 44

>AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YJL089W (SIP4)
          Length = 852

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 6/40 (15%)

Query: 21 KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
          KR  +AC  C+L+K+KCD         P C  C++ G  C
Sbjct: 23 KRSSQACDRCRLKKIKCDG------LRPSCTSCKKIGYQC 56

>Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON}
          (38439..41270) [2832 nt, 944 aa]
          Length = 943

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 6/44 (13%)

Query: 19 KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          K  R  + C  CK RK++CD         P C RC+R    C +
Sbjct: 7  KKPRPSRVCVQCKKRKLRCDR------QRPTCTRCKRSSTICTY 44

>YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON}
          PPR1Zinc finger transcription factor containing a
          Zn(2)-Cys(6) binuclear cluster domain, positively
          regulates transcription of URA1, URA3, URA4, and URA10,
          which are involved in de novo pyrimidine biosynthesis,
          in response to pyrimidine starvation; activity may be
          modulated by interaction with Tup1p
          Length = 904

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 8/55 (14%)

Query: 11 LQKRA--PNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFL 63
          L KR   PN    +   AC  C+L+K+KCD         P C RC +    CV L
Sbjct: 16 LSKRGDSPNIGISKSRTACKRCRLKKIKCDQ------EFPSCKRCAKLEVPCVSL 64

>KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON}
          Anc_7.512 YLR451W
          Length = 766

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 7/54 (12%)

Query: 19 KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCV----FLTTKGR 68
          K KR   AC  C+ +K KCD          PC+RC+++G  C     F  TK R
Sbjct: 10 KSKRRKYACVECRQQKSKCDY---TTKFPEPCSRCKKKGIICAVKQGFKRTKKR 60

>TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.61
          YOR172W
          Length = 799

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 36/78 (46%), Gaps = 18/78 (23%)

Query: 25 KACTNCKLRKVKCDMGPLENPHDPPCARC-RREGKTCVFLTTKGRKADLGT--------- 74
          K+CT C++RK+KCD       + P C+ C  R+ K C +  T   +A   T         
Sbjct: 25 KSCTFCRMRKLKCD------KNKPMCSTCVVRQRKECSYTYTTSSRASSPTANDGKVNIS 78

Query: 75 --SKIPSTTPTLKPNSGN 90
            SK  +   +L P+ GN
Sbjct: 79 NLSKKENVYDSLSPSEGN 96

>NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON}
          Anc_6.279
          Length = 890

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 6/38 (15%)

Query: 25 KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          +AC NC+L+K+KC          P C++C + G  C++
Sbjct: 18 QACDNCRLKKLKCSK------ETPKCSKCLKNGMKCLY 49

>KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {ON}
           some similarities with uniprot|P35995 Saccharomyces
           cerevisiae YKL222c
          Length = 658

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 9/68 (13%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKT-CVFLTTKGRKADLGTSKI 77
           K ++  K+CT C+ RK+KCD         P C  C+  G + CV+  T G   D+    +
Sbjct: 82  KRRKVIKSCTFCRKRKLKCD------RKRPMCTGCKMRGLSECVY--TDGYNFDISHDDV 133

Query: 78  PSTTPTLK 85
            + +P L+
Sbjct: 134 YNKSPNLQ 141

>KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 768

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 8/45 (17%)

Query: 21  KRGY--KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFL 63
           KR Y    C  CK R++KCD G       P C +C R  + CV++
Sbjct: 147 KRKYSRNGCLECKKRRMKCDEG------KPTCWQCARLNRKCVYI 185

>TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON}
          Anc_8.423 YLR228C
          Length = 973

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 23/50 (46%), Gaps = 9/50 (18%)

Query: 13 KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          KR  + K K G   C NCK R+VKCD         P C +C      CV+
Sbjct: 41 KRKFHNKSKNG---CDNCKRRRVKCDEA------KPACVKCSNMKLDCVY 81

>KLTH0F05258g Chr6 complement(462417..464825) [2409 bp, 802 aa]
          {ON} weakly similar to uniprot|P36023 Saccharomyces
          cerevisiae YKR064W Hypothetical ORF
          Length = 802

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 36/87 (41%), Gaps = 20/87 (22%)

Query: 16 PNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREG--KTCVF-LTTKGRKADL 72
          P  K +R    CTNCK RK KCD         P C  C R G   TC + L   G     
Sbjct: 11 PAKKRRRPTVVCTNCKRRKSKCDR------LKPVCGNCLRLGDETTCAYGLEPAGEARKP 64

Query: 73 GTSK--------IPSTTPT---LKPNS 88
          G S+        + ST PT   L+PN 
Sbjct: 65 GVSRLVAQCFEMVRSTQPTLIDLQPNG 91

>SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa]
           {ON} some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1020

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 16/117 (13%)

Query: 25  KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF--LTTKGRKADLGTSKIPSTTP 82
           +AC  C+ +K+KCD+    +  +P C+ C + G  C F  +  K   +   T +  S+T 
Sbjct: 34  RACDQCRKKKIKCDV----SEDNPVCSGCFKVGDRCTFERVPLKRGPSKGYTKQSSSSTD 89

Query: 83  TLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSN------PISPTKWKIGLTSMQ 133
           +L     N+ S KR +S     +E   K P  S  N      P++    + G TS Q
Sbjct: 90  SLD----NNTSTKRRNSVKRNNSESSPKYPDQSGKNGSVSLPPLAHYLPQAGFTSAQ 142

>YML076C Chr13 complement(112513..115347) [2835 bp, 944 aa] {ON}
           WAR1Homodimeric Zn2Cys6 zinc finger transcription
           factor; binds to a weak acid response element to induce
           transcription of PDR12 and FUN34, encoding an acid
           transporter and a putative ammonia transporter,
           respectively
          Length = 944

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF-LTTKGRK 69
           K KR   AC  C   K KC+   + + +  PC RC +  K C F L+ + RK
Sbjct: 68  KTKRNSFACVCCHSLKQKCEPSDVNDIYRKPCRRCLKHKKLCKFDLSKRTRK 119

>Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa]
          {ON} YLR014C (REAL)
          Length = 903

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 6/49 (12%)

Query: 15 APNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFL 63
          +PN    +   AC  C+L+K+KCD         P C RC +    CV L
Sbjct: 21 SPNIAISKSRTACKRCRLKKIKCDQ------EFPSCKRCAKLQVPCVSL 63

>Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON}
           YDR034C (REAL)
          Length = 784

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 7/61 (11%)

Query: 10  VLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF-LTTKGR 68
           V  K+    K K     C+ CK R++KCD         P C +C R  + CV+ L  K +
Sbjct: 136 VRDKKGNTVKRKYSRNGCSECKRRRMKCDET------KPTCWQCARLNRECVYVLNPKNK 189

Query: 69  K 69
           K
Sbjct: 190 K 190

>Kpol_1071.10 s1071 (22248..24344) [2097 bp, 698 aa] {ON}
           (22248..24344) [2097 nt, 699 aa]
          Length = 698

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 83/202 (41%), Gaps = 17/202 (8%)

Query: 26  ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIPSTTPTLK 85
           AC+NC+ R+ KCD+G        PC  C R    C       RK     S + S    + 
Sbjct: 10  ACSNCRRRRKKCDLG-------YPCGTCERLKLVCNVNDVDLRKKRYSASYVKSLESQVS 62

Query: 86  PNSGN--SVSKKRLDSSTDLVNEVPVK----IPKTSPSNPISPTKWKIGLTSMQNSLEFL 139
               N  ++S+K         + +P+        T   +   P K++     +Q  +E  
Sbjct: 63  NVEANVRNLSEKLYPDFAKTFDNMPLNEVLSTLVTVHEDQSEPNKYEQIRNLLQ--IEKS 120

Query: 140 AKAAGNVGFLSAP-SAHSAREELNSAVVPKATSLPQEESLMNMTSSLHSDLLNISPIGKL 198
             +  NVG LS+    +S + +LNS+  P    +  ++    +  SL+ +   +S   K 
Sbjct: 121 VNSNSNVGPLSSSLDGNSNQNKLNSSGNPNENFMVSKKKKTFVKGSLYPE-GPVSYQAKS 179

Query: 199 QHKSLPLIDKLNIVRPTPRRKL 220
           +  SLP+   ++   P+P  ++
Sbjct: 180 KSHSLPVSTSVSNDSPSPGSQM 201

>Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON}
           YDR034C (REAL)
          Length = 778

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 7/67 (10%)

Query: 4   SLLENEVLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF- 62
           S + + V  K+    K K     C+ CK R++KCD         P C +C R  + C++ 
Sbjct: 124 SAVTSTVTDKKGNTVKRKYSRNGCSECKRRRMKCD------ETKPTCWQCARLNRHCIYV 177

Query: 63  LTTKGRK 69
           L  K +K
Sbjct: 178 LNPKNKK 184

>YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}
           MAL33MAL-activator protein, part of complex locus MAL3;
           nonfunctional in genomic reference strain S288C
          Length = 468

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 41/91 (45%), Gaps = 20/91 (21%)

Query: 26  ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF---LTTKGRKADLGTSKIPSTTP 82
           AC  C++R+VKCD          PC+RC      C +   L  +G K        P  T 
Sbjct: 7   ACDYCRVRRVKCD-------GKKPCSRCIEHNFDCTYQQPLKKRGSK--------PIGTR 51

Query: 83  TLK--PNSGNSVSKKRLDSSTDLVNEVPVKI 111
           +LK  P +   +  K   ++ +++ +VP K+
Sbjct: 52  SLKYIPKAKMFIDNKSCTAAAEILMKVPKKV 82

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 52/111 (46%), Gaps = 22/111 (19%)

Query: 21  KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKAD--LGTSKIP 78
           +R  +AC  C+ RK+KCD   ++N     C+ C + G  C F   +   +   L  S   
Sbjct: 117 RRVARACDRCRKRKIKCD--EIKNLKVNKCSNCVKYGAECTFKNWEEHDSQNLLAAS--- 171

Query: 79  STTPTLKPNSGNSVS-----KKRLDSSTDLVNEVPVKIPKTSPSNPISPTK 124
                 K +  N++S     K +LD+S+++    P     TSP++ I P+K
Sbjct: 172 ------KNDKNNNLSNFDNDKNKLDNSSNI--NTPAS--STSPADVIPPSK 212

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa]
          {ON} conserved hypothetical protein
          Length = 362

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 7/42 (16%)

Query: 21 KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          KR  KAC  C+  K KCD        + PC RC  E K C +
Sbjct: 5  KRVSKACDTCRKSKTKCD-------GERPCQRCLSENKICTY 39

>KLLA0C16489g Chr3 (1444456..1446642) [2187 bp, 728 aa] {ON}
          conserved hypothetical protein
          Length = 728

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 13/56 (23%)

Query: 22 RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF-------LTTKGRKA 70
          R    C  C+L+++KCD         P C RC+R   TC++       LT K R+A
Sbjct: 38 RSKSGCFTCRLKRMKCD------EQHPICGRCKRNLLTCIWPKEGNGKLTKKMRQA 87

>Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa]
          {ON} YLR014C (REAL)
          Length = 899

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 6/49 (12%)

Query: 15 APNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFL 63
          +PN  + +   AC  C+L+K+KCD         P C RC      CV L
Sbjct: 22 SPNIGFSKSRTACKRCRLKKIKCDQ------EFPSCKRCANLEVPCVSL 64

>CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON}
          similar to uniprot|P32862 Saccharomyces cerevisiae
          YKL038w RGT1
          Length = 1287

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 4/38 (10%)

Query: 25 KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          +AC  C+ +K+KCD     N     C  C+R G+ C F
Sbjct: 14 RACDQCRRKKIKCDRNQERN----ICTSCQRNGERCKF 47

>ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]
          {ON} similar to gnl|GLV|KLLA0D10153g Kluyveromyces
          lactis KLLA0D10153g and weakly similar to
          uniprot|P35995 Saccharomyces cerevisiae YKL222C
          Hypothetical ORF
          Length = 648

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 6/38 (15%)

Query: 25 KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          K CTNC+ +KV+CD         P C  C   G  C++
Sbjct: 9  KTCTNCQRKKVRCDRKV------PACTACSERGYNCIY 40

>Suva_11.299 Chr11 (546739..549408) [2670 bp, 889 aa] {ON} YKR064W
          (REAL)
          Length = 889

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 21/41 (51%), Gaps = 9/41 (21%)

Query: 26 ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKT--CVFLT 64
           CTNCK RK KC+          PC  C R G T  CV+LT
Sbjct: 43 VCTNCKKRKSKCN-------RTKPCGTCIRLGDTESCVYLT 76

>TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}
          Anc_4.344 YML076C
          Length = 945

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 19/44 (43%)

Query: 19 KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          K KR   AC  C   K KC    L N    PC RC +  + C F
Sbjct: 34 KRKRNTVACITCHSSKQKCVPSDLNNIFWKPCIRCLKSKRQCTF 77

>NCAS0C05100 Chr3 complement(1038084..1041143) [3060 bp, 1019 aa]
           {ON} Anc_2.651
          Length = 1019

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 101/237 (42%), Gaps = 39/237 (16%)

Query: 46  HDPPCARCRREGKTCVFLTTKGRKADLGTSKIPSTTPTLKPNSGNSVSKKRLDSSTDLVN 105
           ++P C  CR++G  C  +   G+  +  T++I        PNS  S  ++R+D++     
Sbjct: 147 NEPVCNYCRQKGTKCFMIPNLGKCIECETNRI----QCFFPNSVKSNKRERVDNNNLQTQ 202

Query: 106 EVPVKIPKTSPSNPI--SPTKWKIGLTSMQNSLEFLAKAAGNVGFLSAPSAHSAREELNS 163
             P KI + S  N    SP  +        N+   ++ +A N   L  P+A +    +N 
Sbjct: 203 NGPKKIKQESVVNNGNNSPNHYYSDFLQTLNNT--ISTSASN---LPMPNA-NLNMNINM 256

Query: 164 AVVPKA---TSLPQEESLMNM------TSSLHSDLLNISPIGKLQHKSLPLIDKLNIVRP 214
            + P A       Q E++ +        SS +    ++  I  + H  L  ID++ + + 
Sbjct: 257 GMNPSAQYNQVQTQPENVQSQLPVQYPRSSFYVGPTSVYDINLINHVKLDNIDQIQLSKS 316

Query: 215 TPRRKL-TDIDYI---GPNRLL-----SESDAIE---------LIDLFFLTMFPFFP 253
              RK+ TD+ +I     NR L      E D +E         LI++FF  + P+FP
Sbjct: 317 LALRKVATDVQFILRDDLNRELYLKQEQEVDVVETLIYPHGKLLIEIFFSLVHPYFP 373

>Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C
          (PIP2) - activator of peroxisome proliferation [contig
          46] FULL
          Length = 838

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 8/49 (16%)

Query: 16 PNYKWKRGYKA--CTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          P +K  R  ++  C NCK RK+KCD         P C RC +    CV+
Sbjct: 17 PEFKKSRMRQSFVCRNCKKRKIKCDKA------RPSCGRCSKLELECVY 59

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
          weakly similar to uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 922

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 7/60 (11%)

Query: 26 ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIPSTTPTLK 85
           C  C+ RK+KCD         P C +C  +G TCV+   + + A   +SK+  T   L+
Sbjct: 24 VCLECRRRKIKCD------KQRPCCIQCAEQGLTCVY-DIERQPAPRKSSKVSETIELLQ 76

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa]
          {ON} 
          Length = 1136

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 6/37 (16%)

Query: 26 ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
           C NC+  K+KCD         P C RC ++G  CV+
Sbjct: 49 VCQNCRKSKMKCDR------EKPECTRCLKQGIKCVY 79

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa]
          {ON} YGL013C (REAL)
          Length = 1080

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 7/43 (16%)

Query: 25 KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKG 67
          KAC NC+ RK+KC+ G        PCA C      C F + +G
Sbjct: 41 KACDNCRKRKIKCN-GKF------PCASCEIYSCECTFTSRQG 76

>TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879
          YML099C
          Length = 835

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 6/39 (15%)

Query: 22 RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
          + +  C  C+ RKVKCD+        P C RC + G  C
Sbjct: 23 KTFTGCWTCRSRKVKCDL------QRPNCGRCEKSGLDC 55

>KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa]
          {ON} similar to uniprot|P47988 Saccharomyces cerevisiae
          YOR337W TEA1 Mutants are defective in Ty1 Enhancer-
          mediated Activation Ty1 enhancer activator and to
          YLR098C uniprot|P43634 Saccharomyces cerevisiae YLR098C
          CHA4 Zinc- finger protein with Zn[2]-Cys[6] fungal-type
          binuclear cluster domain; DNA-binding transcriptional
          activator or CHA1
          Length = 727

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 7/35 (20%)

Query: 26 ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
          AC NC+ R+ KCD+       + PC RC+  G  C
Sbjct: 40 ACANCRRRRKKCDL-------EYPCGRCQELGLGC 67

>CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some
          similarities with uniprot|Q12180 Saccharomyces
          cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
          cerevisiae YBR150c TBS1
          Length = 1049

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 7/54 (12%)

Query: 9  EVLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          E+LQ+    YK +R  KAC +C+ RK++CD     NP    C+ C +    C F
Sbjct: 27 ELLQQH---YK-RRSTKACDHCRKRKIRCDEV---NPVTNKCSNCVKFKVECTF 73

>NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {ON}
           Anc_4.113
          Length = 1043

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 31/68 (45%), Gaps = 9/68 (13%)

Query: 25  KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIPSTTPTL 84
           KAC NC+ RK+KC           PCA C      C++ +T+ RK     +      P +
Sbjct: 46  KACDNCRKRKIKCT-------GKQPCATCEAYQCPCIY-STQKRKTSKRNNTAKMEQPEI 97

Query: 85  KPNSGNSV 92
            PN  NSV
Sbjct: 98  -PNGPNSV 104

>Ecym_5044 Chr5 complement(91778..94489) [2712 bp, 903 aa] {ON}
          similar to Ashbya gossypii ADR375W
          Length = 903

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 9/62 (14%)

Query: 26 ACTNCKLRKVKCDMGPLENPHDPPCARCRREG--KTCV--FLTTKGRKADLGTSKIPSTT 81
          AC  C+  K+KC    + N + PPC+ C+ +G  + CV  F  TK RK  +  S+  +  
Sbjct: 6  ACARCRGHKIKC----VHN-NQPPCSYCQHKGIAEKCVLSFPPTKKRKKAVSYSQDATAF 60

Query: 82 PT 83
          PT
Sbjct: 61 PT 62

>CAGL0M05907g Chr13 (622029..624704) [2676 bp, 891 aa] {ON} similar
           to uniprot|P36023 Saccharomyces cerevisiae YKR064w
          Length = 891

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 18/112 (16%)

Query: 21  KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREG--KTCVFLTTK--GRKADLGTSK 76
           +R    C NC+ RK KCD          PC++C + G   TC +L     G+K ++  ++
Sbjct: 12  RRPMLVCVNCRKRKSKCD-------RQLPCSKCIQHGDTDTCTYLNDVPIGKKNNVPNTQ 64

Query: 77  IP--STTPTLKPN---SGNSVSKKRLDSSTD-LVNEVPVKI-PKTSPSNPIS 121
           +   S++P++  N   +GN    K L+   + L+ E+   I  + SP  P S
Sbjct: 65  VTPNSSSPSIVINLHQNGNDYKTKNLNGQDNTLLKEINNNIWGRNSPIFPDS 116

>ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 1066

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 4/41 (9%)

Query: 22 RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          +  +AC  C+ RK++CD     +     C  CR+ G++C F
Sbjct: 63 KASRACDQCRKRKIRCDY----DDDKGVCTSCRKNGESCAF 99

>NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa]
          {ON} Anc_6.279 YPL248C
          Length = 1033

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 6/38 (15%)

Query: 25 KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          +AC NC+L+K+KC        H P C +C +    C++
Sbjct: 9  QACDNCRLKKLKCSK------HFPKCGQCLKNNWPCIY 40

>YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}
          ARG81Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type, involved in
          the regulation of arginine-responsive genes; acts with
          Arg80p and Arg82p
          Length = 880

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 32/78 (41%), Gaps = 11/78 (14%)

Query: 22 RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGR-----KADLGTSK 76
          + +  C  C+ RKVKCD   L +PH   C RC +    C     K R     + D     
Sbjct: 16 KTFTGCWTCRGRKVKCD---LRHPH---CQRCEKSNLPCGGYDIKLRWSKPMQFDPYGVP 69

Query: 77 IPSTTPTLKPNSGNSVSK 94
          IP  +P    N   SV +
Sbjct: 70 IPQNSPATTTNLSGSVDE 87

>Kpol_1018.92 s1018 (244116..247298) [3183 bp, 1060 aa] {ON}
           (244116..247298) [3183 nt, 1061 aa]
          Length = 1060

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 22  RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
           R   +CT+C+  K+KC+    +N  D PC+RC R G  C
Sbjct: 76  RPVTSCTHCRQHKIKCNAS--DNFPD-PCSRCDRMGLNC 111

>NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879
          Length = 839

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 6/51 (11%)

Query: 22 RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADL 72
          + +  C  C+ RKVKCD+        P C RC + G  C     K R + L
Sbjct: 16 KTFTGCWTCRSRKVKCDL------RRPGCVRCDKSGLECGGYDIKLRWSKL 60

>Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {ON}
           YOL089C (REAL)
          Length = 1032

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query: 21  KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
           KR  KAC +C+ RK++CD     +P    C+ C +    C F
Sbjct: 130 KRVSKACDHCRKRKIRCDEV---DPQTDKCSNCVKFQSVCTF 168

>NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON}
          Anc_7.512 YLR451W
          Length = 809

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 8/53 (15%)

Query: 11 LQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDP-PCARCRREGKTCVF 62
          L+K  P    +R Y AC  C+ +K KCD     N   P PC++C R+G  C+ 
Sbjct: 6  LKKEIP--MGRRKY-ACVECRQQKSKCDA----NDKAPNPCSKCARKGVPCIL 51

>KLLA0B04620g Chr2 complement(413129..415888) [2760 bp, 919 aa]
          {ON} similar to uniprot|Q03631 Saccharomyces cerevisiae
          YML076C WAR1 zinc finger transcription factor
          Length = 919

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 22/50 (44%), Gaps = 12/50 (24%)

Query: 19 KWKRGYKACTNCKLRKVKCDMGPLENPHDP------PCARCRREGKTCVF 62
          K KR   AC +C   K KC      NP DP      PC RC +  K C F
Sbjct: 56 KVKRSTFACISCHSMKQKC------NPTDPTDIYRHPCIRCAKLNKICQF 99

>CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa]
          {ON} weakly similar to uniprot|P39961 Saccharomyces
          cerevisiae YER184c
          Length = 835

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 7/52 (13%)

Query: 11 LQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          L K+A      R  +AC  C+ RKVKCD        D PC+ C      C++
Sbjct: 5  LAKKAKLAGKDRVIRACDVCRKRKVKCD-------GDQPCSSCMTASTVCIY 49

>ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} similar
          to gnl|GLV|KLLA0A04169g Kluyveromyces lactis
          KLLA0A04169g and some similarites with YDR213W
          uniprot|Q12151 Saccharomyces cerevisiae YDR213W UPC2
          involved in sterol uptake zinc finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 793

 Score = 36.6 bits (83), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 9/57 (15%)

Query: 13 KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRK 69
          KR  + K K G   C NCK R+VKCD G       P C +C      CV+   + +K
Sbjct: 36 KRKFHNKSKNG---CDNCKRRRVKCDEG------KPLCRKCVNMKLDCVYTPAQPKK 83

>Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig
          274] FULL
          Length = 628

 Score = 36.6 bits (83), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 7/58 (12%)

Query: 14 RAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKAD 71
          + P  K  R    C  C++RK+KC      N   P C+RC +    CV+ T   R+ D
Sbjct: 2  QTPKSKKNRISHVCDACRIRKLKC------NKQKPSCSRCVKHDLQCVY-TPYRREGD 52

>KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1030

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 8/48 (16%)

Query: 25 KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADL 72
          +AC NC+ RK+KC        H  PCA C   G  C+F + +G+  ++
Sbjct: 33 RACNNCRKRKIKC-----TGLH--PCASCEAYGCPCIF-SPRGKGGNI 72

>KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON}
          Anc_7.512 YLR451W
          Length = 869

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 3/43 (6%)

Query: 20 WKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          ++R   AC  C+ +K +CD          PC +C+++G TCV 
Sbjct: 41 YRRKKFACVECRQQKSRCDAS---EKAPGPCTKCKQKGVTCVL 80

>TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON}
          Anc_7.512 YLR451W
          Length = 923

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 3/41 (7%)

Query: 22 RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVF 62
          R   AC  C+ +K KCD     +    PC RC + G TCV 
Sbjct: 33 RKKVACVECRQQKSKCDA---YDRAPEPCTRCMKRGLTCVL 70

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
           Anc_7.17 YAL051W
          Length = 944

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 73/196 (37%), Gaps = 36/196 (18%)

Query: 21  KRGYK---ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKG---------- 67
           K+ Y+    C  C+  KVKCD         P C+RC +    CV+  TK           
Sbjct: 31  KKRYRLSFVCQGCRRSKVKCDQ------EKPVCSRCSKHDLECVYDVTKQHAPRNPNKAA 84

Query: 68  ------RKADLGTSKIPSTTPTLKPNS-GNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPI 120
                 R+ +    K+ S T    P S GN+ + K  D   +L    P  I  +     +
Sbjct: 85  TMARLRREVEYWKKKVASLTEENAPISNGNNENDKFWDLKVNLYKTYPRLIISSVLKREV 144

Query: 121 SPTKWKIGLTSMQNSLEFLAKAAGNVGFLSAPSAHSAREELNSAVVPKATSLPQEESLMN 180
           +P      +   +    FL   A ++ F++AP     +  L SA+V           L +
Sbjct: 145 TPLSENYLIIHDR----FLCTLASSI-FINAP-----KNSLVSALVTDVNVNKSHPHLRD 194

Query: 181 MTSSLHSDLLNISPIG 196
           +T  +   L N  P G
Sbjct: 195 VTLKMKETLKNRHPDG 210

>Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}
          YML099C (REAL)
          Length = 880

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 32/78 (41%), Gaps = 11/78 (14%)

Query: 22 RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGR-----KADLGTSK 76
          + +  C  C+ RKVKCD   L +PH   C RC +    C     K R     + D     
Sbjct: 16 KTFTGCWTCRGRKVKCD---LRHPH---CQRCEKSNLPCGGYDIKLRWSKPMQFDPYGVP 69

Query: 77 IPSTTPTLKPNSGNSVSK 94
          IP  +P    N   SV +
Sbjct: 70 IPQNSPATTTNLTGSVDE 87

>ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR034C (LYS14)
          Length = 800

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 8/45 (17%)

Query: 21  KRGY--KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFL 63
           KR Y    CT CK R++KCD G       P C +C R  + C ++
Sbjct: 189 KRKYSRNGCTECKRRRMKCDEG------KPICWQCSRLNRECKYI 227

>Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W
          (REAL)
          Length = 1045

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 25/60 (41%), Gaps = 10/60 (16%)

Query: 7  ENEVLQKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTK 66
          EN  +Q R  N    R    C  C+  K KCD         P C RC + G  CV+  +K
Sbjct: 50 ENSEMQNRKRN----RISFVCQACRKSKTKCDR------EKPECGRCTKHGLKCVYDVSK 99

>Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C
           (PPR1) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 246]
           FULL
          Length = 881

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 41/99 (41%), Gaps = 15/99 (15%)

Query: 22  RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSK-IPST 80
           R   AC  C++RKVKCD         P C+RC    + CV +       D  T + +P +
Sbjct: 44  RSIAACKRCRIRKVKCDQ------KFPSCSRCVSANEPCVSI-------DPATGRDVPRS 90

Query: 81  TPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNP 119
                 +   ++ K+  +   D   EV   IP TS   P
Sbjct: 91  YVIFLEDRLEALMKRLQECGVD-PTEVQGNIPATSHDRP 128

>Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 aa]
           {ON} YKL015W (REAL)
          Length = 985

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 43/120 (35%), Gaps = 24/120 (20%)

Query: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIP 78
           K  R   AC +C+ R +KC       P   PC +C      C +L    +K  + T  + 
Sbjct: 26  KQPRSAVACLSCRKRHIKC-------PGGNPCQKCITSNAICEYL-EPSKKIVVSTKYLQ 77

Query: 79  STTPTL----------------KPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPISP 122
                L                K NSGN  S     S+ +L NE P+       S P +P
Sbjct: 78  QLQNDLNDKTRENSRLRALLLEKTNSGNGDSHSHSQSTDELPNEPPISGQLKVSSAPPAP 137

>Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}
          similar to Ashbya gossypii AFR096W
          Length = 952

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 6/40 (15%)

Query: 21 KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
          KR  +AC  C+L+K+KCD         P C  C++ G  C
Sbjct: 24 KRSSQACDRCRLKKIKCD------GVRPSCTSCKKIGYQC 57

>KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17
          YOR363C
          Length = 948

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 8/53 (15%)

Query: 14 RAPNYKWKRGY--KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLT 64
          +AP+ K KR      C  C+  K KCD         P C RC + G  CV+ T
Sbjct: 14 KAPSQKRKRNRLSYVCKACRTAKAKCD------KEKPQCGRCYKLGVECVYDT 60

>NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423
          Length = 949

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 9/58 (15%)

Query: 13  KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKA 70
           KR  + K K G   C NCK R+VKCD      PH   C +C      CV+   + R++
Sbjct: 53  KRKFHNKSKNG---CDNCKRRRVKCDE---SKPH---CQKCVNMQLHCVYTPPQPRRS 101

>TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa]
           {ON} Anc_1.277 YJL089W
          Length = 757

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 6/40 (15%)

Query: 21  KRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
           +R  +AC  C+L+K+KCD G +     P C  CR+    C
Sbjct: 95  RRHSQACDRCRLKKIKCD-GLI-----PHCTNCRKINFNC 128

>KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly
          similar to uniprot|P52960 Saccharomyces cerevisiae
          YOR363C PIP2 peroxisome induction pathway 2 (PIP2)
          transcriptional activator of peroxisome proliferation
          may form heterodimer with Oaf1 to activate
          oleate-inducible gene expression activator of
          peroxisome proliferation
          Length = 847

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 6/35 (17%)

Query: 26 ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
           C NC+ RK+KCD         P C RC + G  C
Sbjct: 31 VCRNCRKRKIKCDKA------QPKCGRCAKLGLEC 59

>NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa]
           {ON} Anc_3.264
          Length = 759

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 8/45 (17%)

Query: 21  KRGY--KACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFL 63
           KR Y    CT CK R++KCD         P C +C R  + CV++
Sbjct: 123 KRKYSRNGCTECKRRRMKCDET------KPICWQCARLNRECVYI 161

>Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W
           (REAL)
          Length = 971

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 40/102 (39%), Gaps = 12/102 (11%)

Query: 26  ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIP-----ST 80
           AC NC+ RK+KC        H  PC  C     TCVFL          T  +P     + 
Sbjct: 14  ACINCRKRKIKC-----TGKH--PCTNCISYNCTCVFLRKYLSLDGDTTQPLPAAAAAAV 66

Query: 81  TPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPISP 122
             +  P++  S      D++  L N+   ++       P+SP
Sbjct: 67  VSSSNPDTDTSAGAHHRDTTIKLDNQDYFELINEPIQTPVSP 108

>Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337W
          (REAL)
          Length = 759

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 7/35 (20%)

Query: 26 ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
          ACTNC+ R+ KCD+G        PC  C R    C
Sbjct: 69 ACTNCRNRRKKCDLG-------FPCGNCSRLELVC 96

>KLLA0E20307g Chr5 (1806005..1809364) [3360 bp, 1119 aa] {ON}
           uniprot|P87164 Kluyveromyces lactis SEF1 Suppressor
           protein SEF1
          Length = 1119

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 35/90 (38%), Gaps = 26/90 (28%)

Query: 22  RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIPSTT 81
           R   +CT+C+  K+KC+          PC+RC R G  C                     
Sbjct: 113 RPVTSCTHCRQHKIKCNAS---EKFPAPCSRCERMGLHC------------------EID 151

Query: 82  PTLKPNSGNSVSKKRLDSSTDLVNEVPVKI 111
           P  +P  G+ +   R D     V+E+ VKI
Sbjct: 152 PQFRPKKGSQLQSLRND-----VDELKVKI 176

>Skud_11.300 Chr11 (544149..546746) [2598 bp, 865 aa] {ON} YKR064W
          (REAL)
          Length = 865

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 9/50 (18%)

Query: 26 ACTNCKLRKVKCDMGPLENPHDPPCARCRREG--KTCVFLTTKGRKADLG 73
           CTNCK RK KCD          PC  C R G   +CV+L+ +  + + G
Sbjct: 18 VCTNCKKRKSKCD-------RIKPCGTCVRLGDMDSCVYLSDRLGQRETG 60

>Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W
          (REAL)
          Length = 759

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 7/35 (20%)

Query: 26 ACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTC 60
          ACTNC+ R+ KCD+G        PC  C R    C
Sbjct: 69 ACTNCRNRRKKCDLG-------FPCGNCSRLELVC 96

>SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON}
          similar to uniprot|P07272 Saccharomyces cerevisiae
          YLR014C PPR1 Zinc finger transcription factor
          containing a Zn(2)-Cys(6) binuclear cluster domain
          positively regulates transcription of genes involved in
          uracil biosynthesis activity may be modulated by
          interaction with Tup1p
          Length = 906

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 6/42 (14%)

Query: 22 RGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFL 63
          R   AC  C+L+KVKCD         P C++C    + CV L
Sbjct: 38 RSIAACKRCRLKKVKCDQ------KFPSCSKCASANEPCVSL 73

>YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol
          regulatory element binding protein, induces
          transcription of sterol biosynthetic genes and of
          DAN/TIR gene products; Ecm22p homolog; relocates from
          intracellular membranes to perinuclear foci on sterol
          depletion
          Length = 913

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 27/61 (44%), Gaps = 12/61 (19%)

Query: 13 KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTT---KGRK 69
          KR  + K K G   C NCK R+VKCD G       P C +C      C +      KGR 
Sbjct: 40 KRKFHNKSKNG---CDNCKRRRVKCDEG------KPACRKCTNMKLECQYTPIHLRKGRG 90

Query: 70 A 70
          A
Sbjct: 91 A 91

>ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} similar
          to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
          Zinc finger transcription factor containing a
          Zn(2)-Cys(6) binuclear cluster domain positively
          regulates transcription of genes involved in uracil
          biosynthesis activity may be modulated by interaction
          with Tup1p
          Length = 855

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 10/60 (16%)

Query: 7  ENEVLQKRAPNY--KWKRGYKACTNCKLRKVKCDMGPLENPHD-PPCARCRREGKTCVFL 63
          E EV +KR  +      +   AC  C+ +K+KCD       H+ P C +C R  K CV L
Sbjct: 11 EEEVSRKRPSSVVVGITKSISACKRCRTKKIKCD-------HEFPSCKKCARANKPCVSL 63

>KAFR0B06340 Chr2 (1311310..1313904) [2595 bp, 864 aa] {ON}
          Anc_8.423 YLR228C
          Length = 864

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 9/52 (17%)

Query: 13 KRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLT 64
          KR  + K K G   C NCK R+VKCD         P C +C      CV++T
Sbjct: 44 KRKFHNKSKTG---CLNCKRRRVKCD------ETKPFCIKCTNMKLDCVYVT 86

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 99,013,882
Number of extensions: 4462973
Number of successful extensions: 18585
Number of sequences better than 10.0: 563
Number of HSP's gapped: 19064
Number of HSP's successfully gapped: 578
Length of query: 909
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 790
Effective length of database: 39,836,145
Effective search space: 31470554550
Effective search space used: 31470554550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)