Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0H014002.533ON54154123630.0
NCAS0F009002.533ON5251514052e-42
KNAG0C058102.533ON5541413571e-35
Smik_13.2492.533ON4731413283e-32
YMR070W (MOT3)2.533ON4901463293e-32
KAFR0A018602.533ON4901373293e-32
CAGL0K03003g2.533ON6471413316e-32
Skud_13.2262.533ON4751473241e-31
NDAI0K018602.533ON7301413202e-30
ZYRO0B02002g2.533ON2941473043e-30
TDEL0A030702.533ON2391482994e-30
Kpol_1018.332.533ON5891473102e-29
KLLA0E18547g2.533ON4311423001e-28
NCAS0A048002.533ON5111412994e-28
TBLA0G022302.533ON2161432825e-28
Suva_13.2462.533ON419662911e-27
Kwal_26.80212.533ON5071462923e-27
TPHA0G035102.533ON3871382848e-27
SAKL0A09482g2.533ON3881402848e-27
KLTH0D06842g2.533ON5061552888e-27
Ecym_72552.533ON5441492792e-25
AGL071C2.533ON3961382548e-23
TBLA0I014802.533ON513662435e-21
KAFR0J003402.533ON218672219e-20
KNAG0A070402.533ON3521391987e-16
TPHA0C041902.533ON417521936e-15
NCAS0A129102.598ON822571634e-11
Kpol_185.32.598ON647561573e-10
NDAI0C005602.598ON972571512e-09
ZYRO0F01012g2.598ON584601492e-09
Skud_13.1932.598ON704561474e-09
TPHA0C025802.598ON365501454e-09
YKL062W (MSN4)2.598ON630501465e-09
Smik_11.1862.598ON641501465e-09
NCAS0H030802.598ON730591456e-09
Skud_11.1672.598ON628501449e-09
Suva_13.2062.598ON709561441e-08
KLLA0F26961g2.598ON694681421e-08
TBLA0G019202.598ON523541411e-08
YMR037C (MSN2)2.598ON704561421e-08
CAGL0L06072g8.144ON300651382e-08
Smik_13.2072.598ON703561412e-08
SAKL0B11330g2.598ON499541402e-08
TBLA0H028302.598ON746501412e-08
KNAG0G012808.144ON472561393e-08
TDEL0B069102.598ON437561393e-08
Suva_11.1642.598ON639501393e-08
KAFR0F020702.598ON370561373e-08
Ecym_23012.598ON767571394e-08
TPHA0N014602.598ON519521375e-08
Kwal_26.83512.598ON698541385e-08
KNAG0H005502.598ON620551375e-08
ABR089C2.598ON571541376e-08
KAFR0A023202.598ON443611341e-07
Kpol_1013.212.598ON494501331e-07
NDAI0B013402.598ON769541342e-07
KNAG0M023102.598ON660611332e-07
CAGL0M13189g2.598ON541501322e-07
KLTH0D08734g2.598ON677501322e-07
NCAS0B046008.144ON547531286e-07
SAKL0H24816g8.144ON410531277e-07
CAGL0F05995g2.598ON597501278e-07
SAKL0H12958g8.425ON1129611281e-06
KAFR0B025508.234ON890541271e-06
KLLA0C17072g8.144ON474531251e-06
Kpol_1052.83.298ON386581251e-06
TPHA0A019408.234ON912541261e-06
TPHA0B003804.351ON1310531252e-06
TBLA0F038308.234ON967681252e-06
TBLA0E047704.351ON1655531252e-06
KLTH0E06688g8.144ON397531232e-06
Suva_2.3838.425ON1319581252e-06
YDR216W (ADR1)8.425ON1323581252e-06
ACL057W8.144ON520501242e-06
KLLA0F13046g8.425ON1379551252e-06
Smik_4.4638.425ON1324581242e-06
Skud_4.4788.425ON1323581243e-06
CAGL0K02145g8.144ON317531213e-06
Kpol_1001.14.351ON1341531243e-06
Ecym_84038.144ON573501233e-06
TPHA0D010508.144ON439531223e-06
KNAG0D021208.144ON402531214e-06
Kwal_47.172418.144ON403531214e-06
YDR096W (GIS1)8.234ON894541224e-06
KAFR0A023808.234ON900581224e-06
Smik_4.3378.234ON894541224e-06
Smik_5.2768.144ON442531214e-06
KNAG0G018708.234ON875541224e-06
Kpol_1032.528.234ON824541224e-06
TBLA0B061604.351ON1384591234e-06
Suva_2.2558.234ON894541224e-06
Skud_4.3548.234ON916541224e-06
TBLA0G032403.298ON511541214e-06
NDAI0G034208.144ON484641215e-06
YER169W (RPH1)8.234ON796541215e-06
Skud_5.3088.234ON802541215e-06
Skud_5.2488.144ON442531206e-06
Smik_5.3418.234ON798541206e-06
Suva_5.3038.234ON797541206e-06
ZYRO0B11770g8.234ON867541207e-06
NDAI0C048608.425ON1350581207e-06
SAKL0F01980g3.518ON385581188e-06
YER130C8.144ON443531198e-06
NCAS0B028408.425ON1152551208e-06
TBLA0I032803.518ON330611179e-06
CAGL0E04884g8.425ON1489551209e-06
Kpol_529.138.425ON1410551199e-06
NCAS0C040708.144ON289711169e-06
Suva_5.2518.144ON449531189e-06
ZYRO0G19140g8.144ON557531189e-06
KAFR0B068104.351ON1155471191e-05
TDEL0B046708.144ON312531171e-05
TDEL0A013008.234ON837541181e-05
AER159C4.351ON1191631181e-05
CAGL0M01870g3.298ON315561161e-05
Kwal_26.80112.531ON190511121e-05
CAGL0L11880g8.234ON980541181e-05
NDAI0B019308.144ON436531171e-05
TBLA0H006608.425ON1311521181e-05
TPHA0C021608.425ON1375521181e-05
NCAS0A062504.351ON1341611181e-05
SAKL0G18062g4.351ON1238521181e-05
KAFR0B063608.425ON627591171e-05
KNAG0A044608.425ON1290631181e-05
KAFR0B021608.144ON453571162e-05
Suva_13.704.351ON777521172e-05
ZYRO0A09416g8.425ON1346551172e-05
KLLA0C17710g8.234ON821611172e-05
TBLA0F003708.144ON687571162e-05
Kwal_47.166214.351ON1178521162e-05
KLTH0D18062g4.351ON1128521162e-05
CAGL0K12078g3.281ON463581152e-05
TDEL0D006704.351ON1199471162e-05
TPHA0A039103.298ON351571142e-05
AGR117C8.234ON799581162e-05
Ecym_35208.234ON819581162e-05
NDAI0B022508.234ON1156541162e-05
Suva_2.2003.281ON232601122e-05
KAFR0C029808.144ON225561113e-05
KLLA0B04477g4.351ON1332521153e-05
KNAG0B067104.351ON1053541153e-05
KNAG0M003504.351ON1076681153e-05
KNAG0B005903.518ON439621143e-05
KNAG0H011803.281ON254671113e-05
CAGL0H04213g4.351ON1321511153e-05
AGR172W8.425ON1057601153e-05
Kpol_1031.428.144ON359501133e-05
ADR308Cna 1ON278591113e-05
Kpol_1052.183.281ON357561124e-05
KLLA0E08713g2.303ON596501144e-05
KNAG0H030108.234ON784581144e-05
NDAI0C06260na 2ON582641134e-05
TBLA0B060502.303ON762501144e-05
Smik_13.584.351ON1253471144e-05
TDEL0F055008.425ON1207551144e-05
YDR043C (NRG1)3.281ON231601104e-05
Ecym_54242.162ON775621134e-05
NDAI0A075403.298ON370561125e-05
ZYRO0B14894g4.351ON1119471135e-05
Skud_4.2973.281ON231601095e-05
SAKL0H17842g8.234ON814541135e-05
KLLA0F18524g3.281ON357651115e-05
KAFR0C003403.298ON394521125e-05
NCAS0B048408.234ON864541135e-05
Kwal_56.234538.234ON828541135e-05
Skud_13.614.351ON1253471135e-05
Suva_7.523.518ON400581115e-05
YML081W (TDA9)4.351ON1251471135e-05
YGL209W (MIG2)3.518ON382581115e-05
KLTH0G14454g8.234ON832541135e-05
CAGL0E04312g5.586ON688711125e-05
Kpol_1065.153.281ON220511086e-05
ACR264W2.162ON769541118e-05
Smik_7.543.518ON382581109e-05
NDAI0D032404.351ON1362521119e-05
Kpol_423.153.518ON392571109e-05
NDAI0J028504.351ON1537521119e-05
Skud_7.593.518ON383571099e-05
Skud_10.3514.351ON1327521111e-04
Smik_6.4356.256ON386571091e-04
KLLA0F20636gsingletonON285611081e-04
Smik_4.2813.281ON231601061e-04
Kpol_1050.116singletonON329621081e-04
Suva_12.2184.351ON1270521101e-04
YPL230W (USV1)6.256ON391571091e-04
NDAI0B060203.518ON426571091e-04
TPHA0G008202.303ON532501091e-04
TBLA0E04210singletonON454521091e-04
Smik_10.4204.351ON1348521101e-04
CAGL0M00594g4.351ON1020521091e-04
YJR127C (RSF2)4.351ON1380521091e-04
TDEL0F026904.80ON350501071e-04
TBLA0E042208.234ON519591081e-04
Ecym_8011na 1ON276501061e-04
KLTH0E09922g8.425ON1119551092e-04
TBLA0B012802.162ON823601092e-04
KAFR0F012106.256ON311651072e-04
SAKL0E10714g2.162ON819541082e-04
Suva_16.766.256ON392471072e-04
KLTH0G01826g3.518ON307631062e-04
KNAG0I020702.162ON572661072e-04
SAKL0D03146g3.281ON157551012e-04
KAFR0H032402.303ON519521072e-04
CAGL0A01628g4.80ON424611062e-04
KLTH0G10802g2.303ON526501072e-04
Skud_16.486.256ON398471062e-04
KAFR0F041503.518ON416571063e-04
ZYRO0E08426g3.518ON171571013e-04
KLLA0F23782g2.162ON782621063e-04
Kwal_27.109253.281ON264551043e-04
NDAI0D037504.80ON493501063e-04
SAKL0E07216g2.303ON548501063e-04
SAKL0H20988g4.80ON548521053e-04
Kwal_47.190453.518ON266511033e-04
KNAG0H019302.303ON618501054e-04
NCAS0G012706.256ON274471034e-04
NDAI0I029003.518ON524571054e-04
NCAS0E006103.518ON401571044e-04
KAFR0E042704.351ON1255521054e-04
Kpol_1065.483.298ON364521044e-04
KAFR0C057105.586ON442751045e-04
NDAI0C006905.586ON650681055e-04
Kpol_1072.582.162ON794551055e-04
TPHA0D034003.518ON338521035e-04
Kpol_541.398.116ON291501025e-04
Kwal_27.114602.303ON531501045e-04
NCAS0H028905.586ON532641046e-04
KAFR0C004903.281ON224491006e-04
Kpol_1023.1004.351ON916501046e-04
NCAS0F009202.531ON354511026e-04
NDAI0B042902.162ON1064521046e-04
CAGL0L05786g8.116ON348511027e-04
ADL198W2.303ON547501037e-04
AGL207W3.298ON277541017e-04
KAFR0B045802.162ON729481037e-04
Kwal_47.178882.162ON786591037e-04
NDAI0A056503.281ON330601018e-04
Ecym_26543.281ON257551008e-04
Ecym_8379na 3ON305571018e-04
KAFR0H012903.298ON330601018e-04
KAFR0I023703.518ON391571028e-04
SAKL0G06292g5.586ON517741028e-04
NCAS0I014603.298ON330591018e-04
Ecym_33412.303ON560501028e-04
NCAS0G037302.303ON571531029e-04
KNAG0E016003.518ON338591019e-04
KLTH0E09724g2.162ON768591020.001
CAGL0K06413g5.586ON359681010.001
KNAG0H034802.162ON796471020.001
KLTH0H09196g4.80ON460521010.001
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0H01400
         (541 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...   914   0.0  
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...   160   2e-42
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...   142   1e-35
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...   130   3e-32
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...   131   3e-32
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...   131   3e-32
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...   132   6e-32
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...   129   1e-31
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...   127   2e-30
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...   121   3e-30
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...   119   4e-30
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...   124   2e-29
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...   120   1e-28
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...   119   4e-28
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...   113   5e-28
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...   116   1e-27
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...   117   3e-27
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...   114   8e-27
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...   114   8e-27
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...   115   8e-27
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...   112   2e-25
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...   102   8e-23
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...    98   5e-21
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       90   9e-20
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    81   7e-16
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    79   6e-15
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    67   4e-11
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    65   3e-10
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     63   2e-09
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    62   2e-09
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    61   4e-09
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    60   4e-09
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    61   5e-09
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    61   5e-09
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    60   6e-09
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    60   9e-09
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    60   1e-08
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    59   1e-08
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    59   1e-08
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    59   1e-08
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    58   2e-08
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    59   2e-08
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    59   2e-08
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    59   2e-08
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    58   3e-08
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    58   3e-08
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    58   3e-08
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    57   3e-08
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    58   4e-08
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    57   5e-08
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    58   5e-08
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    57   5e-08
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    57   6e-08
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    56   1e-07
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    56   1e-07
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     56   2e-07
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    56   2e-07
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    55   2e-07
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    55   2e-07
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    54   6e-07
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    54   7e-07
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    54   8e-07
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    54   1e-06
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    54   1e-06
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    53   1e-06
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    53   1e-06
TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {O...    53   1e-06
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    53   2e-06
TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.2...    53   2e-06
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    53   2e-06
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    52   2e-06
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    53   2e-06
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    53   2e-06
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    52   2e-06
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    53   2e-06
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    52   2e-06
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    52   3e-06
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    51   3e-06
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    52   3e-06
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    52   3e-06
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    52   3e-06
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    51   4e-06
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    51   4e-06
YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC d...    52   4e-06
KAFR0A02380 Chr1 complement(493691..496393) [2703 bp, 900 aa] {O...    52   4e-06
Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W ...    52   4e-06
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    51   4e-06
KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.2...    52   4e-06
Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON} (1181...    52   4e-06
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    52   4e-06
Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W ...    52   4e-06
Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W ...    52   4e-06
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     51   4e-06
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    51   5e-06
YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC d...    51   5e-06
Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W ...    51   5e-06
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    51   6e-06
Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W ...    51   6e-06
Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa...    51   6e-06
ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} simila...    51   7e-06
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    51   7e-06
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    50   8e-06
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    50   8e-06
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    51   8e-06
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    50   9e-06
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    51   9e-06
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    50   9e-06
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      49   9e-06
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    50   9e-06
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    50   9e-06
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    50   1e-05
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    50   1e-05
TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {O...    50   1e-05
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    50   1e-05
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    49   1e-05
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    48   1e-05
CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} som...    50   1e-05
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     50   1e-05
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    50   1e-05
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    50   1e-05
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    50   1e-05
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    50   1e-05
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    50   1e-05
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    50   1e-05
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    49   2e-05
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    50   2e-05
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    50   2e-05
KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} simi...    50   2e-05
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    49   2e-05
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    49   2e-05
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    49   2e-05
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    49   2e-05
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    49   2e-05
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    49   2e-05
AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON} S...    49   2e-05
Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}...    49   2e-05
NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8....    49   2e-05
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    48   2e-05
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    47   3e-05
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    49   3e-05
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    49   3e-05
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    49   3e-05
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    49   3e-05
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    47   3e-05
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    49   3e-05
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    49   3e-05
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    48   3e-05
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    47   3e-05
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    48   4e-05
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    49   4e-05
KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.2...    49   4e-05
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}             48   4e-05
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    49   4e-05
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    49   4e-05
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    49   4e-05
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    47   4e-05
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    48   4e-05
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    48   5e-05
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    48   5e-05
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    47   5e-05
SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]...    48   5e-05
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    47   5e-05
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    48   5e-05
NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234     48   5e-05
Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {...    48   5e-05
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    48   5e-05
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    47   5e-05
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    48   5e-05
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    47   5e-05
KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some...    48   5e-05
CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some s...    48   5e-05
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    46   6e-05
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    47   8e-05
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    47   9e-05
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    47   9e-05
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    47   9e-05
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    47   9e-05
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    47   9e-05
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    47   1e-04
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    47   1e-04
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    46   1e-04
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    45   1e-04
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    46   1e-04
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    47   1e-04
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    47   1e-04
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    47   1e-04
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    47   1e-04
TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON}             47   1e-04
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    47   1e-04
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    47   1e-04
YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}...    47   1e-04
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    46   1e-04
TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON} Anc_8...    46   1e-04
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    45   1e-04
KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakl...    47   2e-04
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    47   2e-04
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    46   2e-04
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    46   2e-04
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    46   2e-04
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    45   2e-04
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    46   2e-04
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    44   2e-04
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    46   2e-04
CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} simila...    45   2e-04
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    46   2e-04
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    45   2e-04
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    45   3e-04
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    44   3e-04
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    45   3e-04
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    45   3e-04
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      45   3e-04
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    45   3e-04
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    45   3e-04
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    44   3e-04
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    45   4e-04
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      44   4e-04
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    45   4e-04
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     45   4e-04
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    45   4e-04
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    45   4e-04
KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON} Anc_5...    45   5e-04
NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {O...    45   5e-04
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    45   5e-04
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    44   5e-04
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    44   5e-04
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    45   5e-04
NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {O...    45   6e-04
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    43   6e-04
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    45   6e-04
NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531     44   6e-04
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    45   6e-04
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    44   7e-04
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    44   7e-04
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    44   7e-04
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    44   7e-04
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    44   7e-04
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    44   8e-04
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    43   8e-04
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    44   8e-04
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    44   8e-04
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    44   8e-04
SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON} unipro...    44   8e-04
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    44   8e-04
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    44   8e-04
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     44   9e-04
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    44   9e-04
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    44   0.001
CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some ...    44   0.001
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    44   0.001
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    44   0.001
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    44   0.001
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    44   0.001
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    44   0.001
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     44   0.001
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    43   0.001
ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} simi...    44   0.001
KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {...    44   0.001
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    43   0.001
KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {O...    44   0.001
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    44   0.001
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    44   0.001
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    44   0.001
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    44   0.001
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    44   0.001
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               43   0.001
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    44   0.001
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    44   0.001
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    42   0.001
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    44   0.001
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    44   0.001
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    42   0.001
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    43   0.002
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    42   0.002
Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)    43   0.002
CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly...    43   0.002
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    43   0.002
Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463...    43   0.002
Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463...    43   0.002
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    42   0.002
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    42   0.002
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    42   0.002
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    43   0.002
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    42   0.002
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    43   0.002
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    43   0.002
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    42   0.002
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    43   0.002
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    42   0.002
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    42   0.002
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    42   0.002
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    42   0.002
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    42   0.002
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    42   0.002
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    42   0.002
YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}  STP1Tran...    42   0.002
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    42   0.002
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    41   0.002
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    42   0.002
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    42   0.002
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    42   0.003
Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W (...    42   0.003
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               42   0.003
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    42   0.003
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      42   0.003
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    42   0.003
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    42   0.003
Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W (...    42   0.003
KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some ...    42   0.003
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    42   0.003
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    42   0.003
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    42   0.003
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    42   0.003
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    42   0.003
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    42   0.003
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    42   0.003
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    42   0.003
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    42   0.003
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    41   0.003
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    40   0.003
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               42   0.003
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    42   0.004
KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5....    42   0.004
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    42   0.004
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    42   0.004
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    42   0.004
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    41   0.004
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    42   0.004
KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} simila...    42   0.004
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    42   0.004
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               41   0.004
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     42   0.004
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    42   0.004
NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586     42   0.005
KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...    41   0.005
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    42   0.005
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    40   0.005
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    42   0.005
Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa] ...    42   0.005
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    41   0.005
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    41   0.005
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    42   0.005
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    41   0.005
AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if...    41   0.005
TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {...    41   0.005
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    41   0.005
KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5....    40   0.005
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    41   0.006
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    42   0.006
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      40   0.006
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    41   0.006
YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}  STP2Transc...    41   0.006
TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}                40   0.006
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    41   0.006
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    41   0.006
Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}...    41   0.006
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    39   0.007
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    40   0.007
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}               41   0.007
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    41   0.007
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    40   0.007
TPHA0J00670 Chr10 complement(148901..150883) [1983 bp, 660 aa] {...    41   0.008
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                40   0.008
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    40   0.008
NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa] ...    40   0.008
YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}  ...    40   0.008
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    40   0.009
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    41   0.009
KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {...    40   0.009
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    40   0.009
TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.5...    40   0.009
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    40   0.010
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    40   0.011
AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}...    40   0.011
Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463...    40   0.011
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    40   0.011
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    40   0.012
SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...    40   0.013
TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON...    40   0.013
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    40   0.014
NCAS0D03910 Chr4 (729305..730255) [951 bp, 316 aa] {ON} Anc_6.256      40   0.014
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    40   0.014
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    40   0.014
AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}...    40   0.014
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    40   0.015
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             40   0.015
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    40   0.015
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    40   0.015
ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {O...    40   0.015
SAKL0B04664g Chr2 complement(410577..411857) [1281 bp, 426 aa] {...    40   0.016
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    40   0.016
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    39   0.017
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    40   0.017
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    40   0.017
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    40   0.017
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    40   0.018
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    40   0.018
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    40   0.019
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    38   0.019
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    39   0.020
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    39   0.021
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    39   0.022
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    39   0.022
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    39   0.022
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    39   0.022
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    39   0.022
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    39   0.023
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    39   0.025
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    39   0.025
TBLA0A00350 Chr1 complement(66653..67588) [936 bp, 311 aa] {ON} ...    39   0.025
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    38   0.025
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                39   0.025
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    39   0.026
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    39   0.028
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    39   0.029
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               39   0.029
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    39   0.030
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    39   0.031
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    38   0.033
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    39   0.034
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    39   0.034
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    38   0.036
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    39   0.036
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    39   0.037
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    39   0.038
SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar...    37   0.042
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    38   0.043
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    39   0.043
YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}  N...    38   0.044
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    39   0.046
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    37   0.047
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    38   0.048
Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON} co...    39   0.049
NCAS0B04020 Chr2 complement(726291..727118) [828 bp, 275 aa] {ON}      38   0.049
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    38   0.049
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    36   0.051
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    38   0.054
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    39   0.055
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    38   0.057
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    38   0.057
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    38   0.059
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    38   0.060
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    38   0.061
TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON...    38   0.061
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    38   0.062
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    38   0.062
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    38   0.062
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    37   0.063
TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.3...    38   0.063
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    37   0.064
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    37   0.067
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    38   0.067
Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W...    37   0.068
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    38   0.070
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    38   0.075
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    37   0.075
Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}...    37   0.090
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    37   0.091
KLTH0G17336g Chr7 (1500141..1501598) [1458 bp, 485 aa] {ON} some...    37   0.093
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    37   0.095
Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar t...    37   0.095
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    37   0.095
Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}...    37   0.099
NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326     37   0.10 
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    37   0.10 
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    37   0.11 
NDAI0J00990 Chr10 (226704..228863) [2160 bp, 719 aa] {ON} Anc_8....    37   0.12 
Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {...    37   0.12 
NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {O...    37   0.12 
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    37   0.12 
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    36   0.12 
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    36   0.12 
Skud_4.515 Chr4 complement(918500..919063) [564 bp, 187 aa] {ON}...    36   0.14 
Kpol_543.29 s543 complement(59228..60583) [1356 bp, 451 aa] {ON}...    37   0.14 
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    37   0.14 
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    37   0.14 
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    37   0.14 
Suva_2.419 Chr2 complement(743569..744144) [576 bp, 191 aa] {ON}...    36   0.15 
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    35   0.16 
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    37   0.16 
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    37   0.17 
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                36   0.17 
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    37   0.17 
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    37   0.17 
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    37   0.17 
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...    37   0.18 
NCAS0J02140 Chr10 complement(410960..415012) [4053 bp, 1350 aa] ...    37   0.18 
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    36   0.18 
KNAG0A02260 Chr1 (205510..206118) [609 bp, 202 aa] {ON} Anc_8.48...    35   0.18 
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    37   0.19 
TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.3...    36   0.19 
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    36   0.21 
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    36   0.21 
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    36   0.23 
NCAS0B04360 Chr2 (791449..792276) [828 bp, 275 aa] {ON}                36   0.23 
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    36   0.23 
Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON...    36   0.23 
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    36   0.23 
KAFR0F03940 Chr6 complement(769153..770511) [1359 bp, 452 aa] {O...    36   0.24 
NCAS0A02160 Chr1 complement(406753..407991) [1239 bp, 412 aa] {O...    36   0.24 
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    36   0.25 
YDR253C Chr4 complement(963990..964565) [576 bp, 191 aa] {ON}  M...    35   0.25 
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    36   0.26 
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    36   0.26 
CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some s...    36   0.26 
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    36   0.27 
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    36   0.27 
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                35   0.28 
ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic hom...    35   0.30 
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    35   0.30 
KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.3...    36   0.31 
Smik_4.500 Chr4 complement(908879..909460) [582 bp, 193 aa] {ON}...    35   0.32 
KLLA0D11902g Chr4 (1015273..1016142) [870 bp, 289 aa] {ON} some ...    35   0.33 
CAGL0I02838g Chr9 complement(248704..250671) [1968 bp, 655 aa] {...    36   0.34 
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    35   0.35 
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    35   0.35 
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    35   0.37 
Ecym_2536 Chr2 complement(1041642..1042364) [723 bp, 240 aa] {ON...    35   0.39 
Kwal_27.11824 s27 complement(959535..960134) [600 bp, 199 aa] {O...    35   0.39 
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    35   0.42 
TDEL0B01500 Chr2 (265906..266292) [387 bp, 128 aa] {ON} Anc_8.48...    33   0.43 
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}       33   0.44 
Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {...    35   0.48 
NDAI0I03330 Chr9 complement(781013..782065) [1053 bp, 350 aa] {O...    35   0.50 
KLTH0E11330g Chr5 complement(1013019..1013618) [600 bp, 199 aa] ...    34   0.51 
NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326     35   0.54 
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    35   0.57 
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    35   0.59 
KNAG0D04020 Chr4 complement(726098..727558) [1461 bp, 486 aa] {O...    35   0.60 
TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON} Anc_2...    35   0.62 
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    35   0.64 
KLLA0E13487g Chr5 complement(1190615..1191307) [693 bp, 230 aa] ...    34   0.72 
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    34   0.75 
TPHA0L01320 Chr12 complement(275431..275937) [507 bp, 168 aa] {O...    33   0.79 
CAGL0L00583g Chr12 (71544..72710) [1167 bp, 388 aa] {ON} similar...    34   0.87 
CAGL0K04257g Chr11 complement(392116..393759) [1644 bp, 547 aa] ...    34   0.89 
Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {O...    33   0.92 
TBLA0I01970 Chr9 complement(446033..446899) [867 bp, 288 aa] {ON...    33   1.1  
Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {O...    33   1.1  
TPHA0C01760 Chr3 (402424..402939) [516 bp, 171 aa] {ON} Anc_8.48...    33   1.1  
AFL136W Chr6 (178780..180009) [1230 bp, 409 aa] {ON} Syntenic ho...    34   1.2  
YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON} P...    33   1.2  
KNAG0I00130 Chr9 (10977..11972) [996 bp, 331 aa] {ON}                  33   1.2  
CAGL0L12562g Chr12 complement(1353174..1353845) [672 bp, 223 aa]...    33   1.3  
TBLA0D02300 Chr4 (581398..584553) [3156 bp, 1051 aa] {ON} Anc_8....    34   1.3  
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    33   1.4  
KAFR0J02980 Chr10 complement(567857..568816) [960 bp, 319 aa] {O...    33   1.7  
Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to...    33   1.8  
NDAI0E03120 Chr5 (662597..663316) [720 bp, 239 aa] {ON} Anc_8.48...    33   1.9  
YPR022C Chr16 complement(603911..607312) [3402 bp, 1133 aa] {ON}...    33   2.0  
Kpol_489.4 s489 (17106..18125) [1020 bp, 339 aa] {ON} (17106..18...    33   2.0  
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    33   2.2  
CAGL0H07557g Chr8 (738086..739516) [1431 bp, 476 aa] {ON} some s...    33   2.2  
NCAS0C02430 Chr3 (453975..454574) [600 bp, 199 aa] {ON} Anc_8.486      32   2.3  
KAFR0I01440 Chr9 complement(300092..301702) [1611 bp, 536 aa] {O...    33   2.4  
Suva_16.349 Chr16 complement(610937..612562) [1626 bp, 541 aa] {...    33   2.6  
NDAI0D04090 Chr4 complement(959363..960733) [1371 bp, 456 aa] {O...    33   2.8  
NCAS0B02480 Chr2 (414819..415418) [600 bp, 199 aa] {ON} Anc_8.48...    32   2.8  
Kwal_14.1457 s14 complement(331338..332885) [1548 bp, 515 aa] {O...    33   2.8  
CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa] ...    33   2.9  
SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some s...    32   2.9  
Smik_16.263 Chr16 complement(479612..482980) [3369 bp, 1122 aa] ...    33   2.9  
Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {O...    32   3.0  
ZYRO0F08162g Chr6 complement(660746..661294) [549 bp, 182 aa] {O...    32   3.0  
TDEL0G01700 Chr7 complement(334394..335848) [1455 bp, 484 aa] {O...    32   3.1  
ZYRO0D00902g Chr4 (68162..69379) [1218 bp, 405 aa] {ON} similar ...    32   3.2  
NCAS0E00170 Chr5 (20556..21539) [984 bp, 327 aa] {ON}                  32   3.2  
Skud_7.13 Chr7 (26414..27304) [891 bp, 296 aa] {ON} YGL254W (REAL)     32   3.3  
ZYRO0A12936g Chr1 complement(1023335..1024135) [801 bp, 266 aa] ...    32   3.4  
NDAI0H00300 Chr8 (52362..54269) [1908 bp, 635 aa] {ON}                 32   3.4  
AGL197W Chr7 (325717..328251) [2535 bp, 844 aa] {ON} Syntenic ho...    32   3.5  
KLLA0E00793g Chr5 (80516..82069) [1554 bp, 517 aa] {ON} weakly s...    32   3.6  
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    32   4.4  
TBLA0B01860 Chr2 complement(424732..427818) [3087 bp, 1028 aa] {...    32   4.5  
Skud_16.307 Chr16 complement(568219..570672,570703..571623) [337...    32   4.9  
KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some ...    32   5.5  
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    32   6.6  
TBLA0A08460 Chr1 (2080390..2082015) [1626 bp, 541 aa] {ON} Anc_4...    32   6.7  
Skud_8.17 Chr8 (39078..40961) [1884 bp, 627 aa] {ON} YHL027W (REAL)    31   7.1  
TPHA0B00120 Chr2 (7999..8484) [486 bp, 161 aa] {ON}                    30   8.2  
CAGL0K02343g Chr11 (209474..212962) [3489 bp, 1162 aa] {ON} simi...    31   8.2  
KAFR0H01500 Chr8 (277542..278336) [795 bp, 264 aa] {ON} Anc_8.48...    30   9.7  

>NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {ON}
           Anc_2.533
          Length = 541

 Score =  914 bits (2363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/541 (83%), Positives = 452/541 (83%)

Query: 1   MNDAGKRLMGNSDFTTGQYTAKQEPXXXXXXXXXXXXGPSQFENRSQQPLGQGFQRNNPL 60
           MNDAGKRLMGNSDFTTGQYTAKQEP            GPSQFENRSQQPLGQGFQRNNPL
Sbjct: 1   MNDAGKRLMGNSDFTTGQYTAKQEPQSNFQSQNAQNNGPSQFENRSQQPLGQGFQRNNPL 60

Query: 61  VQHPPINTLGKESGMFMXXXXXXXXXXXTSPMLYHWTKPTNTDEEKKADDNSDNGVPKQT 120
           VQHPPINTLGKESGMFM           TSPMLYHWTKPTNTDEEKKADDNSDNGVPKQT
Sbjct: 61  VQHPPINTLGKESGMFMNNSSINRSISNTSPMLYHWTKPTNTDEEKKADDNSDNGVPKQT 120

Query: 121 SLIQQPYQRQSYPSDYTPIYHQQQPRFVGQQSVXXXXXXSTNHALPIQQDFQATIGHPQQ 180
           SLIQQPYQRQSYPSDYTPIYHQQQPRFVGQQSV      STNHALPIQQDFQATIGHPQQ
Sbjct: 121 SLIQQPYQRQSYPSDYTPIYHQQQPRFVGQQSVPPPPPPSTNHALPIQQDFQATIGHPQQ 180

Query: 181 APVYGRVPLRNMNQTVIQAVPLHSQYFTAYGMPQIPTGQQEPLLISNAPPISYMXXXXXX 240
           APVYGRVPLRNMNQTVIQAVPLHSQYFTAYGMPQIPTGQQEPLLISNAPPISYM      
Sbjct: 181 APVYGRVPLRNMNQTVIQAVPLHSQYFTAYGMPQIPTGQQEPLLISNAPPISYMPTIPTT 240

Query: 241 XXXXXFQRQNSNALPNMYIDNGQKVPVQPEQIASKQYIPSTLNNVVHSHTNSNIYYTSPN 300
                FQRQNSNALPNMYIDNGQKVPVQPEQIASKQYIPSTLNNVVHSHTNSNIYYTSPN
Sbjct: 241 VPVTTFQRQNSNALPNMYIDNGQKVPVQPEQIASKQYIPSTLNNVVHSHTNSNIYYTSPN 300

Query: 301 YQMVPEDISRSHHSQNFITSQTVVTQPNFKTGQLPFSYPNIVAPKEERRNDSSFSIXXXX 360
           YQMVPEDISRSHHSQNFITSQTVVTQPNFKTGQLPFSYPNIVAPKEERRNDSSFSI    
Sbjct: 301 YQMVPEDISRSHHSQNFITSQTVVTQPNFKTGQLPFSYPNIVAPKEERRNDSSFSIDNTN 360

Query: 361 XXXXXXXXXXXXXXXXXXXXXXXXXXXLSMGEFDIESQSYRCRICEKKFKRRSWLKRHLL 420
                                      LSMGEFDIESQSYRCRICEKKFKRRSWLKRHLL
Sbjct: 361 PNPDNANSNTTTIINNNNSNAVAIATILSMGEFDIESQSYRCRICEKKFKRRSWLKRHLL 420

Query: 421 SHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINELKLRNFIXXXXXXXXXXXXXXX 480
           SHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINELKLRNFI               
Sbjct: 421 SHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINELKLRNFISSQTAAASVAFVTSA 480

Query: 481 XXXIMSINDGMNNTVAGTVDNAVSTPGYETGITIKDLISEGLINKEDVKRLLNILIDEYN 540
              IMSINDGMNNTVAGTVDNAVSTPGYETGITIKDLISEGLINKEDVKRLLNILIDEYN
Sbjct: 481 APSIMSINDGMNNTVAGTVDNAVSTPGYETGITIKDLISEGLINKEDVKRLLNILIDEYN 540

Query: 541 N 541
           N
Sbjct: 541 N 541

>NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {ON}
           Anc_2.533
          Length = 525

 Score =  160 bits (405), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 92/151 (60%), Gaps = 6/151 (3%)

Query: 391 GEFDIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLK 450
           G FD E+  Y C IC K FKRRSWLKRHLLSHSSERHY CPWCLSRHKRRDNLLQHMKLK
Sbjct: 379 GTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLK 438

Query: 451 HPNNLINELKLRNFIXXXXXXXXXXXXXXXXXXIMSINDGMNNTVAGTVDNAVSTPGYET 510
           H  NLINELK RN I                        GM   + G    A       +
Sbjct: 439 HSKNLINELKFRNVIFDWHNYHYQQQVQRHQQYQQQ--GGMPPQIHG----ANEPFNINS 492

Query: 511 GITIKDLISEGLINKEDVKRLLNILIDEYNN 541
             TI+ L++ G++NKEDVKR+LN L+DE  N
Sbjct: 493 EFTIRTLVTNGVVNKEDVKRVLNQLVDENEN 523

>KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa]
           {ON} Anc_2.533 YMR070W
          Length = 554

 Score =  142 bits (357), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 70/141 (49%), Positives = 88/141 (62%), Gaps = 22/141 (15%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           ++C +CEK FKRRSWLKRHLLSHS+ERHYLCPWCLSRHKR+DNLLQHMKLKH N L++EL
Sbjct: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDEL 495

Query: 460 KLRNFIXXXXXXXXXXXXXXXXXXIMSINDGMNNTVAGTVDNAVSTPGYETGITIKDLIS 519
           K  N                         D M  T++G  D+           +IK L+ 
Sbjct: 496 KNANVSFNWGTYDGQNST-----------DSMPKTLSGYPDS-----------SIKKLLY 533

Query: 520 EGLINKEDVKRLLNILIDEYN 540
            G++NK+DVKR+LN +I+  N
Sbjct: 534 RGILNKDDVKRVLNKIIERSN 554

>Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 aa]
           {ON} YMR070W (REAL)
          Length = 473

 Score =  130 bits (328), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 67/141 (47%), Positives = 83/141 (58%), Gaps = 6/141 (4%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           ++C+ CEK FKR+SWLKRHLLSHS +RH+LCPWCLSR KR+DNLLQHMKLKH N L++EL
Sbjct: 338 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 397

Query: 460 KLRNFIXXXXXXXXXXXXXXXXXXIMSINDGMNNTVAGTVDNAVSTPGYETGITIKDLIS 519
           K  N I                        G         D      G      IK LI+
Sbjct: 398 KKNNIIFNYNNSSINSNNSNNNNSASGSGGGSAAAAPENED------GNSYDPNIKTLIN 451

Query: 520 EGLINKEDVKRLLNILIDEYN 540
           +G++NK+DVKR+LN LI  +N
Sbjct: 452 DGVLNKDDVKRVLNNLIVSHN 472

>YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}
           MOT3Transcriptional repressor and activator with two
           C2-H2 zinc fingers; involved in repression of a subset
           of hypoxic genes by Rox1p, repression of several DAN/TIR
           genes during aerobic growth, and repression of
           ergosterol biosynthetic genes in response to
           hyperosmotic stress; contributes to recruitment of the
           Tup1p-Cyc8p general repressor to promoters; involved in
           positive transcriptional regulation of CWP2 and other
           genes; can form the [MOT3+] prion
          Length = 490

 Score =  131 bits (329), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 86/146 (58%), Gaps = 7/146 (4%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           ++C+ CEK FKR+SWLKRHLLSHS +RH+LCPWCLSR KR+DNLLQHMKLKH N L++EL
Sbjct: 346 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 405

Query: 460 KLRNFI-----XXXXXXXXXXXXXXXXXXIMSINDGMNNTVAGTVDNAVSTPGYETGITI 514
           K  N I                                   A T        GY+T   I
Sbjct: 406 KKNNIIFNYNNSSSSNNNNDNNNNNNSNSASGSGGAGAAAAAATAPENEDGNGYDTN--I 463

Query: 515 KDLISEGLINKEDVKRLLNILIDEYN 540
           K LI++G++NK+DVKR+LN LI  +N
Sbjct: 464 KTLINDGVLNKDDVKRVLNNLIVSHN 489

>KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.533
           YMR070W
          Length = 490

 Score =  131 bits (329), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 83/137 (60%), Gaps = 31/137 (22%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           + C +CEK F+R+SWLKRHLLSHS+ER +LCPWCLSRHKR+DNLLQHMKLKH N L+ EL
Sbjct: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIEL 412

Query: 460 KLRNFIXXXXXXXXXXXXXXXXXXIMSINDGMNNTVAGTVDNAVSTPGYETGITIKDLIS 519
           K  N +                     +N G    +  T D             I++LIS
Sbjct: 413 KKNNAV------------------FSCVNGGNREKLNDTDD-------------IRNLIS 441

Query: 520 EGLINKEDVKRLLNILI 536
            G+INK+DVK+++N LI
Sbjct: 442 LGVINKDDVKKVINKLI 458

>CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakly
           similar to uniprot|P54785 Saccharomyces cerevisiae
           YMR070w MOT3
          Length = 647

 Score =  132 bits (331), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 86/141 (60%), Gaps = 27/141 (19%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           +RC +C K FKR+SWLKRHLLSHS +RH+LCPWC SRHKRRDNLLQHMKLKH  NL+ E+
Sbjct: 534 HRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPWCNSRHKRRDNLLQHMKLKHVPNLLQEI 593

Query: 460 KLRNFIXXXXXXXXXXXXXXXXXXIMSINDGMNNTVAGTVDNAVSTPGYETGITIKDLIS 519
             RN                     M  N  +   ++  +D  +  P  +T      LI 
Sbjct: 594 NSRN---------------------MRFNWPILERLSKQIDGTIEYPDTKT------LIH 626

Query: 520 EGLINKEDVKRLLNILIDEYN 540
           EGL+NK+++K +LN +ID++N
Sbjct: 627 EGLLNKDELKNILNTVIDKHN 647

>Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)
           [1428 bp, 475 aa] {ON} YMR070W (REAL)
          Length = 475

 Score =  129 bits (324), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 69/147 (46%), Positives = 88/147 (59%), Gaps = 6/147 (4%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           ++C+ CEK FKR+SWLKRHLLSHS +RH+LCPWCLSR KR+DNLLQHMKLKH N L++EL
Sbjct: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 387

Query: 460 KLRNFI--XXXXXXXXXXXXXXXXXXIMSINDGMNNTVAGTVDNAVSTPGYETGIT---- 513
           K  N I                      +          G    A + P  E G +    
Sbjct: 388 KKNNIIFNYNKTSTNSNDNNNSTSTRTSASASSGGGGGGGGGAAAAAAPENEDGSSYDPN 447

Query: 514 IKDLISEGLINKEDVKRLLNILIDEYN 540
           IK LI++G++NK+DVKR+LN LI  +N
Sbjct: 448 IKTLINDGVLNKDDVKRVLNNLIVSHN 474

>NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {ON}
           Anc_2.533
          Length = 730

 Score =  127 bits (320), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 62/141 (43%), Positives = 83/141 (58%), Gaps = 4/141 (2%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           ++C  C K FKR SWLKRHLL+HS ERHY CPWCLS+HKR+DNLLQH+KLKH   ++ +L
Sbjct: 560 FQCSYCVKSFKRFSWLKRHLLAHSPERHYSCPWCLSKHKRKDNLLQHLKLKHTEMVLQQL 619

Query: 460 KLRNFIXXXXXXXXXXXXXXXXXXIMSINDGMNNTVAGTVDNAVSTPGYETGITIKDLIS 519
           +L N                      S++ G     +G  D+       + G  IK L+ 
Sbjct: 620 RLENIEISTIEETMEDRRVDVHERSKSVDTG----TSGVNDDIDIKNVKQPGTNIKTLLY 675

Query: 520 EGLINKEDVKRLLNILIDEYN 540
           +G +NKEDVK++LN L+D  N
Sbjct: 676 DGRLNKEDVKKVLNKLLDGTN 696

>ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 294

 Score =  121 bits (304), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 82/147 (55%), Gaps = 39/147 (26%)

Query: 395 IESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNN 454
           +   S+ C +C+K FKR+SWL+RHLLSHS ERH+ CPWCLS+HKR+DNLLQHMKLKH   
Sbjct: 187 LNGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEY 246

Query: 455 LINELKLRNFIXXXXXXXXXXXXXXXXXXIMSINDGMNNTVAGTVDNAVSTPGYETGITI 514
           ++   KLRN                            N  + G V N            I
Sbjct: 247 VLE--KLRN---------------------------QNVGIDGEVRND----------NI 267

Query: 515 KDLISEGLINKEDVKRLLNILIDEYNN 541
           + L+ EG +NKEDVK++LN LID YN 
Sbjct: 268 RTLLCEGRLNKEDVKKVLNGLIDSYNG 294

>TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.533
           YMR070W
          Length = 239

 Score =  119 bits (299), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 84/148 (56%), Gaps = 40/148 (27%)

Query: 396 ESQSY--RCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPN 453
           E+Q Y  +C +C K FKR+SWL+RHLLSHS  RH+ CPWCLS+HKR+DNLLQHMKLKH +
Sbjct: 128 EAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTD 187

Query: 454 NLINELKLRNFIXXXXXXXXXXXXXXXXXXIMSINDGMNNTVAGTVDNAVSTPGYETGIT 513
            ++ EL+L N                                       VST G      
Sbjct: 188 YVLQELRLNNVY-------------------------------------VSTEG-SCKNN 209

Query: 514 IKDLISEGLINKEDVKRLLNILIDEYNN 541
           I+ L+ EG +NK++VK++LN LID +NN
Sbjct: 210 IRTLLYEGRLNKDEVKKVLNSLIDRHNN 237

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score =  124 bits (310), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 60/147 (40%), Positives = 91/147 (61%), Gaps = 30/147 (20%)

Query: 394 DIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPN 453
           ++++ ++ C IC K+FKR+SWL+RHLLSHSSER++ CPWCLS+HKR+DNLLQHMKLKH  
Sbjct: 471 NLKNFAHVCHICGKQFKRKSWLQRHLLSHSSERNFDCPWCLSKHKRKDNLLQHMKLKHAE 530

Query: 454 NLINELKLRNFIXXXXXXXXXXXXXXXXXXIMSINDGMNNTVAGTVDNAVSTPGYETGIT 513
           N++ +L++                        + ND    T+ G  D+ + T        
Sbjct: 531 NVLEQLRIN-------------------LKANNPNDNSEPTLEGNGDHNIRT-------- 563

Query: 514 IKDLISEGLINKEDVKRLLNILIDEYN 540
              L+ EG++NK++VK+LLN L+ ++N
Sbjct: 564 ---LMGEGILNKDEVKKLLNSLVAQHN 587

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score =  120 bits (300), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 82/142 (57%), Gaps = 22/142 (15%)

Query: 399 SYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINE 458
           SY+C +CEK+F+R+SWLKRHLLSHS+ + + CPWC S HKR+DNLLQH+KLKH   L++E
Sbjct: 305 SYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHE 364

Query: 459 LKLRNFIXXXXXXXXXXXXXXXXXXIMSINDGMNNT---VAGTVDNAVSTPGYETGITIK 515
             L                      +M++N+G  NT   V  +    +     E   TI+
Sbjct: 365 FTLFGI-------------------LMNVNNGSGNTANLVTTSTGETICLINNEPSTTIR 405

Query: 516 DLISEGLINKEDVKRLLNILID 537
           D++    + K+ VKR LN ++D
Sbjct: 406 DMLDSNALPKDQVKRCLNYIVD 427

>NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {ON}
           Anc_2.533
          Length = 511

 Score =  119 bits (299), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 77/141 (54%), Gaps = 29/141 (20%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           Y+C +C K F+R SWLKRHLL+HSS+RHY CP C+S+HKR+DNLLQH+KLKH   ++ +L
Sbjct: 387 YQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCPKCVSKHKRKDNLLQHLKLKHTAFVLEQL 446

Query: 460 KLRNFIXXXXXXXXXXXXXXXXXXIMSINDGMNNTVAGTVDNAVSTPGYETGITIKDLIS 519
           +  N                               +    D      G  +   IK L+ 
Sbjct: 447 RQDNI-----------------------------DIKTAKDEGEEDQGTASNTNIKTLLV 477

Query: 520 EGLINKEDVKRLLNILIDEYN 540
           EG +NKEDVK++LN LID  N
Sbjct: 478 EGRLNKEDVKKVLNRLIDSAN 498

>TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.533
           YMR070W
          Length = 216

 Score =  113 bits (282), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 84/143 (58%), Gaps = 35/143 (24%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNL 455
           E   ++C  CEK+FKR+SWLKRH+LSHS ER Y CPWC+SRHKR+DNLLQHMKLKH + +
Sbjct: 109 EMAYHKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPWCISRHKRKDNLLQHMKLKHTDEV 168

Query: 456 INELKLRNFIXXXXXXXXXXXXXXXXXXIMSINDGMNNTVAGTVDNAVSTPGYETGITIK 515
           + +LK+  ++                       +G +       DN            I+
Sbjct: 169 LKKLKMTCYL-----------------------EGDDGEEMMNRDN------------IR 193

Query: 516 DLISEGLINKEDVKRLLNILIDE 538
            ++ EGL++K++VK++LN L++E
Sbjct: 194 TMLYEGLLDKDEVKKVLNELLEE 216

>Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070W
           (REAL)
          Length = 419

 Score =  116 bits (291), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 48/66 (72%), Positives = 57/66 (86%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           ++C+ CEK FKR+SWLKRHLLSHS +RH+LCPWCLSR KR+DNLLQHMKLKH N L++EL
Sbjct: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 386

Query: 460 KLRNFI 465
           K  N I
Sbjct: 387 KKNNII 392

>Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W
           (MOT3) - 2 Cys2-His2 zinc fingers at c-terminus,
           glutamine and asparagine rich [contig 55] FULL
          Length = 507

 Score =  117 bits (292), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 78/146 (53%), Gaps = 34/146 (23%)

Query: 399 SYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINE 458
           +YRC +C+K FKRRSW KRHLLSHSS + Y CPWC SRHKRRDNL QHMK KH  +++ E
Sbjct: 388 AYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQE 447

Query: 459 LKLRNFIXXXXXXXXXXXXXXXXXXIMSINDGMNNTVAG---TVDNAVSTPGYETGITIK 515
           L                         + + D   + ++G   T D +   P      +IK
Sbjct: 448 L-------------------------LEVGDVDGSVMSGMQVTSDESAPEP------SIK 476

Query: 516 DLISEGLINKEDVKRLLNILIDEYNN 541
            LI +G + KE VK +LN +I   N 
Sbjct: 477 TLIQDGQVKKERVKAVLNAVIARVNG 502

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score =  114 bits (284), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 55/138 (39%), Positives = 77/138 (55%), Gaps = 8/138 (5%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           +RC +C K FKR+SWLKRHLLSHSS R Y CPWCLS+HKR+DNLLQHMKLKH   ++ E+
Sbjct: 254 FRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQEM 313

Query: 460 KLRNFIXXXXXXXXXXXXXXXXXXIMSINDGMNNTVAGTVDNAVSTPGYETGITIKDLIS 519
              +                    +      M N  +G+  N          ++I  ++ 
Sbjct: 314 DKLSESSLELNDESSTGTDTASPIVNETALSMLNDDSGSSSN--------DNVSIIAMVD 365

Query: 520 EGLINKEDVKRLLNILID 537
            G + KE+VK++LN +I+
Sbjct: 366 NGTLKKENVKKVLNSIIE 383

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score =  114 bits (284), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 83/140 (59%), Gaps = 15/140 (10%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           ++C +C+K FKR+SWLKRHLLSHSS + + CPWC SRHKR+DNLLQHMKLKH   ++ EL
Sbjct: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317

Query: 460 KLRNFIXXXXXXXXXXXXXXXXXXIMSINDGMNNTVAGTVDNAVSTPGYETGIT-IKDLI 518
           +                       I  IN        G V + V   G  + +T IK +I
Sbjct: 318 Q-------------SAGVHPIVSNITLINLASTAGQNG-VPSLVPVHGDMSMMTSIKTMI 363

Query: 519 SEGLINKEDVKRLLNILIDE 538
            +G +NK+DVKR+LN+LI+ 
Sbjct: 364 DDGTLNKDDVKRVLNMLINR 383

>KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 506

 Score =  115 bits (288), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 60/155 (38%), Positives = 81/155 (52%), Gaps = 32/155 (20%)

Query: 391 GEFDIESQS----YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQH 446
           G FD    S    YRC +CEK FKR+SW +RHLLSHSS + Y CPWC SRHKRRDNL QH
Sbjct: 375 GSFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQH 434

Query: 447 MKLKHPNNLINELKLRNFIXXXXXXXXXXXXXXXXXXIMSINDGMNNTVAGTVDNAVSTP 506
           MK KH + ++ EL                           ++  M   V   +D+ V+ P
Sbjct: 435 MKTKHVHQVLQEL----------------------MEAGDLDGSMGTNVRLAIDDMVAGP 472

Query: 507 GYETGITIKDLISEGLINKEDVKRLLNILIDEYNN 541
                 +I+ L+ +G + KE VK +LN +I   ++
Sbjct: 473 ------SIRTLVQDGRVKKERVKTVLNAVIARVHD 501

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score =  112 bits (279), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/149 (39%), Positives = 80/149 (53%), Gaps = 24/149 (16%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           ++C  CEK FKR+SWLKRHLLSHS+ + Y CPWC SRHKR+DNL QH+KLKH   L+  L
Sbjct: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERL 345

Query: 460 KLRNFIXXXXXXXXXXXXXXXXXXIMSINDGMNNTVAGTVDNAVSTPGYE---------- 509
                                   +  ++ G N  VA T  +A S+              
Sbjct: 346 S--------------SNPNTASHLMNRLHSGANGAVAVTAASADSSATMVSSSSSSAAGP 391

Query: 510 TGITIKDLISEGLINKEDVKRLLNILIDE 538
           T  +IKD+I  G+++K +VK+ LN LI+ 
Sbjct: 392 TTFSIKDMIDSGMLSKNEVKKTLNSLINS 420

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score =  102 bits (254), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 55/138 (39%), Positives = 78/138 (56%), Gaps = 19/138 (13%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           ++C  CEK FKR+SWLKRHLLSHS+ + Y CPWC SRHKR+DNL QH+KLKH   L+  L
Sbjct: 185 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERL 244

Query: 460 KLRNFIXXXXXXXXXXXXXXXXXXIMSINDGMNNTVAGTVDNAVSTPGYETGITIKDLIS 519
                                     S+ + ++++ A     A +  G     +IKD+I 
Sbjct: 245 S------------------SNPNTPTSLINRLHSSDAAAGSAAAAA-GTPAAFSIKDMID 285

Query: 520 EGLINKEDVKRLLNILID 537
            G+++K +VK+ LN LI+
Sbjct: 286 SGMLSKNEVKKTLNSLIN 303

>TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.533
           YMR070W
          Length = 513

 Score = 98.2 bits (243), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 38/66 (57%), Positives = 54/66 (81%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           ++C +CEK FKR+SWLKRHLLSHS +R++ CP CLS+HKR+DNL+QH+KLKH + ++ +L
Sbjct: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKHLDYILKKL 399

Query: 460 KLRNFI 465
              + I
Sbjct: 400 NKDDLI 405

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 89.7 bits (221), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 51/67 (76%)

Query: 394 DIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPN 453
           D  +  YRC +C K F+R +WL+RH LSH+++R++LCPWC S+HKRRDNL +H+KLKH  
Sbjct: 113 DEVTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHME 172

Query: 454 NLINELK 460
            L+  ++
Sbjct: 173 LLMKAIR 179

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score = 80.9 bits (198), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 66/139 (47%), Gaps = 41/139 (29%)

Query: 399 SYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINE 458
           SY C  C K F+R +WLKRH ++H++   + C WC S HKRRDN+ +HMKLKH N L+  
Sbjct: 249 SYPCPQCPKSFQRSAWLKRHSITHTNSHPFKCVWCKSEHKRRDNMFKHMKLKHMNLLMKV 308

Query: 459 LKLRNFIXXXXXXXXXXXXXXXXXXIMSINDGMNNTVAGTVDNAVSTPGYETGITIKDLI 518
             +RN+                                              G  +K L+
Sbjct: 309 --IRNYYPLAEFE---------------------------------------GKDLKGLL 327

Query: 519 SEGLINKEDVKRLLNILID 537
           ++G ++KEDVKR+L  +++
Sbjct: 328 ADGRLHKEDVKRVLVDIVN 346

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 79.0 bits (193), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 39/52 (75%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           Y C++C K FKR SWLKRH  SHS  +++ C WC  ++KR+DNL+QH++ KH
Sbjct: 324 YECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNWCSGKYKRKDNLVQHIRKKH 375

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (64%), Gaps = 1/57 (1%)

Query: 393 FDIESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           F  E+++++C  C K F+R   LKRH+ S HSSER + CP C  +  R DNL QH+K
Sbjct: 758 FSDENKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQHIK 814

>Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON}
           complement(4290..6233) [1944 nt, 648 aa]
          Length = 647

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 1/56 (1%)

Query: 394 DIESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           D ES+ ++C  CEK F+R   LKRH+ S HSSER + C +C  +  R DNL QH+K
Sbjct: 584 DDESKPFKCTDCEKAFRRSEHLKRHIRSVHSSERPFACNYCEKKFSRSDNLSQHLK 639

>NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598
          Length = 972

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 1/57 (1%)

Query: 393 FDIESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           +D +++ ++C  CEK F+R   LKRH  S HS+ER + C +C  R  R DNL QH+K
Sbjct: 908 YDDQNKPFKCSDCEKAFRRSEHLKRHFRSVHSAERPFGCMFCTKRFSRSDNLSQHLK 964

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (61%), Gaps = 1/60 (1%)

Query: 390 MGEFDIESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           M   D + + ++C+ C K F+R   LKRH+ S HSSER + C +C  +  R DNL QH+K
Sbjct: 517 MNASDEDVKPFKCKECSKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLK 576

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 394 DIESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           D+E + + C IC K FKR   LKRH+ S HS+ER + C  C  +  R DNL QH+K
Sbjct: 641 DLEEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           ++C  CEKKFKR   LKRH+ S HS+ER Y C +C     R DNL QH+K
Sbjct: 308 FKCNKCEKKFKRSEHLKRHIRSVHSTERPYHCQFCEKNFSRSDNLSQHLK 357

>YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}
           MSN4Transcriptional activator related to Msn2p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 630

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 1/50 (2%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           ++C+ CEK F+R   LKRH+ S HS+ER + C +C  +  R DNL QH+K
Sbjct: 573 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 622

>Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062W
           (REAL)
          Length = 641

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 1/50 (2%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           ++C+ CEK F+R   LKRH+ S HS+ER + C +C  +  R DNL QH+K
Sbjct: 584 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 633

>NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {ON}
           Anc_2.598
          Length = 730

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (62%), Gaps = 1/59 (1%)

Query: 391 GEFDIESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           G  D +++ ++C  C K F+R   LKRH+ S HSSER + C +C  +  R DNL QH+K
Sbjct: 664 GSLDDKNKPFKCSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLK 722

>Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062W
           (REAL)
          Length = 628

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 1/50 (2%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           ++C+ CEK F+R   LKRH+ S HS+ER + C +C  +  R DNL QH+K
Sbjct: 571 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 620

>Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {ON}
           YMR037C (REAL)
          Length = 709

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 394 DIESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           ++E + + C IC K FKR   LKRH+ S HS+ER + C  C  +  R DNL QH+K
Sbjct: 646 ELEEKPFHCHICSKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 701

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 393 FDIESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
            D E + ++C  C K F+R   LKRH+ S HS+ER + C +C  +  R DNL QH+K   
Sbjct: 614 MDEEEKPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHLKTHK 673

Query: 452 PNNLINEL 459
            +  I EL
Sbjct: 674 KHGDITEL 681

>TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {ON}
           Anc_2.598 YMR037C
          Length = 523

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           E + ++C  CEK F+R   LKRH+ S HSSER + C +C  R  R DNL QH+K
Sbjct: 462 EVKPFKCGQCEKAFRRSEHLKRHVRSVHSSERPFPCTFCDKRFSRSDNLSQHLK 515

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 394 DIESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           ++E + + C IC K FKR   LKRH+ S HS+ER + C  C  +  R DNL QH+K
Sbjct: 641 ELEEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696

>CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {ON}
           some similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c or uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 300

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 40/65 (61%), Gaps = 5/65 (7%)

Query: 393 FDIESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLK- 450
           FD +++ ++C +CE++FKR+  LKRH+ S H  ER Y C  CL    R DNL QH +   
Sbjct: 212 FD-DAKIFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQHKRTHN 270

Query: 451 --HPN 453
             HPN
Sbjct: 271 NPHPN 275

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 394 DIESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           ++E + + C IC K FKR   LKRH+ S HS+ER + C  C  +  R DNL QH+K
Sbjct: 640 ELEEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICEKKFSRSDNLSQHIK 695

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           E + ++C+ C K F+R   LKRH+ S HSSER + C +C  +  R DNL QH+K
Sbjct: 438 EEKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLK 491

>TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {ON}
           Anc_2.598 YMR037C
          Length = 746

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           ++C  C K F+R   LKRH+ S HS ER + C  CL +  R DNL QH+K
Sbjct: 689 FKCDTCGKNFRRSEHLKRHIRSVHSMERPFSCDICLKKFSRSDNLSQHLK 738

>KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {ON}
           Anc_8.144 YER130C
          Length = 472

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 394 DIESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           D  S+ + C+ C +KFKR+  LKRH+LS H  E+ + CP C     R DNL QH+K
Sbjct: 394 DDPSKQFGCKYCPRKFKRQEHLKRHILSLHVGEKRFGCPICGKNFSRSDNLNQHIK 449

>TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa]
           {ON} Anc_2.598 YMR037C
          Length = 437

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%), Gaps = 1/56 (1%)

Query: 394 DIESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           D E + ++C+ C K F+R   LKRH+ S HS+ER + C +C  +  R DNL QH+K
Sbjct: 374 DEEVKPFKCKECAKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 429

>Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062W
           (REAL)
          Length = 639

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           + C+ C+K F+R   LKRH+ S HS+ER + C +C  +  R DNL QH+K
Sbjct: 582 FNCKDCDKAFRRSEHLKRHIRSVHSAERPFACMFCEKKFSRSDNLSQHLK 631

>KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.598
           YMR037C
          Length = 370

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 394 DIESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           D++ Q ++C  CEK FKR   LKRH  S HS+ER + C  C  +  R DNL QH+K
Sbjct: 308 DLDKQ-FKCSECEKGFKRSEHLKRHFRSVHSNERPFPCMLCEKKFSRSDNLSQHLK 362

>Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii ABR089C
          Length = 767

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 1/57 (1%)

Query: 393 FDIESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
            D E + ++C+ C K F+R   LKRH+ S HS++R + C +C  +  R DNL QH+K
Sbjct: 691 LDEEEKPFKCQECTKAFRRSEHLKRHIRSVHSTDRPFPCTYCDKKFSRSDNLSQHLK 747

>TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {ON}
           Anc_2.598 YMR037C
          Length = 519

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 1/52 (1%)

Query: 398 QSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           ++++C  CEK F+R   LKRH+ S HSSER + C +C  +  R DNL QH+K
Sbjct: 460 KTFKCNNCEKAFRRSEHLKRHIRSVHSSERPFPCNYCEKKFSRSDNLSQHLK 511

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           E + ++C+ C K F+R   LKRH+ S HSSER + C +C  +  R DNL QH+K
Sbjct: 637 EEKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLK 690

>KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598
           YMR037C
          Length = 620

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 395 IESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           +E + ++C  C K FKR   LKRH+ S HS++R + C  C  +  R DNL QH+K
Sbjct: 558 LEDKPFKCGQCVKAFKRSEHLKRHVRSVHSNDRPFACTLCEKKFSRSDNLSQHLK 612

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           E + ++C+ C K F+R   LKRH+ S HSS+R + C +C  +  R DNL QH+K
Sbjct: 500 EEKPFKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHLK 553

>KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {ON}
           Anc_2.598 YMR037C
          Length = 443

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 389 SMGEFDIESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHM 447
           S+   D   + ++C  C K F+R   LKRH+ S HS+ER + C  C  +  R DNL QH+
Sbjct: 375 SIDPIDENEKPFKCDTCYKAFRRSEHLKRHIRSVHSTERPFACTICDKKFSRSDNLSQHL 434

Query: 448 K 448
           K
Sbjct: 435 K 435

>Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {ON}
           complement(39687..41171) [1485 nt, 495 aa]
          Length = 494

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           ++C  C K+F+R   LKRH+ S HS ER + C +C  +  R DNL QH+K
Sbjct: 437 FKCGDCTKQFRRSEHLKRHIRSVHSKERPFPCKYCDKKFSRSDNLSQHLK 486

>NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598
          Length = 769

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           E++ ++C  C K F+R   LKRH+ S HS ER + C  C  +  R DNL QH+K
Sbjct: 708 ENKPFQCDQCTKSFRRSEHLKRHVRSVHSKERPFACNLCEKKFSRSDNLSQHLK 761

>KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {ON}
           Anc_2.598 YMR037C
          Length = 660

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query: 389 SMGEFDIESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHM 447
           S  E D+E + + C  C K FKR   LKRH+ S HS ER Y C  C  +  R DNL QH+
Sbjct: 593 STAEDDME-KPFHCEQCLKAFKRSEHLKRHVRSVHSQERPYGCNICDKKFSRSDNLSQHL 651

Query: 448 K 448
           K
Sbjct: 652 K 652

 Score = 34.3 bits (77), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 2/28 (7%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERH 427
           Y C IC+KKF R   L +HL +H  +RH
Sbjct: 632 YGCNICDKKFSRSDNLSQHLKTH--KRH 657

>CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa]
           {ON} weakly similar to uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 541

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           ++C  C+K F+R   LKRH+ S HS+ER + C +C  +  R DNL QH+K
Sbjct: 484 FQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHLK 533

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           ++C+ C K F+R   LKRH+ S HS+ER + C +C  +  R DNL QH+K
Sbjct: 620 FKCQECTKAFRRSEHLKRHIRSVHSTERPFHCSYCDKKFSRSDNLSQHLK 669

>NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {ON}
           Anc_8.144
          Length = 547

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 397 SQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           ++ + C  CE++FKR+  LKRH+ S H  E+ Y C  C     R DNL QH+K
Sbjct: 492 TKQFACDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHIK 544

>SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 410

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 397 SQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           S+ + C  C+++FKR+  LKRH+ S H  E+ Y C  C  +  R DNL QH+K
Sbjct: 351 SKQFGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHIK 403

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 5/38 (13%)

Query: 388 LSMGEFDIESQSYRCRICEKKFKRRSWLKRHLLSHSSE 425
           L MGE     + Y C IC KKF R   L +H+ +H  +
Sbjct: 376 LHMGE-----KPYGCEICGKKFSRSDNLNQHIKTHGGD 408

>CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {ON}
           some similarities with uniprot|P33748 Saccharomyces
           cerevisiae YMR037c MSN2
          Length = 597

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           + C +C K FKR   LKRH+ S HS++R + C  C  +  R DNL QH+K
Sbjct: 535 FGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHIK 584

>SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa]
           {ON} similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1129

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 32/61 (52%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           + C+IC + F R+  L RH  SH+ E+ Y C  C  R  RRD LL+H    H  N    +
Sbjct: 59  FVCKICTRAFARQEHLTRHERSHTKEKPYFCGICDRRFSRRDLLLRHAHKLHGGNCGETI 118

Query: 460 K 460
           K
Sbjct: 119 K 119

>KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.234
           YER169W
          Length = 890

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (62%), Gaps = 1/54 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           Y C+IC+++F     L RH  S HS E+ + CP C  R KRRD++LQH+  K P
Sbjct: 781 YICQICKRQFSSGHHLTRHKKSVHSGEKPFSCPKCGKRFKRRDHVLQHLNKKIP 834

>KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 474

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 397 SQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           S+ + C  C+++FKR+  LKRH+ S H  E+ Y C  C  +  R DNL QH+K
Sbjct: 415 SKPFGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHLK 467

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSE 425
           Y C +C KKF R   L +HL +H+ E
Sbjct: 447 YGCHLCGKKFSRSDNLSQHLKTHTHE 472

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 394 DIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMKL 449
           +IE   Y C IC KKFKR S L  H+  H+  + + CP+  C      + N+L+H KL
Sbjct: 299 NIEKIKYHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNCTKSFNAKSNMLRHYKL 356

>TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {ON}
           Anc_8.234 YER169W
          Length = 912

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           Y C+ C+++F     L RH  S HS E+ + CP C  R KRRD++LQH+  K P
Sbjct: 777 YICQDCKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIP 830

>TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.351
           YJR127C
          Length = 1310

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 33/53 (62%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           + C IC + F R+  LKRH +SH++E+ +LC +C     R+D +L+H    HP
Sbjct: 34  FLCSICTRGFVRQEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRHQYKLHP 86

>TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.234
           YER169W
          Length = 967

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 388 LSMGEFDIESQS--YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLL 444
            S GE  +      Y C+ C+++F     L RH  S HS E+ + CP C  R KRRD++L
Sbjct: 845 FSSGEIIVSENGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVL 904

Query: 445 QHMKLKHP 452
           QH+  K P
Sbjct: 905 QHLNKKIP 912

>TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1655

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 33/53 (62%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           Y C+IC + F R+  L+RH  +H++E+ +LC +C     RRD +L+H    HP
Sbjct: 87  YLCQICTRGFVRQEHLRRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHP 139

>KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 397

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 397 SQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           S+ + C  C+++FKR+  LKRH+ S H  E+ + C  C  +  R DNL QH+K
Sbjct: 337 SKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCQICGKKFSRSDNLNQHVK 389

>Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W
           (REAL)
          Length = 1319

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 34/58 (58%)

Query: 398 QSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNL 455
           +S+ C +C + F R+  LKRH  SH++E+ Y C  C     RRD L++H +  H  NL
Sbjct: 102 RSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNL 159

>YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbon
           source-responsive zinc-finger transcription factor,
           required for transcription of the glucose-repressed gene
           ADH2, of peroxisomal protein genes, and of genes
           required for ethanol, glycerol, and fatty acid
           utilization
          Length = 1323

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 34/58 (58%)

Query: 398 QSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNL 455
           +S+ C +C + F R+  LKRH  SH++E+ Y C  C     RRD L++H +  H  NL
Sbjct: 102 RSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNL 159

>ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER130C
          Length = 520

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           + C  CE++FKR+  LKRH+ S H  E+ Y C  C  +  R DNL QH+K
Sbjct: 460 FGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHIK 509

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 5/36 (13%)

Query: 388 LSMGEFDIESQSYRCRICEKKFKRRSWLKRHLLSHS 423
           L MGE     + Y C IC KKF R   L +H+ +HS
Sbjct: 482 LHMGE-----KPYGCDICGKKFSRSDNLNQHIKTHS 512

>KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1379

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNN 454
           + C++C + F R+  L RH  SH+ E+ Y+C  C  R  RRD L++H +  H  N
Sbjct: 125 FVCKVCTRAFARQEHLTRHERSHTKEKPYVCGICERRFTRRDLLIRHCQKLHGGN 179

>Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W
           (REAL)
          Length = 1324

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 34/58 (58%)

Query: 398 QSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNL 455
           +S+ C +C + F R+  LKRH  SH++E+ Y C  C     RRD L++H +  H  NL
Sbjct: 108 RSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNL 165

>Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W
           (REAL)
          Length = 1323

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 34/58 (58%)

Query: 398 QSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNL 455
           +S+ C +C + F R+  LKRH  SH++E+ Y C  C     RRD L++H +  H  NL
Sbjct: 102 RSFVCEVCTRAFARQEHLKRHHRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNL 159

>CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some
           similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c
          Length = 317

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 397 SQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           S+ + C  C+++FKR+  LKRH+ S H  E+ Y C  C  +  R DNL QH+K
Sbjct: 261 SKQFGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHIK 313

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 5/36 (13%)

Query: 388 LSMGEFDIESQSYRCRICEKKFKRRSWLKRHLLSHS 423
           L MGE     + Y C IC KKF R   L +H+ +HS
Sbjct: 286 LHMGE-----KPYECHICNKKFSRSDNLNQHIKTHS 316

>Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..7102)
           [4026 nt, 1342 aa]
          Length = 1341

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           + C IC + F R   LKRH +SH++E+ +LC +C     R+D +L+H    HP
Sbjct: 36  FLCSICTRGFVRHEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRHQYKLHP 88

>Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii ACL057W
          Length = 573

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           + C  CE++FKR+  LKRH+ S H  E+ Y C  C  +  R DNL QH+K
Sbjct: 514 FGCEFCERRFKRQEHLKRHVRSLHMGEKPYGCDICGKKFSRSDNLNQHIK 563

>TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {ON}
           Anc_8.144 YER130C
          Length = 439

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 397 SQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           S+ + C  CE++FKR+  LKRH+ S H   + Y C  C  +  R DNL QH+K
Sbjct: 383 SKQFGCDYCERRFKRQEHLKRHVRSLHMCVKPYACHICDKKFSRSDNLSQHIK 435

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHS 423
           Y C IC+KKF R   L +H+ +H+
Sbjct: 415 YACHICDKKFSRSDNLSQHIKTHT 438

>KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.144
           YER130C
          Length = 402

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 397 SQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           ++ Y C  CE++FKR+  LKRH+ S H   + Y C  C  +  R DNL QH K
Sbjct: 346 TKHYSCEYCERRFKRQEHLKRHIRSLHLGAKPYTCHICARKFSRSDNLNQHTK 398

>Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130C -
           Hypothetical ORF [contig 211] FULL
          Length = 403

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 397 SQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           S+ + C  C+++FKR+  LKRH+ S H  E+ + C  C  +  R DNL QH+K
Sbjct: 343 SKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHIK 395

>YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC
           domain-containing histone demethylase and transcription
           factor; involved in expression of genes during nutrient
           limitation; negatively regulates DPP1 and PHR1; activity
           is modulated by limited proteasome-mediated proteolysis;
           has a JmjC and a JmjN domain in the N-terminal region
           that interact, promoting Gis1p stability and proper
           transcriptional activity; contains transactivating
           domains TAD1 and TAD2 downstream of the Jmj domains and
           a C-terminal DNA binding domain
          Length = 894

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           Y CR C ++F     L RH  S HS E+ + CP C  R KRRD++LQH+  K P
Sbjct: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKKIP 881

>KAFR0A02380 Chr1 complement(493691..496393) [2703 bp, 900 aa] {ON}
           Anc_8.234 YER169W
          Length = 900

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 1/58 (1%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           + ++Y C+ C++KF     L RH  S HS E+ + CP C  R KRRD++LQH+  K P
Sbjct: 831 KGKTYMCQECKRKFSSGHHLTRHKKSVHSGEKPHPCPKCGKRFKRRDHVLQHLNKKIP 888

>Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           Y CR C ++F     L RH  S HS E+ + CP C  R KRRD++LQH+  K P
Sbjct: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKKIP 881

>Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON}
           YER130C (REAL)
          Length = 442

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 397 SQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           S+ + C  C+++FKR+  LKRH+ S H  E+ + C  C     R DNL QH+K
Sbjct: 385 SKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

>KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.234
           YER169W
          Length = 875

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           Y C+ C+++F     L RH  S HS E+ Y CP C  R KRRD++LQH+  K P
Sbjct: 760 YVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKRFKRRDHVLQHLNKKIP 813

>Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON}
           (118186..120660) [2475 nt, 825 aa]
          Length = 824

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           Y C+ C+++F     L RH  S HS E+ + CP C  R KRRD++LQH+  K P
Sbjct: 687 YICQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIP 740

>TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1384

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 36/59 (61%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINE 458
           Y C+ C + F R+  LKRH  SH++E+ +LC +C     RRD +L+H +  H + + N+
Sbjct: 105 YICQTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLILRHQRRLHSSLMTND 163

>Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           Y CR C ++F     L RH  S HS E+ + CP C  R KRRD++LQH+  K P
Sbjct: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKKIP 881

>Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W
           (REAL)
          Length = 916

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           Y CR C ++F     L RH  S HS E+ + CP C  R KRRD++LQH+  K P
Sbjct: 850 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKKIP 903

>TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298
          Length = 511

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMKLKH 451
           Y C IC K F+R S LK H+  H+  + YLCP+  C      + N+L+H KL +
Sbjct: 415 YHCDICHKFFRRPSSLKTHMNIHTGVKPYLCPYNNCYKPFNAKSNMLRHFKLHY 468

>NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.144
           YER130C
          Length = 484

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%), Gaps = 8/64 (12%)

Query: 397 SQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK------- 448
           S+ + C IC ++F+R+  +KRH+ + H  ER Y C  C     R DNL QH++       
Sbjct: 410 SKQFLCTICSRRFRRQEHMKRHIRTIHFQERPYTCYVCEKTFSRSDNLNQHLRTHTRNYE 469

Query: 449 LKHP 452
           +KHP
Sbjct: 470 VKHP 473

>YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC
           domain-containing histone demethylase; specifically
           demethylates H3K36 tri- and dimethyl modification
           states; associates with actively transcribed (RNA
           polymerase II) regions in vivo and specifically targets
           H3K36 in its trimethylation state as its substrate;
           transcriptional repressor of PHR1; Rph1p phosphorylation
           during DNA damage is under control of the MEC1-RAD53
           pathway
          Length = 796

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           Y C+ C++KF     L RH  S HS E+ + CP C  R KRRD++LQH+  K P
Sbjct: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIP 762

>Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W
           (REAL)
          Length = 802

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           Y C+ C++KF     L RH  S HS E+ + CP C  R KRRD++LQH+  K P
Sbjct: 716 YVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIP 769

>Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C
           (REAL)
          Length = 442

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 397 SQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           S+ + C  C+++FKR+  LKRH+ S H  E+ + C  C     R DNL QH+K
Sbjct: 385 SKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

>Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W
           (REAL)
          Length = 798

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           Y C+ C++KF     L RH  S HS E+ + CP C  R KRRD++LQH+  K P
Sbjct: 711 YVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIP 764

>Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa]
           {ON} YER169W (REAL)
          Length = 797

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           Y C+ C++KF     L RH  S HS E+ + CP C  R KRRD++LQH+  K P
Sbjct: 710 YVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIP 763

>ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} similar
           to uniprot|P39956 Saccharomyces cerevisiae YER169W RPH1
           Transcriptional repressor of PHR1 which is a photolyase
           induced by DNA damage binds to AG(4) (C(4)T) sequence
           upstream of PHR1 Rph1p phosphorylation during DNA damage
           is under control of the MEC1-RAD53 pathway
          Length = 867

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           Y C+ C+++F     L RH  S HS E+ Y CP C  + KRRD++LQH+  K P
Sbjct: 788 YVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKKIP 841

>NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON}
           Anc_8.425
          Length = 1350

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (56%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLIN 457
           + C IC + F R+  L RH  SH+ E+ Y C  C  +  RRD L++H +  H  N+++
Sbjct: 116 FVCEICTRAFARQEHLVRHERSHTKEKPYNCGICSKKFTRRDLLIRHAQKVHNGNVVD 173

>SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 385

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 394 DIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMKL 449
           D + + Y+C +C K F R    +RH+ +H+ E+ + C  P C+ R  R D L +H+++
Sbjct: 19  DNDQRPYKCELCNKGFHRLEHKRRHIRTHTGEKPHACTFPGCMKRFSRSDELKRHLRI 76

>YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON}
           Protein of unknown function; transcription is regulated
           by Haa1p, Sok2p and Zap1p transcriptional activators;
           computational analysis suggests a role as a
           transcription factor; C. albicans homolog (MNL1) plays a
           role in adaptation to stress
          Length = 443

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 397 SQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           S+ + C  C+++FKR+  LKRH+ S H  E+ + C  C     R DNL QH+K
Sbjct: 386 SKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 438

>NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {ON}
           Anc_8.425
          Length = 1152

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNN 454
           + C +C + F R+  L RH  SH++E+ Y C  C  +  RRD LL+H +  H  N
Sbjct: 78  FVCDVCSRAFARQEHLDRHARSHTNEKPYQCGICTKKFTRRDLLLRHAQKVHNGN 132

>TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 3/61 (4%)

Query: 394 DIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCP--WCLSRHKRRDNLLQHMKLKH 451
           D E + ++C +C + F R    KRH+ +H+ E+ +LCP   C     R D L +HMK+ H
Sbjct: 10  DNEERPFKCPMCHRGFYRAEHKKRHIRTHTGEKPHLCPILGCNKSFSRTDELKRHMKV-H 68

Query: 452 P 452
           P
Sbjct: 69  P 69

>CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa]
           {ON} weakly similar to uniprot|P07248 Saccharomyces
           cerevisiae YDR216w ADR1 zinc-finger transcription factor
          Length = 1489

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNN 454
           + C+ C + F R+  L RH  SH+ E+ Y C  C  R  RRD LL+H    H  N
Sbjct: 30  FVCQTCTRAFARQEHLTRHERSHTKEKPYCCGICDRRFTRRDLLLRHAHKVHGGN 84

>Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON}
           complement(28325..32557) [4233 nt, 1411 aa]
          Length = 1410

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNN 454
           + C IC + F R+  L RH  SH+ E+ Y C  C  +  RRD LL+H    H  N
Sbjct: 118 FVCSICTRAFARQEHLTRHERSHTKEKPYCCGICQRKFSRRDLLLRHAHKIHGGN 172

>NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144
          Length = 289

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNN 454
           +S+ Y C +C+K+FKR   LKRH  + H   R + C  C  R  R DNL QH+++     
Sbjct: 219 DSKQYFCHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHVRIHEQQP 278

Query: 455 LINELKLRNFI 465
           ++  ++ R+ +
Sbjct: 279 IMEPIRKRSSV 289

>Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON}
           YER130C (REAL)
          Length = 449

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 397 SQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           ++ + C  C+++FKR+  LKRH+ S H  E+ + C  C     R DNL QH+K
Sbjct: 392 TKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 444

>ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 557

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 397 SQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           ++ + C  C+++FKR+  LKRH+ S H  E+ + C  C  +  R DNL QH+K
Sbjct: 500 TKHFGCEYCDRRFKRQEHLKRHVRSLHMCEKPFGCHICGKKFSRSDNLNQHIK 552

>KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1155

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 30/47 (63%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQH 446
           + C IC + F R+  LKRH  +H+SE+ +LC +C     RRD +L+H
Sbjct: 54  FLCSICTRGFVRQEHLKRHQRAHTSEKPFLCTFCGRCFARRDLVLRH 100

>TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.144
           YER130C
          Length = 312

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 397 SQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           S+ + C  C+++FKR+  LKRH+ S H  E+ + C  C  +  R DNL QH+K
Sbjct: 255 SKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFNCHICDKKFSRSDNLNQHIK 307

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHS 423
           + C IC+KKF R   L +H+ +HS
Sbjct: 287 FNCHICDKKFSRSDNLNQHIKTHS 310

>TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {ON}
           Anc_8.234 YER169W
          Length = 837

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           Y C+ C+++F     L RH  S HS E+ Y CP C  + KRRD++LQH+  K P
Sbjct: 756 YICQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKKIP 809

>AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML081W and
           YJR127C (ZMS1)
          Length = 1191

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 37/63 (58%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           + C +C + F R+  LKRH  SH++E+ +LC +C     RRD +L+H +  H + +  + 
Sbjct: 80  FLCPVCTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHASLMDQDK 139

Query: 460 KLR 462
            LR
Sbjct: 140 DLR 142

>CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {ON}
           some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 315

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMKL 449
           E   + C++C KKFKR S L  H+  H+ E+ Y CP+  C      + N+L+H KL
Sbjct: 169 EDTKFICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKL 224

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMK 448
           Y+C++C K F R S L+ HLL+H+  R + CP+  C      + N+++H+K
Sbjct: 128 YQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLK 178

>CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169w
          Length = 980

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           Y C+ C+++F     L RH  S HS E+ + CP C  R KRRD++LQH+  K P
Sbjct: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIP 955

>NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144
          Length = 436

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 397 SQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           S+ + C  CE++FKR+  LKRH+ S H   + Y C  C     R DNL QH+K
Sbjct: 381 SKQFGCEYCERRFKRQEHLKRHVRSLHIGVKPYTCHICQKNFSRSDNLSQHIK 433

>TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1311

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           + C  C++ F R+  L RH  SH++E+ +LC  C     RRD L++H +  H
Sbjct: 152 FLCDFCKRAFARQEHLTRHKRSHTNEKPFLCNLCFKNFTRRDLLIRHAQKIH 203

>TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1375

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           + C IC + F R+  L RH  SH+ E+ Y C  C  +  RRD LL+H +  H
Sbjct: 44  FVCSICTRAFARQEHLTRHERSHTKEKPYCCGLCQRKFSRRDLLLRHAQKIH 95

>NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]
           {ON} Anc_4.351
          Length = 1341

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           + C  C + F R+  LKRH  SH++E+ +LC +C     RRD +L+H    H   + NEL
Sbjct: 72  FLCPTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHAALIGNEL 131

Query: 460 K 460
           +
Sbjct: 132 Q 132

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1238

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (61%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           + C IC + F R+  LKRH  SH++E+ +LC +C     RRD +L+H +  H
Sbjct: 73  FLCPICTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLH 124

>KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON}
           Anc_8.425 YDR216W
          Length = 627

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query: 398 QSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLI 456
           +++ C +C+K F R+  L RHL SH++E+ + C  C     RRD L++H    H +  I
Sbjct: 47  RTFLCFVCQKAFARQEHLDRHLRSHTNEKPFKCAVCDKDFTRRDLLIRHSNKLHSDTAI 105

>KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1290

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 33/63 (52%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           + C++C + F R   L+RH  SH++E+ Y C  C     RRD LL+H    H  N  N +
Sbjct: 75  FVCKVCTRAFARSEHLERHERSHTNEKPYECGICDRMFTRRDLLLRHALKTHNGNCGNTI 134

Query: 460 KLR 462
             R
Sbjct: 135 VKR 137

>KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {ON}
           Anc_8.144 YER130C
          Length = 453

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 393 FDIESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
            D  ++ + C  C+++FKR+  LKRH+ S H  E+ + C  C     R DNL QH+K
Sbjct: 391 LDDGTKQFSCEYCDRRFKRQEHLKRHIRSLHICEKPFHCHICDKHFSRSDNLNQHIK 447

>Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W
           (REAL)
          Length = 777

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           + C IC + F R+  LKRH  +H++E+ +LC +C     RRD +L+H    H
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLH 112

>ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} similar
           to uniprot|P07248 Saccharomyces cerevisiae YDR216W ADR1
           Positive transcriptional regulator controls the
           expression of ADH2 peroxisomal protein genes and genes
           required for ethanol glycerol and fatty acid utilization
          Length = 1346

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNN 454
           + C++C + F R+  L RH  SH+ E+ Y C  C  +  RRD LL+H    H  N
Sbjct: 86  FVCQVCTRAFARQEHLTRHERSHTKEKPYCCGICNRKFSRRDLLLRHAHKIHGGN 140

>KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} similar
           to uniprot|Q74ZT1 Ashbya gossypii AGR117C AGR117Cp and
           some similarites with YER169W uniprot|P39956
           Saccharomyces cerevisiae YER169W RPH1 Transcriptional
           repressor of PHR1 which is a photolyase induced by DNA
           damage binds to AG(4) (C(4)T) sequence upstream of PHR1
           Rph1p phosphorylation during DNA damage is under control
           of the MEC1-RAD53 pathway
          Length = 821

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 393 FDIESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
            D  S+ Y C+ C ++F     L RH  S HS E+ + CP C  + KRRD++LQH+  K 
Sbjct: 748 LDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKI 807

Query: 452 P 452
           P
Sbjct: 808 P 808

>TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144
           YER130C
          Length = 687

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 393 FDIESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           F+  S+ + C  C ++FKR+  LKRH  S H  E+ + C  C  +  R DNL QH+K
Sbjct: 627 FNDPSKIFICPYCNRRFKRQEHLKRHNRSLHMGEKPFDCHICNKKFSRSDNLAQHIK 683

>Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {ON}
           YML081W - Hypothetical ORF [contig 376] FULL
          Length = 1178

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (61%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           + C IC + F R+  LKRH  +H++E+ +LC +C     RRD +L+H +  H
Sbjct: 78  FLCSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLH 129

>KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON}
           similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1128

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (61%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           + C IC + F R+  LKRH  +H++E+ +LC +C     RRD +L+H +  H
Sbjct: 32  FLCSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLH 83

>CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa]
           {ON} weakly similar to uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 463

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 394 DIE-SQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMK 448
           DIE  + Y C++C K F     L RH   H+ E+ ++CP+  C  R  R DN LQH K
Sbjct: 395 DIELRRKYLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYK 452

>TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4.351
           YJR127C
          Length = 1199

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 30/47 (63%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQH 446
           Y C IC + F R+  LKRH  SH++E+ +LC +C     RRD +L+H
Sbjct: 57  YLCPICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRH 103

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 395 IESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMKL 449
           I+   Y C IC KKFKR S L  H+  H+ ++ Y CP   C      + N+L+H KL
Sbjct: 265 IDKIKYDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHISCSKAFNAKSNMLRHYKL 321

>AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER169W
           (RPH1) and YDR096W (GIS1)
          Length = 799

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 36/58 (62%), Gaps = 1/58 (1%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           + ++Y C+ C+++F     L RH  S HS E+ + CP C  + KRRD++LQH+  K P
Sbjct: 728 KGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIP 785

>Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}
           similar to Ashbya gossypii AGR117C
          Length = 819

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 36/58 (62%), Gaps = 1/58 (1%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           + ++Y C+ C+++F     L RH  S HS E+ + CP C  + KRRD++LQH+  K P
Sbjct: 748 KGKAYICQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIP 805

>NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8.234
          Length = 1156

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 400  YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
            Y C  C+++F     L RH  S HS E+ + CP C  + KRRD++LQH+  K P
Sbjct: 998  YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIP 1051

>Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}
           YDR043C (REAL)
          Length = 232

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query: 392 EFDIE-SQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMK 448
           E D+E  + Y C+IC + F     L RH   H+ E+++ CP+  C  R  R DN LQH +
Sbjct: 166 EEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYR 225

>KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.144
           YER130C
          Length = 225

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 394 DIESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           D  ++ + C+ C ++F+R+  +KRH+ S H +E+ Y C  C     R DNL QH K
Sbjct: 165 DDGTKKFACQYCHRRFRRQEHMKRHIRSLHIAEKPYSCQICSKAFSRNDNLKQHRK 220

>KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081W
          Length = 1332

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (61%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           + C IC + F R+  L+RH  SH++E+ +LC +C     RRD +L+H +  H
Sbjct: 83  FLCPICTRGFARQEHLRRHERSHTNEKPFLCAFCGRCFARRDLVLRHQQKLH 134

>KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1053

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 30/54 (55%)

Query: 402 CRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNL 455
           C +C + F R   LKRH  SH+ E+ YLC +C     R+D +L+H    HP  L
Sbjct: 24  CPVCSRGFVRLEHLKRHQRSHTREKPYLCVFCGRCFARKDLVLRHQGKLHPEVL 77

>KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.351
           YJR127C
          Length = 1076

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 38/68 (55%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNL 455
           +S+ + C +C + F R+  LKRH  SH++E+ ++C +C     RRD +L+H    H   +
Sbjct: 48  KSRPFVCSVCTRAFIRQEHLKRHQRSHTNEKPFICVFCGRCFARRDLVLRHQHKLHSALI 107

Query: 456 INELKLRN 463
             EL   N
Sbjct: 108 GTELHHEN 115

>KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518
           YGL209W
          Length = 439

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 389 SMGEFDIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQH 446
           S+ E D E++ Y+C IC + F R    KRHL +H+ E+ + C  P C     R D L +H
Sbjct: 10  SLPEND-ENRPYKCGICSRGFHRLEHKKRHLRTHTGEKPHKCVFPGCTKGFSRGDELKRH 68

Query: 447 MK 448
           ++
Sbjct: 69  LR 70

>KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.281
           YBR066C
          Length = 254

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 398 QSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMKLKHPN-- 453
           + Y C  C K F     L RH   H+ E+++LCP+  C  R  R+DN LQH +    N  
Sbjct: 183 RKYLCTTCTKGFTTSGHLARHKRIHTGEKNHLCPFEGCKQRFSRQDNCLQHYRTHFKNFT 242

Query: 454 --NLINE 458
             NL N+
Sbjct: 243 FTNLANK 249

>CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1321

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%)

Query: 402 CRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           C IC + F R   LKRH  +H++E+ +LC +C     RRD +L+H    HP
Sbjct: 35  CPICTRGFVRLEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQYKLHP 85

>AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR216W (ADR1)
          Length = 1057

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           + C  C + F R+  L RH  SH++E+ Y+C  C  R  RRD LL+H    H  +  + L
Sbjct: 49  FVCHTCTRAFARQEHLIRHKRSHTNEKPYICGICDRRFSRRDLLLRHAHKLHGGSCGDAL 108

>Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa]
           {ON} complement(101434..102513) [1080 nt, 360 aa]
          Length = 359

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMK 448
           + C  C+++FKR+  LKRH+ S H  E+ + C  C  +  R DNL QH+K
Sbjct: 303 FACEHCDRRFKRQEHLKRHVRSLHMGEKPFSCHICEKKFSRSDNLNQHIK 352

 Score = 34.3 bits (77), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 5/36 (13%)

Query: 388 LSMGEFDIESQSYRCRICEKKFKRRSWLKRHLLSHS 423
           L MGE     + + C ICEKKF R   L +H+ +HS
Sbjct: 325 LHMGE-----KPFSCHICEKKFSRSDNLNQHIKTHS 355

>ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON}
           NOHBY437; No homolog in Saccharomyces cerevisiae
          Length = 278

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 393 FDIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMKL 449
           + + ++   C++C ++ +R S LK H+L+H+ +R + C  P C      R N+L+H +L
Sbjct: 197 YSVSTKKNVCKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERL 255

>Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON}
           (58087..59160) [1074 nt, 358 aa]
          Length = 357

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 395 IESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMK 448
           ++ + Y CR+C K       L RH   H+ E+++ CP+  C  R  R DN +QH +
Sbjct: 296 VKRRKYICRVCSKGLTTSGHLARHYRIHTGEKNHFCPYEGCNQRFSRHDNCIQHYR 351

>KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 596

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 27/50 (54%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           Y C IC+KKF R   LK HL SH+ ER Y+C  C     R  +  +H  L
Sbjct: 469 YACDICDKKFTRPYNLKSHLRSHTDERPYVCSVCGKAFARMHDKNRHEDL 518

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 9/58 (15%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLC--------PW-CLSRHKRRDNLLQHMK 448
           Y C +C K F R     RH   H+ +R Y+C         W C  +  R D L +H K
Sbjct: 497 YVCSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGNSWGCGKKFARSDALGRHFK 554

>KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.234
           YER169W
          Length = 784

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           + ++Y C  C++ F     L RH  S HS E+ + CP C  + KRRD++LQH+  K P
Sbjct: 721 QGKTYICVDCKRTFSSGHHLTRHKKSVHSFEKPHSCPKCGKKFKRRDHVLQHLNKKIP 778

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 2/64 (3%)

Query: 398 QSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMKLKHPNNL 455
           +S +C IC K   R S L+ H+L H+ +R + C W  C  R   + N+ +H KL     L
Sbjct: 489 KSRQCHICGKSVTRTSTLQTHMLVHTGDRPFECVWSGCHKRFNVKSNMNRHYKLHLKKQL 548

Query: 456 INEL 459
            NE+
Sbjct: 549 ANEV 552

>TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON}
           Anc_2.303 YNL027W
          Length = 762

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           Y C +C+KKF R   LK HL +H++ER ++C  C     R+ +  +H  L
Sbjct: 651 YACELCDKKFTRPYNLKSHLRTHTNERPFICSICNKAFARQHDRKRHEDL 700

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 9/60 (15%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLC--------PW-CLSRHKRRDNLLQHMKLK 450
           + C IC K F R+   KRH   H+ ++ Y+C         W C  +  R D L +H K +
Sbjct: 679 FICSICNKAFARQHDRKRHEDLHTGKKRYICGGKLKNGTSWGCGKKFARSDALGRHFKTE 738

>Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 30/47 (63%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQH 446
           + C IC + F R+  LKRH  +H++E+ +LC +C     RRD +L+H
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 107

>TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1207

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNN 454
           + C+IC + F R+  L RH  SH+ E+ Y C  C     RRD LL+H    H  N
Sbjct: 59  FVCQICTRAFARQEHLTRHERSHTKEKPYSCGICNRNFSRRDLLLRHAHKVHGGN 113

>YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}
           NRG1Transcriptional repressor that recruits the
           Cyc8p-Tup1p complex to promoters; mediates glucose
           repression and negatively regulates a variety of
           processes including filamentous growth and alkaline pH
           response
          Length = 231

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query: 392 EFDIE-SQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMK 448
           E D+E  + Y C+IC + F     L RH   H+ E+++ CP+  C  R  R DN LQH +
Sbjct: 165 EEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYR 224

>Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii ACR264W
          Length = 775

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           ++C  C K+F +   L+ H+  H+ ER Y C  C  R  R+ NL  HM L H N+   + 
Sbjct: 519 FQCEYCGKRFTQGGNLRTHVRLHTGERPYECDKCGKRFSRKGNLAAHM-LTHENHKPFQC 577

Query: 460 KL 461
           KL
Sbjct: 578 KL 579

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           + C  C K F + + L+ H+ SH   + + C +C  R  +  NL  H++L
Sbjct: 491 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL 540

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMKL 449
           E   Y C+ C K+FKR S L  H+  H+  + Y+CP+  C      + N+L+H KL
Sbjct: 254 EIAKYGCKHCNKRFKRPSSLNTHMNIHTGNKPYVCPYEECRKSFNAKSNMLRHYKL 309

>ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1119

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 30/47 (63%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQH 446
           + C IC + F R+  LKRH  SH++E+ +LC +C     RRD +L+H
Sbjct: 75  FLCSICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRH 121

>Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query: 392 EFDIE-SQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMK 448
           E D+E  + Y C+IC + F     L RH   H+ E+++ CP+  C  R  R DN LQH +
Sbjct: 165 EEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYR 224

>SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]
           {ON} similar to uniprot|P39956 Saccharomyces cerevisiae
           YER169W RPH1 Transcriptional repressor of PHR1 which is
           a photolyase induced by DNA damage binds to AG(4)
           (C(4)T) sequence upstream of PHR1 Rph1p phosphorylation
           during DNA damage is under control of the MEC1-RAD53
           pathway
          Length = 814

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           Y C+ C+++F     L RH  S HS E+ + CP C  + KRRD++LQH+  K P
Sbjct: 718 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIP 771

>KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]
           {ON} some similarities with uniprot|Q03125 Saccharomyces
           cerevisiae YDR043C NRG1 Transcriptional repressor that
           recruits the Cyc8p-Tup1p complex to promoters
          Length = 357

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMKLKHPN 453
           E + Y C+IC + F     L RH   H+ E+ + C  P C  R  R DN +QH +    N
Sbjct: 280 ERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKN 339

Query: 454 NLINE 458
           N + E
Sbjct: 340 NPMPE 344

>KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}
           Anc_3.298
          Length = 394

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMKL 449
           Y C++C K+FKR S L  H+  H+  + Y CP+  C      + N+L+H KL
Sbjct: 278 YCCKVCSKRFKRPSSLSTHMNIHTGYKPYQCPFSNCQKSFNAKSNMLRHYKL 329

>NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234
          Length = 864

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           Y C  C+++F     L RH  S HS E+ + CP C  + KRRD++LQH+  K P
Sbjct: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIP 818

>Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {ON}
           YER169W (RPH1) - Repressor of PHR1 transcription; binds
           to PHR1 URS [contig 177] FULL
          Length = 828

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           Y C+ C ++F     L RH  S HS E+ + CP C  + KRRD++LQH+  K P
Sbjct: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIP 788

>Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 30/47 (63%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQH 446
           + C IC + F R+  LKRH  +H++E+ +LC +C     RRD +L+H
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 107

>Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)
          Length = 400

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 393 FDIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMK 448
            D E++ +RC  C + F R    KRHL +H+ E+ + C  P C     R D L +HM+
Sbjct: 10  VDNENRPFRCDTCNRGFHRLEHKKRHLRTHTGEKPHHCGFPGCGKSFSRSDELKRHMR 67

>YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}
           TDA9DNA-binding protein, putative transcription factor;
           green fluorescent protein (GFP)-fusion protein localizes
           to the nucleus; null mutant is sensitive to expression
           of the top1-T722A allele; not an essential gene
          Length = 1251

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 30/47 (63%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQH 446
           + C IC + F R+  LKRH  +H++E+ +LC +C     RRD +L+H
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 107

>YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc finger
           transcriptional repressor; cooperates with Mig1p in
           glucose-induced repression of many genes including SUC2
           (invertase); binds to Mig1p-binding sites in SUC2
           promoter; under low glucose conditions Mig2p relocalizes
           to mitochondrion, where it regulates morphology,
           interacts with Ups1p and antagonizes mitochondrial
           fission factor, Dnm1p, indicative of a role in promoting
           mitochondrial fusion or regulating morphology
          Length = 382

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 393 FDIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMK 448
            D E++ +RC  C + F R    KRHL +H+ E+ + C  P C     R D L +HM+
Sbjct: 10  VDNENRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMR 67

>KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169W RPH1 Transcriptional repressor of
           PHR1 which is a photolyase induced by DNA damage binds
           to AG(4) (C(4)T) sequence upstream of PHR1 Rph1p
           phosphorylation during DNA damage is under control of
           the MEC1-RAD53 pathway
          Length = 832

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           Y C+ C ++F     L RH  S HS E+ + CP C  + KRRD++LQH+  K P
Sbjct: 739 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIP 792

>CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some
           similarities with uniprot|P38704 Saccharomyces
           cerevisiae YHR006w SPT2 or uniprot|Q00947 Saccharomyces
           cerevisiae YDR463w STP1
          Length = 688

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 12/71 (16%)

Query: 393 FDIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW----------CLSR--HKRR 440
            D + + + C  C+ KF+ R +L RH+  H+ E+ Y CP+          C +     RR
Sbjct: 191 LDDDEKEFVCHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFYNGQEVPSKRCHNSGGFSRR 250

Query: 441 DNLLQHMKLKH 451
           D    HMK +H
Sbjct: 251 DTYKTHMKARH 261

>Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON}
           (43237..43899) [663 nt, 221 aa]
          Length = 220

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMK 448
           + C+ C +KF     L RH   H+ E++++CP+  C  R  R DN LQH K
Sbjct: 161 FECKTCGRKFTTSGHLTRHNRIHTGEKNHVCPFEGCNLRFSRNDNSLQHYK 211

>ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR113W (AZF1)
          Length = 769

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPN 453
           ++C  C K+F +   L+ H+  H+ ER Y C  C  R  R+ NL  HM L H N
Sbjct: 515 FQCEYCGKRFTQGGNLRTHVRLHTGERPYECDKCGKRFSRKGNLAAHM-LTHEN 567

 Score = 37.7 bits (86), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 27/50 (54%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           ++C  C K F + + L+ H+ SH   + + C +C  R  +  NL  H++L
Sbjct: 487 HKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL 536

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 18/31 (58%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLC 430
           Y C  C K+F R+  L  H+L+H + + + C
Sbjct: 543 YECDKCGKRFSRKGNLAAHMLTHENYKPFQC 573

>Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)
          Length = 382

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 393 FDIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMK 448
            D E++ +RC  C + F R    KRHL +H+ E+ + C  P C     R D L +HM+
Sbjct: 10  VDNENRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMR 67

>NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {ON}
           Anc_4.351
          Length = 1362

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           + C  C + F R+  LKRH  SH++E+ +LC +C     RRD +L+H    H
Sbjct: 71  FVCSTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLH 122

>Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON}
           (33422..34600) [1179 nt, 393 aa]
          Length = 392

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 395 IESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMKL 449
           I+++ Y C IC K F+R    KRH+ +H+ E+ ++C +  C     R D L +HM +
Sbjct: 22  IDNRPYICEICTKGFRRLEHKKRHIRTHTGEKPHVCTFQGCPKSFSRSDELKRHMNI 78

>NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa]
           {ON} Anc_4.351
          Length = 1537

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           + C  C + F R   LKRH  SH+ E+ YLC +C     RRD +L+H    H
Sbjct: 45  FLCPTCTRGFVRLEHLKRHERSHTQEKPYLCIFCGRCFARRDLVLRHQTKLH 96

>Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W
           (REAL)
          Length = 383

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 394 DIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMK 448
           D E++ +RC  C + F R    KRHL +H+ E+ + C  P C     R D L +HM+
Sbjct: 11  DNENRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMR 67

>Skud_10.351 Chr10
           complement(617553..621332,621389..621469,621466..621510,
           621543..621620) [3984 bp, 1327 aa] {ON} YJR127C (REAL)
          Length = 1327

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           + C  C + F R+  LKRH  SH+ E+ YLC +C     RRD +L+H +  H
Sbjct: 104 FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLH 155

>Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON}
           YPL230W (REAL)
          Length = 386

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 398 QSYRCRI---CEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           +S++C     C   F R   L RH+  H+ E+ + CP CL    R DNL QH +  H
Sbjct: 39  KSFKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 95

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 8/61 (13%)

Query: 391 GEFDIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMK 448
           G+ DI      C  C K+F R S L+ H+L HS ++ + C W  C  +   + NL++H+K
Sbjct: 229 GKADI------CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLK 282

Query: 449 L 449
           L
Sbjct: 283 L 283

>Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query: 392 EFDIE-SQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMK 448
           E D+E  + Y C+IC + F     L RH   H+ E+++ CP+  C  R  R DN LQH +
Sbjct: 165 EEDLELRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYR 224

>Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa]
           {ON} complement(264361..265350) [990 nt, 330 aa]
          Length = 329

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 388 LSMGEFDI-ESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLL 444
           +S+ + DI E + Y CR+C K       L RH   H+ E+ + CP+  C  R  RRDN  
Sbjct: 250 VSLLKGDIAERRKYYCRVCGKGLTTSGHLSRHYRIHTGEKKHCCPFEGCNQRFSRRDNCS 309

Query: 445 QH 446
           QH
Sbjct: 310 QH 311

>Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa]
           {ON} YJR127C (REAL)
          Length = 1270

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           + C  C + F R+  LKRH  SH+ E+ YLC +C     RRD +L+H +  H
Sbjct: 36  FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLH 87

>YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putative
           transcription factor containing a C2H2 zinc finger;
           mutation affects transcriptional regulation of genes
           involved in growth on non-fermentable carbon sources,
           response to salt stress and cell wall biosynthesis
          Length = 391

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 398 QSYRCRI---CEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           ++++C     C   F R   L RH+  H+ E+ + CP CL    R DNL QH +  H
Sbjct: 39  KTFKCTGYDGCTMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 95

>NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa]
           {ON} Anc_3.518
          Length = 426

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 394 DIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMK 448
           D + + +RC+ C + F R    KRH+ +H+ E+ ++C  P C     RRD L +H++
Sbjct: 15  DNDERPFRCQFCSRGFHRLEHKKRHVRTHTGEKPHVCNFPHCKKGFSRRDELKRHIR 71

>TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.303
           YNL027W
          Length = 532

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           Y C ICEKKF R   L+ HL +H++ER ++C  C     R  +  +H  L
Sbjct: 420 YDCVICEKKFTRPYNLRSHLRTHTNERPFVCTVCGKAFAREHDRKRHEDL 469

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 29/69 (42%), Gaps = 9/69 (13%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLC--------PW-CLSRHKRRDNLLQHMKLK 450
           + C +C K F R    KRH   H+ ++ Y+C         W C  +  R D L +H K +
Sbjct: 448 FVCTVCGKAFAREHDRKRHEDLHTGKKRYICGGKLKSGEAWGCGKKFARSDALGRHFKTE 507

Query: 451 HPNNLINEL 459
                I  L
Sbjct: 508 SGKKCITPL 516

>TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON} 
          Length = 454

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 402 CRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           C  C + F     L RH  + H +E+ + CP C  R KRRD++LQH+  K P
Sbjct: 392 CYECCRSFSSSHHLTRHKKTVHLNEKPFSCPRCRKRFKRRDHVLQHLNKKIP 443

>Smik_10.420 Chr10
           complement(647997..651776,651798..651836,651840..652019,
           652023..652070) [4047 bp, 1348 aa] {ON} YJR127C (REAL)
          Length = 1348

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           + C  C + F R+  LKRH  SH+ E+ YLC +C     RRD +L+H +  H
Sbjct: 125 FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLH 176

>CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} similar
           to uniprot|P46974 Saccharomyces cerevisiae YJR127c ZMS1
           or uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1020

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           + C IC + F R+  LKRH  SH+ E+ +LC  C     R+D +L+H++  H
Sbjct: 27  FLCPICSRGFVRQEHLKRHQNSHTHEKPFLCLICGKCFARKDLVLRHLQKLH 78

>YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}
           RSF2Zinc-finger protein involved in transcriptional
           control of both nuclear and mitochondrial genes, many of
           which specify products required for glycerol-based
           growth, respiration, and other functions
          Length = 1380

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           + C  C + F R+  LKRH  SH+ E+ YLC +C     RRD +L+H +  H
Sbjct: 151 FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLH 202

>TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.80
           YGL035C
          Length = 350

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 402 CRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMKL 449
           C IC++ F+R     RHL +H+ E+ + C  P C  R  R D L +H ++
Sbjct: 31  CPICQRAFRRLEHQTRHLRTHTGEKPHACDFPGCAKRFSRSDELTRHRRI 80

>TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON}
           Anc_8.234 YER169W
          Length = 519

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 395 IESQSYRCRICEKKFKRRSWLKRHLLS-HSSERHYLCPWCLSRHKRRDNLLQHMKLKHP 452
           I   SY C  C + F     L RH  + H +E+ + CP C  R KRRD++LQH+  K P
Sbjct: 443 INPSSY-CFECRRSFSSSHHLTRHRKTVHLNEKPFSCPKCGKRFKRRDHVLQHLNKKIP 500

>Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON}
           similar to Ashbya gossypii ADR308C
          Length = 276

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 402 CRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMKL 449
           C++C ++ +R S LK H+L+H+ +R + C  P C      R N+L+H +L
Sbjct: 215 CKVCGRECRRPSTLKTHMLTHTGQRPFCCRHPGCNKSFNVRSNMLRHERL 264

>KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1119

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNN 454
           + C +C + F R   L RH   H+ E+ Y C  C  ++ RRD LL+H+   H  N
Sbjct: 53  FVCEVCTRAFARHEHLIRHERQHTKEKPYHCGVCERKYGRRDLLLRHVIKMHGGN 107

>TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {ON}
           Anc_2.162 YOR113W
          Length = 823

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 4/60 (6%)

Query: 395 IESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNL----LQHMKLK 450
           I  + Y+C  C KKF +   LK H   H+ E+ Y C  C  R  R+ NL    L H KLK
Sbjct: 540 IGYKPYQCNFCGKKFTQGGNLKTHQRLHTGEKPYSCKICNKRFSRKGNLTAHVLTHKKLK 599

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMKLKHPNNLI 456
           Y C+IC K+F R+  L  H+L+H   + Y C    C     +  N+  H    H N LI
Sbjct: 573 YSCKICNKRFSRKGNLTAHVLTHKKLKPYFCKLDNCNKTFTQLGNMKAHQNKFHYNTLI 631

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 29/54 (53%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           + ++++C  C + F + + L+ H+ SH   + Y C +C  +  +  NL  H +L
Sbjct: 513 KKKTHQCPYCHRFFSQSTHLEVHIRSHIGYKPYQCNFCGKKFTQGGNLKTHQRL 566

>KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.256
           YPL230W
          Length = 311

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 3/65 (4%)

Query: 398 QSYRCR---ICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNN 454
           +S+ C     C   F R   L RH+  H+ E+ + C  C     R DNL QH +  H N 
Sbjct: 16  KSFTCHGYGDCHMTFARAEHLARHVRRHTGEKPFECNVCFKHFSRVDNLKQHKETVHANV 75

Query: 455 LINEL 459
            I+E+
Sbjct: 76  FIDEM 80

>SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 819

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPN 453
           ++C  C K+F +   L+ H   H+ E+ Y C  C  R  R+ NL  HM L H N
Sbjct: 568 FQCEYCGKRFTQGGNLRTHTRLHTGEKPYSCEKCGKRFSRKGNLAAHM-LTHEN 620

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           + C  C K F + + L+ H+ SH   + + C +C  R  +  NL  H +L
Sbjct: 540 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHTRL 589

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 3/65 (4%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMKLKHPNNLIN 457
           Y C  C K+F R+  L  H+L+H + + Y C    C     +  NL  H    H   L N
Sbjct: 596 YSCEKCGKRFSRKGNLAAHMLTHENLKPYHCKLDGCSKSFTQLGNLKAHQNRFHLQTL-N 654

Query: 458 ELKLR 462
           +L  R
Sbjct: 655 QLTQR 659

>Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W
           (REAL)
          Length = 392

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 24/47 (51%)

Query: 405 CEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           C   F R   L RH+  H+ E+ + CP CL    R DNL QH +  H
Sbjct: 52  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 98

>KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 307

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 4/63 (6%)

Query: 390 MGEFDIES--QSYRCRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQ 445
           MG    ES  + ++C +C K F R    +RH+ +H+ E+ + C  P C+ R  R D L +
Sbjct: 1   MGVAQQESDHRPFKCDMCGKGFHRLEHKRRHIRTHTGEKPHACNFPGCVKRFSRSDELKR 60

Query: 446 HMK 448
           H++
Sbjct: 61  HVR 63

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 8/66 (12%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           Y+C  C K F +   LK H+  H+ E+ + C +C  R  R+ NL  H        L+   
Sbjct: 416 YKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEFCSKRFSRKGNLTAH--------LVTHE 467

Query: 460 KLRNFI 465
           K+R F+
Sbjct: 468 KVRPFV 473

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           + C IC K F + + L+ HL SH  ++ Y C WC     +  NL  H++L
Sbjct: 388 HECNICHKLFIQLTHLEVHLRSHLGDKPYKCTWCGKGFTQGGNLKTHVRL 437

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 3/65 (4%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMKLKHPNNLIN 457
           + C  C K+F R+  L  HL++H   R ++C    C+    +  N+  H    H N L  
Sbjct: 444 FSCEFCSKRFSRKGNLTAHLVTHEKVRPFVCKLNGCMKTFTQLGNMKSHQNRFHQNTLT- 502

Query: 458 ELKLR 462
           EL  R
Sbjct: 503 ELTRR 507

>SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {ON}
           similar to uniprot|Q750L1 Ashbya gossypii AGR031W
           AGR031Wp and some similarites with YDR043C
           uniprot|Q03125 Saccharomyces cerevisiae YDR043C NRG1
           Transcriptional repressor that recruits the Cyc8p-Tup1p
           complex to promoters mediates glucose repression and
           negatively regulates a variety of processes including
           filamentous growth and alkaline pH response
          Length = 157

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMK 448
           + + Y C+IC + F     L RH   H+ E++++CP+  C  R  R DN +QH +
Sbjct: 96  QRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYR 150

>KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.303
           YNL027W
          Length = 519

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%)

Query: 398 QSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           Q Y C +C+KKF R   LK HL +H++ER + C  C     R+ +  +H  L
Sbjct: 395 QLYTCEVCDKKFTRPYNLKSHLRTHTNERPFACTICGKAFARQHDRKRHEDL 446

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 9/58 (15%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLC--------PW-CLSRHKRRDNLLQHMK 448
           + C IC K F R+   KRH   HS ++ Y C        PW C  +  R D L +H K
Sbjct: 425 FACTICGKAFARQHDRKRHEDLHSGKKRYACGGKLKSGIPWGCGKKFARSDALGRHFK 482

>CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} similar
           to uniprot|P27705 Saccharomyces cerevisiae YGL035c MIG1
           transcriptional repressor
          Length = 424

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 391 GEFDIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMK 448
           G+ D   + + C IC + F R     RH+ +H+ E+ + C  P C+ R  R D L +H +
Sbjct: 34  GKGDDAPRPHVCPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRR 93

Query: 449 L 449
           +
Sbjct: 94  I 94

>KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 526

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           Y C +C+KKF R   LK HL +H+ ER + C  C     R+ +  +H  L
Sbjct: 408 YACELCDKKFTRPYNLKSHLRTHTDERPFACAICGKAFARQHDRKRHEDL 457

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 29/69 (42%), Gaps = 9/69 (13%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCP--------W-CLSRHKRRDNLLQHMKLK 450
           + C IC K F R+   KRH   H+ ++ Y C         W C  +  R D L +H K +
Sbjct: 436 FACAICGKAFARQHDRKRHEDLHTGKKRYTCKGKLKDGTQWGCGKKFARSDALGRHFKTE 495

Query: 451 HPNNLINEL 459
                I  L
Sbjct: 496 GGKRCIAPL 504

>Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W
           (REAL)
          Length = 398

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 24/47 (51%)

Query: 405 CEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           C   F R   L RH+  H+ E+ + CP CL    R DNL QH +  H
Sbjct: 49  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 95

>KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {ON}
           Anc_3.518 YGL209W
          Length = 416

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 394 DIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMK 448
           D + + ++C IC + F R     RH+++H+ E+ + C  P C+ +  R D L +H K
Sbjct: 12  DNDRRPFKCDICSRGFHRLEHKNRHIMTHTGEKPHQCSFPGCVKKFSRGDELKRHAK 68

>ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {ON}
           some similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 171

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 394 DIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMK 448
           D + + +RC IC + F R    KRH+ +H+ E+ + C  P C     R D L +H++
Sbjct: 8   DNDDRPFRCEICNRGFHRLEHKKRHIRTHTGEKPHKCSFPGCGKSFSRSDELKRHLR 64

>KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 782

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459
           + C  C K+F +   L+ H+  H+ E+ Y C  C  +  R+ NL  H KL H N    E 
Sbjct: 551 FSCEFCGKRFTQGGNLRTHIRLHTGEKPYECERCGRKFSRKGNLAAH-KLTHDNLKPFEC 609

Query: 460 KL 461
           KL
Sbjct: 610 KL 611

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 27/50 (54%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           ++C  C K F + + L+ H+ SH   + + C +C  R  +  NL  H++L
Sbjct: 523 FQCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEFCGKRFTQGGNLRTHIRL 572

>Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {ON}
           YDR043C (NRG1) - transcriptional repressor which can
           bind to UAS-1 in the STA1 promoter and which can
           interact with Ssn6p [contig 33] FULL
          Length = 264

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCP--WCLSRHKRRDNLLQHMK 448
           + + Y C+IC K F     L RH   H+ E++++CP   C  R  R DN +QH K
Sbjct: 197 QRRRYVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQHYK 251

>NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80
          Length = 493

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 402 CRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMKL 449
           C +C++ F R     RHL +H+ E+  +C  P C+ R  R D L +H ++
Sbjct: 45  CPVCQRAFHRLEHQTRHLRTHTGEKPNVCDFPGCIKRFSRSDELTRHKRI 94

>SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {ON}
           some similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 548

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           Y C +C+KKF R   LK HL +H+ ER + C  C     R+ +  +H  L
Sbjct: 424 YACELCDKKFTRPYNLKSHLRTHTDERPFACNVCGKAFARQHDRKRHEDL 473

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 9/58 (15%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLC--------PW-CLSRHKRRDNLLQHMK 448
           + C +C K F R+   KRH   H+ ++ Y+C         W C  +  R D L +H K
Sbjct: 452 FACNVCGKAFARQHDRKRHEDLHTGKKRYICGGNLKDGTSWGCGKKFARSDALGRHFK 509

>SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P27705 Saccharomyces
           cerevisiae YGL035C MIG1 Transcription factor involved in
           glucose repression; C2H2 zinc finger protein similar to
           mammalian Egr and Wilms tumor proteins
          Length = 548

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMKL 449
           Y C IC + F R     RH+ +H+ E+ + C  P C  R  R D L +H ++
Sbjct: 34  YVCPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTRI 85

>Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa]
           {ON} YGL209W (MIG2) - 1:1 [contig 188] FULL
          Length = 266

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMK 448
           ++C +C K F R    +RH+ +H+ E+ + C  P C+ R  R D L +H++
Sbjct: 14  FKCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVR 64

>KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.303
           YNL027W
          Length = 618

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           Y C +C+KKF R   LK HL +H++ER ++C  C     R+ +  +H  L
Sbjct: 499 YACDMCDKKFTRPYNLKSHLRTHTNERPFVCSICGKAFARQHDRKRHEDL 548

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 9/69 (13%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLC--------PW-CLSRHKRRDNLLQHMKLK 450
           + C IC K F R+   KRH   HS ++ Y+C         W C  +  R D L +H K +
Sbjct: 527 FVCSICGKAFARQHDRKRHEDLHSGKKRYICGGTLKDGTKWGCGKKFARSDALGRHFKTE 586

Query: 451 HPNNLINEL 459
                I+ L
Sbjct: 587 AGKRCISLL 595

>NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256
          Length = 274

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 24/47 (51%)

Query: 405 CEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           C   F R   L RH+  H+ E+ + C  CL R  R DNL QH +  H
Sbjct: 27  CHMAFTRAEHLARHIRKHTGEKPFQCDVCLKRFSRVDNLKQHRESVH 73

>NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {ON}
           Anc_3.518
          Length = 524

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 394 DIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMK 448
           D + + ++C +C + F R    KRH+ +H+ E+ + C  P C     R D L +H++
Sbjct: 12  DNDERPFKCDVCSRGFHRLEHKKRHMRTHTGEKPHHCNFPGCGKSFSRSDELKRHLR 68

>NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518
          Length = 401

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 394 DIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMK 448
           D + + +RC  C + F R    KRH+ +H+ E+ + C  P C     R D L +H++
Sbjct: 12  DNDERPFRCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLR 68

>KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1255

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           + C  C + F R+  LKRH  SH+ ER +LC  C     R+D +L+H +  H
Sbjct: 49  FLCPTCTRGFVRQEHLKRHQRSHTRERPFLCVLCGRCFARKDLVLRHQQKLH 100

>Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa]
           {ON} complement(127243..128337) [1095 nt, 365 aa]
          Length = 364

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMKL 449
           Y C +C KKFKR S L  H   H+  + Y CP   C      + N+L+H KL
Sbjct: 276 YSCDVCGKKFKRPSSLNTHTNIHTGNKPYSCPAAKCKKAFNAKSNMLRHYKL 327

>KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON}
           Anc_5.586 YHR006W
          Length = 442

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 15/75 (20%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW----------CLSR--HKRRDNL 443
           + +++ C  C+ KFK R +L RH+  H+ E+ + CP+          C S     RRD  
Sbjct: 118 DEEAFICHYCDAKFKIRGYLTRHIRKHAIEKAFKCPYFNATLPKTLRCHSTGGFSRRDTF 177

Query: 444 LQHMKLKH---PNNL 455
             H+K +H   PN++
Sbjct: 178 KIHLKSRHFIFPNDV 192

>NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {ON} 
          Length = 650

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 12/68 (17%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWC-------LSRH-----KRRDNL 443
           E  ++ C  C+ KF+ R +L RH+  H+ E+ Y CP+        L  H      RRD  
Sbjct: 269 EEGTFVCHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFFNNDALPELRCHNSGGFSRRDTY 328

Query: 444 LQHMKLKH 451
             H+K +H
Sbjct: 329 KTHLKARH 336

>Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa]
           {ON} complement(131384..133768) [2385 nt, 795 aa]
          Length = 794

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 4/55 (7%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNL----LQHMKLK 450
           ++C  C K+F +   L+ H   H+ ER Y C  C  +  R+ NL    L H KLK
Sbjct: 536 FQCEYCGKRFTQGGNLRTHQRLHTGERPYSCELCGKKFSRKGNLAAHFLTHQKLK 590

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 2/59 (3%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMKLKHPNNLI 456
           Y C +C KKF R+  L  H L+H   + Y+C    C     +  N+  H    H N L+
Sbjct: 564 YSCELCGKKFSRKGNLAAHFLTHQKLKPYVCKLDECNKSFTQLGNMKAHQNRFHLNTLM 622

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 25/50 (50%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           + C  C + F + + L+ H+ SH   + + C +C  R  +  NL  H +L
Sbjct: 508 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHQRL 557

>TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMKL 449
           + C IC K F+R    KRH+ +H+ E+ + C +  C+ +  R D L +H+K+
Sbjct: 13  FICDICSKGFRRLEHKKRHIRTHTGEKPHHCTFKGCVKKFSRSDELKRHLKI 64

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 401 RCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMK 448
           +C IC+K   R + LK HLL H+ +  + CPW  C      + N+L+H+K
Sbjct: 150 QCHICKKICSRPATLKTHLLIHTGDTPFKCPWENCPKSFNVKSNMLRHLK 199

>Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {ON}
           YNL027W (CRZ1) - putative transcription factor [contig
           27] FULL
          Length = 531

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           Y C +C+KKF R   LK HL +H+ ER + C  C     R+ +  +H  L
Sbjct: 413 YACELCDKKFTRPYNLKSHLRTHTDERPFSCAICGKAFARQHDRKRHEDL 462

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 29/69 (42%), Gaps = 9/69 (13%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLC--------PW-CLSRHKRRDNLLQHMKLK 450
           + C IC K F R+   KRH   H+ ++ Y C         W C  +  R D L +H K +
Sbjct: 441 FSCAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHFKTE 500

Query: 451 HPNNLINEL 459
                I  L
Sbjct: 501 GGKRCIAPL 509

>NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {ON}
           Anc_5.586
          Length = 532

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 12/64 (18%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW----CLSRHK--------RRDNLLQHM 447
           + C  C+ KF+ R +L RH+  H+ E+ Y CP+     LS  +        RRD    H+
Sbjct: 183 FICHYCDAKFRIRGYLTRHIKKHAVEKAYHCPFFNSDILSESRCHNTGGFSRRDTYKTHL 242

Query: 448 KLKH 451
           K +H
Sbjct: 243 KARH 246

>KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON}
           Anc_3.281 YBR066C
          Length = 224

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 402 CRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMK 448
           C++C   F     L RH   H+ E+ Y+CP+  C  R  R DN +QH K
Sbjct: 160 CKVCTMAFTTSGHLSRHNKIHTGEKKYVCPFEGCGQRFSRHDNCVQHHK 208

>Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON}
           (235260..238010) [2751 nt, 917 aa]
          Length = 916

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%)

Query: 402 CRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           C  C + F RR  LKRH  +H+ E+ ++C +C     RRD +++H    H
Sbjct: 43  CPTCSRGFVRREHLKRHQRAHTKEKPFVCVFCGRCFARRDLIIRHQNKLH 92

>NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531
          Length = 354

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMK 448
           ++C IC+K   R + L+ HLL H+ E+ Y C W  C +    + N+ +H K
Sbjct: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYK 346

>NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON}
           Anc_2.162
          Length = 1064

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451
           ++C  C K+F +   L+ H   H+ E+ Y C  C  R  R+ NL  H KL H
Sbjct: 628 FQCNFCGKRFTQGGNLRTHQRLHTGEKPYRCEICDKRFSRKGNLAAH-KLTH 678

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLC 430
           YRC IC+K+F R+  L  H L+H   + ++C
Sbjct: 656 YRCEICDKRFSRKGNLAAHKLTHRDVKPFVC 686

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 27/53 (50%)

Query: 397 SQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           S+ + C  C + F + + L+ H+ SH   + + C +C  R  +  NL  H +L
Sbjct: 597 SKQHECPYCHRLFSQSTHLEVHIRSHLGYKPFQCNFCGKRFTQGGNLRTHQRL 649

>CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa]
           {ON} some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 348

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 401 RCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMKL 449
           +C +C K   R S LK H L H+ +  + CPW  C      + N+L+H+K 
Sbjct: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKC 336

>ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL027W (CRZ1)
          Length = 547

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           Y C +C+KKF R   LK HL +H+ ER + C  C     R+ +  +H  L
Sbjct: 426 YSCNLCDKKFTRPYNLKSHLRTHTDERPFSCSVCGKAFARQHDRKRHEDL 475

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 30/69 (43%), Gaps = 9/69 (13%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLC--------PW-CLSRHKRRDNLLQHMKLK 450
           + C +C K F R+   KRH   HS ++ Y+C         W C  +  R D L +H K +
Sbjct: 454 FSCSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATWGCGKKFARSDALGRHFKTE 513

Query: 451 HPNNLINEL 459
                I  L
Sbjct: 514 SGRRCIAPL 522

>AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No
           homolog in Saccharomyces cerevisiae
          Length = 277

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 398 QSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMKL 449
           Q Y C  C K F R S L+ H   H+ +R + CP+  C      R N+L+H KL
Sbjct: 181 QRYVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKL 234

>KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.162
           YOR113W
          Length = 729

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHM 447
           Y+C+ C KKF +   L+ H   H+ E+ Y C  C  R  R+ NL  H+
Sbjct: 521 YQCQYCGKKFTQGGNLRTHERLHTGEKPYQCELCGKRFSRKGNLAAHV 568

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           + CR C + F + + L+ H+ SH   + Y C +C  +  +  NL  H +L
Sbjct: 493 HECRYCHRFFTQLTHLEVHIRSHIGIKPYQCQYCGKKFTQGGNLRTHERL 542

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 20/31 (64%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLC 430
           Y+C +C K+F R+  L  H+L+H   + ++C
Sbjct: 549 YQCELCGKRFSRKGNLAAHVLTHKKIKPFIC 579

>Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113W
           (AZF1) - similar to Zn-finger transcription factors
           [contig 204] FULL
          Length = 786

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 395 IESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPN 453
           I  + ++C  C K+F +   L+ H+  H+ E+ Y C  C  R  R+ NL  H +L H N
Sbjct: 526 IGYKPFQCEYCGKRFTQGGNLRTHVRLHTGEKPYECEKCGRRFSRKGNLAAH-RLTHEN 583

 Score = 37.7 bits (86), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 28/53 (52%)

Query: 397 SQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           ++ + C  C K F + + L+ H+ SH   + + C +C  R  +  NL  H++L
Sbjct: 500 AKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL 552

>NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3.281
          Length = 330

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 392 EFDIE-SQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMK 448
           E D+E  + Y C++C K F     L RH   H+ E+ + C +  C  +  R DN LQH +
Sbjct: 261 EEDLEHRRKYLCKVCSKGFTTSGHLARHNRIHTGEKSHACHFAGCTQKFSRHDNCLQHYR 320

>Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar to
           Ashbya gossypii AGR031W
          Length = 257

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMK 448
           + + +RC+ C+K F     L RH   H+ E+++ C  P C  R  R DN LQH +
Sbjct: 189 KRRKHRCQTCDKGFTTSGHLARHNRIHTGEKNHRCHFPGCGQRFSRHDNCLQHYR 243

>Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii ADL042W
          Length = 305

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 7/57 (12%)

Query: 399 SYR-----CRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMK 448
           SYR     C IC K FKR S L+ H++ H++++ Y C    C  R   + N+L+HM+
Sbjct: 243 SYRKSGSICEICGKDFKRPSALRTHMVVHNNDKPYKCEHIDCQKRFNVKSNMLRHMR 299

>KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 391 GEFDIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMK 448
           G+  +  + Y C +C K+FKR S L  H   H+ ++ + CP   C      R N+L+H K
Sbjct: 224 GKDGLYRKKYCCNVCGKRFKRPSSLSTHTNIHTGKKPFHCPLAKCTKTFNARSNMLRHYK 283

>KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.518
           YGL209W
          Length = 391

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 394 DIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMK 448
           D + + +RC +C++ F R    KRH+ +H+ E+ + C  P C     R D L +H +
Sbjct: 11  DNDQRPFRCELCQRGFHRLEHKKRHVRTHTGEKPHACTFPGCEKHFSRSDELKRHSR 67

>SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON}
           uniprot|Q875P4 Saccharomyces kluyveri STP1
          Length = 517

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 14/74 (18%)

Query: 392 EFDIESQ--SYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSR------------H 437
           E D E Q   Y C  C+ +F+ R +L RH+  H+ E+ Y CP+  S+             
Sbjct: 152 EIDDEEQRGKYVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSKLPPESRCHTTGGF 211

Query: 438 KRRDNLLQHMKLKH 451
            RRD    H+K +H
Sbjct: 212 SRRDTYKTHLKSRH 225

>NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 393 FDIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMKL 449
           FD E   Y C +C K F+R S L+ H    S  R Y CP+  C      + N+L+H KL
Sbjct: 233 FD-EKLGYFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKL 290

>Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar to
           Ashbya gossypii ADL198W
          Length = 560

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           Y C +C KKF R   LK HL +H+ ER + C  C     R+ +  +H  L
Sbjct: 438 YSCDLCNKKFTRPYNLKSHLRTHTDERPFACNMCGKAFARQHDRKRHEDL 487

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 9/58 (15%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLC--------PW-CLSRHKRRDNLLQHMK 448
           + C +C K F R+   KRH   HS ++ Y+C         W C  +  R D L +H K
Sbjct: 466 FACNMCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKDGTSWGCGKKFARSDALGRHFK 523

>NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303
          Length = 571

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%)

Query: 397 SQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           S +Y C +C+K F R   LK HL +H++E+ ++C  C     R+ +  +H  L
Sbjct: 449 SGAYACELCDKTFTRPYNLKSHLRTHTNEKPFVCNICGKAFARQHDRKRHEDL 501

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 9/58 (15%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLC--------PW-CLSRHKRRDNLLQHMK 448
           + C IC K F R+   KRH   H+ ++ Y+C        PW C  +  R D L +H K
Sbjct: 480 FVCNICGKAFARQHDRKRHEDLHTGKKRYVCGGVLKNGTPWGCHKKFARSDALGRHFK 537

>KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 393 FDIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMKL 449
            D  ++ ++C +C++ F R    KRH+ +H+ E+ Y C  P C     R D L +H K+
Sbjct: 10  LDNNTRPFKCPLCQRGFHRLEHKKRHVRTHTGEKPYKCSFPDCPKSFSRTDELKRHSKI 68

>KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 768

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 395 IESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPN 453
           I  + ++C  C K+F +   L+ H+  H+ E+ Y C  C  R  R+ NL  H +L H N
Sbjct: 509 IGYKPFQCEYCGKRFTQGGNLRTHVRLHTGEKPYECEKCGRRFSRKGNLAAH-RLTHEN 566

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 28/53 (52%)

Query: 397 SQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKL 449
           ++ + C  C K F + + L+ H+ SH   + + C +C  R  +  NL  H++L
Sbjct: 483 AKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL 535

>CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some
           similarities with uniprot|Q00947 Saccharomyces
           cerevisiae YDR463w STP1
          Length = 359

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 12/68 (17%)

Query: 396 ESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWC-------LSRH-----KRRDNL 443
           E + + C  C+ +FK R +L RH+  H+ ++ Y CP+        L  H      RRD  
Sbjct: 37  EQEEFVCHYCDARFKIRGYLTRHIKKHALQKAYYCPYYNEKAPPDLRCHNNGGFSRRDTY 96

Query: 444 LQHMKLKH 451
             HMK +H
Sbjct: 97  KAHMKTRH 104

>KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.162
           YOR113W
          Length = 796

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQH 446
           + C+ C K+F +   L+ H   H+ E+ Y C  C  R  R+ NL  H
Sbjct: 500 FECQFCGKRFTQGGNLRTHQRLHTGEKPYACQHCSKRFSRKGNLAAH 546

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 26/59 (44%), Gaps = 2/59 (3%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW--CLSRHKRRDNLLQHMKLKHPNNLI 456
           Y C+ C K+F R+  L  H L+H   + +LC    C     +  N+  H    H   ++
Sbjct: 528 YACQHCSKRFSRKGNLAAHQLTHREVKPFLCKLDNCGKTFAQLGNMKNHQNRFHSQTVL 586

>KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {ON}
           some similarities with uniprot|P27705 Saccharomyces
           cerevisiae YGL035C
          Length = 460

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLC--PWCLSRHKRRDNLLQHMKL 449
           Y C IC + F R     RH+ +H+ E+ + C  P C  +  R D L +H ++
Sbjct: 26  YICPICSRAFHRLEHQTRHIRTHTGEKPHACDFPGCTKKFSRSDELTRHKRI 77

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,583,907
Number of extensions: 2215890
Number of successful extensions: 8808
Number of sequences better than 10.0: 636
Number of HSP's gapped: 8765
Number of HSP's successfully gapped: 796
Length of query: 541
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 427
Effective length of database: 40,409,475
Effective search space: 17254845825
Effective search space used: 17254845825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)