Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0H013107.126ON26126112860.0
KAFR0K012007.126ON2021606224e-81
SAKL0F05368g7.126ON2312576192e-80
KNAG0G010207.126ON2071506139e-80
CAGL0C03850g7.126ON2092045921e-76
Kpol_1062.577.126ON2191765922e-76
NCAS0F008107.126ON2312625923e-76
YIL010W (DOT5)7.126ON2151725904e-76
Skud_9.1627.126ON2171535871e-75
TDEL0H028807.126ON3541665981e-75
KLLA0D14333g7.126ON2051605852e-75
Suva_9.1947.126ON2151515826e-75
Smik_9.1847.126ON2141935801e-74
Ecym_83517.126ON2241505767e-74
TBLA0A009407.126ON2881855819e-74
ZYRO0C05214g7.126ON2701475746e-73
ADL018W7.126ON2441505717e-73
TPHA0C043307.126ON2091605522e-70
KLTH0F12562g7.126ON2931585392e-67
Kwal_55.208397.126ON3051495306e-66
KLLA0E20285g7.388ON24980770.23
SAKL0F12320g7.388ON24880720.89
NCAS0E026307.388ON231110711.1
ZYRO0A07876g2.365ON44095711.6
Ecym_46877.388ON25280682.7
Smik_2.527.388ON26180682.7
SAKL0F03168g3.479ON70687675.2
KLTH0C06798g7.388ON24948665.3
Suva_2.537.388ON26148657.4
YBL064C (PRX1)7.388ON26148648.6
NDAI0E042007.388ON25448649.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0H01310
         (261 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.12...   499   0.0  
KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {O...   244   4e-81
SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {O...   243   2e-80
KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON...   240   9e-80
CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {O...   232   1e-76
Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {...   232   2e-76
NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.12...   232   3e-76
YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear...   231   4e-76
Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W (...   230   1e-75
TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.1...   234   1e-75
KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa] ...   229   2e-75
Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W (...   228   6e-75
Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W (...   228   1e-74
Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON} ...   226   7e-74
TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.12...   228   9e-74
ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some si...   225   6e-73
ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic hom...   224   7e-73
TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON...   217   2e-70
KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} simil...   212   2e-67
Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W...   208   6e-66
KLLA0E20285g Chr5 (1803791..1804540) [750 bp, 249 aa] {ON} simil...    34   0.23 
SAKL0F12320g Chr6 (963021..963767) [747 bp, 248 aa] {ON} highly ...    32   0.89 
NCAS0E02630 Chr5 complement(526821..527516) [696 bp, 231 aa] {ON...    32   1.1  
ZYRO0A07876g Chr1 complement(638258..639580) [1323 bp, 440 aa] {...    32   1.6  
Ecym_4687 Chr4 complement(1340392..1341150) [759 bp, 252 aa] {ON...    31   2.7  
Smik_2.52 Chr2 complement(94285..95070) [786 bp, 261 aa] {ON} YB...    31   2.7  
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...    30   5.2  
KLTH0C06798g Chr3 complement(590991..591740) [750 bp, 249 aa] {O...    30   5.3  
Suva_2.53 Chr2 complement(97422..98207) [786 bp, 261 aa] {ON} YB...    30   7.4  
YBL064C Chr2 complement(100371..101156) [786 bp, 261 aa] {ON}  P...    29   8.6  
NDAI0E04200 Chr5 complement(949094..949858) [765 bp, 254 aa] {ON...    29   9.3  

>NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.126
           YIL010W
          Length = 261

 Score =  499 bits (1286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/261 (95%), Positives = 249/261 (95%)

Query: 1   MVMELRRSGRVTAGKRTFDEDTDNHVEXXXXXXXXXXXXSPSKKLLVSEKKVIKNAGSIN 60
           MVMELRRSGRVTAGKRTFDEDTDNHVE            SPSKKLLVSEKKVIKNAGSIN
Sbjct: 1   MVMELRRSGRVTAGKRTFDEDTDNHVEKRKKIATQKAKKSPSKKLLVSEKKVIKNAGSIN 60

Query: 61  GRETKKETKPRSVVEDKVDGIEHEEVKKVKFDEQQVSDKSANNDSIIELEIGDDIPDITL 120
           GRETKKETKPRSVVEDKVDGIEHEEVKKVKFDEQQVSDKSANNDSIIELEIGDDIPDITL
Sbjct: 61  GRETKKETKPRSVVEDKVDGIEHEEVKKVKFDEQQVSDKSANNDSIIELEIGDDIPDITL 120

Query: 121 SNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDELKKNAIVFGLSADA 180
           SNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDELKKNAIVFGLSADA
Sbjct: 121 SNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDELKKNAIVFGLSADA 180

Query: 181 ISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFVEGKLSIKRIKVSP 240
           ISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFVEGKLSIKRIKVSP
Sbjct: 181 ISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFVEGKLSIKRIKVSP 240

Query: 241 EISVAESKKEVIEFAKKLSEA 261
           EISVAESKKEVIEFAKKLSEA
Sbjct: 241 EISVAESKKEVIEFAKKLSEA 261

>KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {ON}
           Anc_7.126 YIL010W
          Length = 202

 Score =  244 bits (622), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 110/160 (68%), Positives = 143/160 (89%)

Query: 100 SANNDSIIELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACG 159
           S+ N S  EL+IGD +PDITL NQ+ ++ISL+E+AK NKI+V+FA+P+ASTPGCTRQACG
Sbjct: 42  SSGNVSSSELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACG 101

Query: 160 FRDNYDELKKNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGT 219
           FRDNYDE+KK+A VFGLSAD++ SQK+F+EKQ+LP++LLSDPKR+LIG+LGAKKTPQSG 
Sbjct: 102 FRDNYDEIKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGI 161

Query: 220 VRSYWIFVEGKLSIKRIKVSPEISVAESKKEVIEFAKKLS 259
           +RS+W+F++GKL  + IKVSPE S++ESKKEV+E A+K S
Sbjct: 162 IRSHWVFLDGKLRFRNIKVSPERSISESKKEVMELAEKNS 201

>SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {ON}
           highly similar to gnl|GLV|KLLA0D14333g Kluyveromyces
           lactis KLLA0D14333g and similar to YIL010W
           uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 231

 Score =  243 bits (619), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 126/257 (49%), Positives = 164/257 (63%), Gaps = 34/257 (13%)

Query: 2   VMELRRSGRVTAGKRTFDEDTDNHVEXXXXXXXXXXXXSPSKKLLVSEKKVIKNAGSING 61
           ++ELRRS R+ A K+                        P+KKL +S K           
Sbjct: 1   MVELRRSNRLAASKKL-------------GKGEKPSVEPPAKKLKISRK----------- 36

Query: 62  RETKKETKPRSVVEDKVDGIEHEEVKKVKFDEQQVSDKSANNDSIIELEIGDDIPDITLS 121
                     +  EDK++    +EV+    D+ +       N +  ELE+GDDIPD+ L 
Sbjct: 37  ----------NKSEDKIEDKTEDEVQDKPADKSEDEPTEEPNPASSELEVGDDIPDLILK 86

Query: 122 NQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDELKKNAIVFGLSADAI 181
           NQ+ K+ISLKE+AK N+I+V FA+P+ASTPGCTRQ CG+RDNY++LK++A VFGLSAD  
Sbjct: 87  NQDDKDISLKELAKKNRIVVFFAYPKASTPGCTRQVCGYRDNYEDLKEHAAVFGLSADTT 146

Query: 182 SSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFVEGKLSIKRIKVSPE 241
            +QK F+ KQ LPYDLLSDPKR+ IGLLGAKKTPQSG +RS+W+F EGKL  KR+K+SPE
Sbjct: 147 KAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTPQSGVIRSHWVFSEGKLRFKRVKISPE 206

Query: 242 ISVAESKKEVIEFAKKL 258
            SVA+ KKEV+E AK L
Sbjct: 207 TSVADGKKEVLELAKDL 223

>KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON}
           Anc_7.126 YIL010W
          Length = 207

 Score =  240 bits (613), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 109/150 (72%), Positives = 130/150 (86%)

Query: 109 LEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDELK 168
           LEIGD+IPD+TL +Q G+ +SL E+A  NKI+VIFA+PRASTPGCTRQACGFRDNY ELK
Sbjct: 58  LEIGDEIPDLTLVDQEGELVSLTEVASNNKILVIFAYPRASTPGCTRQACGFRDNYAELK 117

Query: 169 KNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFVE 228
           K+A V+GLSAD ++SQKKF+ KQ+LPY+LLSDPKR+ IG+LGAKKT QSG +RSYWIF  
Sbjct: 118 KHAAVYGLSADTVASQKKFQTKQNLPYNLLSDPKREFIGVLGAKKTSQSGIIRSYWIFFN 177

Query: 229 GKLSIKRIKVSPEISVAESKKEVIEFAKKL 258
           GKL IK+IKVSPE SVAESK EV+E  K+L
Sbjct: 178 GKLRIKKIKVSPEASVAESKAEVLELVKEL 207

>CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {ON}
           similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010w DOT5 involved in derepression of telomeric
           silencing
          Length = 209

 Score =  232 bits (592), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 156/204 (76%), Gaps = 12/204 (5%)

Query: 60  NGRETKKE----TKPRSVVEDKVDGIEHEEVKKVKFDEQQVSDKSANNDSIIELEIGDDI 115
           +G E K E     K +SV+++KV+    E VKK    E++VS     +D  I LE+GDDI
Sbjct: 13  HGNEVKDEGPIKKKAKSVLKEKVN--TKEPVKKPNTKEEKVS-----SDEAI-LEVGDDI 64

Query: 116 PDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDELKKNAIVFG 175
           PDITL NQ+GK++SLK +AK NK+I+IF +P+ASTPGCTRQACGFRDN+D+LK++ +V G
Sbjct: 65  PDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLKEHGLVLG 124

Query: 176 LSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFVEGKLSIKR 235
           LS D  ++Q KF+EK  LPYDLL DP R+ IG+LGAKKTP SG++RS+++F +GKL  KR
Sbjct: 125 LSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFADGKLKFKR 184

Query: 236 IKVSPEISVAESKKEVIEFAKKLS 259
           +K+SPEISVA+ KKEV+E AK+ S
Sbjct: 185 LKISPEISVADGKKEVLELAKQYS 208

>Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {ON}
           complement(128150..128809) [660 nt, 220 aa]
          Length = 219

 Score =  232 bits (592), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 112/176 (63%), Positives = 143/176 (81%), Gaps = 3/176 (1%)

Query: 85  EVKKVKFDEQQVSDKSANNDS-IIELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIF 143
           +V+  K D+++   K+ N  S I E+EIGD+IPD+ L NQ+G +ISL+++AK N I+V F
Sbjct: 45  DVRVTKVDDKE--SKAENKPSGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFF 102

Query: 144 AFPRASTPGCTRQACGFRDNYDELKKNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKR 203
           A+PRA TPGCTRQACGFRD YD+LKK+A VFGLSAD+  SQKKF++K  LPYDLLSDPKR
Sbjct: 103 AYPRAMTPGCTRQACGFRDTYDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKR 162

Query: 204 QLIGLLGAKKTPQSGTVRSYWIFVEGKLSIKRIKVSPEISVAESKKEVIEFAKKLS 259
           + IGLLGAKKTPQSG +RS++IFV+GKL  KRIK+SPEISV + KKEV+E  ++ S
Sbjct: 163 EFIGLLGAKKTPQSGIIRSHFIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEEFS 218

>NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.126
           YIL010W
          Length = 231

 Score =  232 bits (592), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 138/262 (52%), Positives = 179/262 (68%), Gaps = 41/262 (15%)

Query: 2   VMELRRSGRVTAGKRTF---DEDTDNHVEXXXXXXXXXXXXSPS-KKLLVSEKK--VIKN 55
           ++ELRRSGR++  K+T    +ED++                 P+ KK  VS+ K  VIK 
Sbjct: 1   MVELRRSGRISTLKKTHFLTEEDSEE--------------VKPAIKKQRVSKTKKIVIKK 46

Query: 56  AGSINGRETKKETKPRSVVEDKVDGIEHEEVKKVK-FDEQQVSDKSANNDSII-ELEIGD 113
           +   NG+      KP      K+DG E E VK VK  D   V     N DSI  EL+IGD
Sbjct: 47  S---NGK-----MKP------KLDGKE-EIVKSVKELDSTAVK----NTDSIYKELQIGD 87

Query: 114 DIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDELKKNAIV 173
           DIPDI L ++ G  +SLK++ + NKI+V FAFP+A+TPGCTRQACGFRDNY ELK++A V
Sbjct: 88  DIPDIILPDEEGVSVSLKKVVEENKIVVFFAFPKANTPGCTRQACGFRDNYKELKEHAAV 147

Query: 174 FGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFVEGKLSI 233
           +G+SAD +++QKKF+ KQ+LPY LLSD KR  IGLLGAKKTPQSG +RSY+IFV+GKL +
Sbjct: 148 YGISADPVTAQKKFKTKQNLPYSLLSDSKRDFIGLLGAKKTPQSGVIRSYFIFVDGKLKV 207

Query: 234 KRIKVSPEISVAESKKEVIEFA 255
           KR+K+SPE+SV E++KEV  FA
Sbjct: 208 KRVKISPELSVEEARKEVSAFA 229

>YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear
           thiol peroxidase which functions as an
           alkyl-hydroperoxide reductase during post-diauxic growth
          Length = 215

 Score =  231 bits (590), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 108/172 (62%), Positives = 139/172 (80%), Gaps = 1/172 (0%)

Query: 90  KFDEQQVSDKSANNDS-IIELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRA 148
           K +  Q   + AN  S + ELEIGD IPD++L N++   ISLK+I + N+++V F +PRA
Sbjct: 43  KHNANQAVVQEANRSSDVNELEIGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRA 102

Query: 149 STPGCTRQACGFRDNYDELKKNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGL 208
           STPGCTRQACGFRDNY ELKK A VFGLSAD+++SQKKF+ KQ+LPY LLSDPKR+ IGL
Sbjct: 103 STPGCTRQACGFRDNYQELKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGL 162

Query: 209 LGAKKTPQSGTVRSYWIFVEGKLSIKRIKVSPEISVAESKKEVIEFAKKLSE 260
           LGAKKTP SG++RS++IFV+GKL  KR+K+SPE+SV ++KKEV+E A+K  E
Sbjct: 163 LGAKKTPLSGSIRSHFIFVDGKLKFKRVKISPEVSVNDAKKEVLEVAEKFKE 214

>Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W
           (REAL)
          Length = 217

 Score =  230 bits (587), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 134/153 (87%)

Query: 108 ELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDEL 167
           ELEIGD IPD++L +++   ISLKEIAK NKI+V F +P+ASTPGCTRQACGFRDNY++L
Sbjct: 62  ELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDL 121

Query: 168 KKNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFV 227
           KK+A VFGLSAD ++SQKKF+ KQ+LPY L+SDPKR+ IGLLGAKKTP SG++RS+++FV
Sbjct: 122 KKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHFVFV 181

Query: 228 EGKLSIKRIKVSPEISVAESKKEVIEFAKKLSE 260
            GKL  KRIK+SPE+SV+++KKEV+E A+++ E
Sbjct: 182 NGKLRFKRIKISPEVSVSDAKKEVLEIAERVEE 214

>TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.126
           YIL010W
          Length = 354

 Score =  234 bits (598), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 135/166 (81%)

Query: 93  EQQVSDKSANNDSIIELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPG 152
           E  V++ S       EL+IGD+IPD+TL NQ+GK++SL+++AK +KII+IFA+P+ASTPG
Sbjct: 186 ETDVAEDSDQTAQSTELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPG 245

Query: 153 CTRQACGFRDNYDELKKNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAK 212
           CTRQACG+RDNYDELK++A VFGLS D  S+QKKF+ KQ LP+DLL DP R LIG LGAK
Sbjct: 246 CTRQACGYRDNYDELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAK 305

Query: 213 KTPQSGTVRSYWIFVEGKLSIKRIKVSPEISVAESKKEVIEFAKKL 258
           KT QSGT+RS+W+F +GKL  KR+KVSPE+S+ + KKEV+E A  L
Sbjct: 306 KTAQSGTLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEVLELAASL 351

>KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa]
           {ON} similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010W DOT5 Nuclear thiol peroxidase
          Length = 205

 Score =  229 bits (585), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 107/160 (66%), Positives = 130/160 (81%), Gaps = 3/160 (1%)

Query: 102 NNDS---IIELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQAC 158
           N DS   + EL+IGDDIPD+TL NQ+ + ISLKE+A  NK++V FA+P+ASTPGCTRQAC
Sbjct: 46  NEDSANKLAELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQAC 105

Query: 159 GFRDNYDELKKNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSG 218
           G+RDNY ELK++A VFGLSADA  SQK F+ KQ LP+DLLSDPKR+ IG LGAKKT  SG
Sbjct: 106 GYRDNYSELKEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSG 165

Query: 219 TVRSYWIFVEGKLSIKRIKVSPEISVAESKKEVIEFAKKL 258
            VRS+WIF  GKL +KR++VSPE+S+ E KKEV+E AK L
Sbjct: 166 VVRSHWIFKNGKLEVKRVQVSPEVSIEEGKKEVLELAKSL 205

>Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W
           (REAL)
          Length = 215

 Score =  228 bits (582), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 101/151 (66%), Positives = 132/151 (87%)

Query: 108 ELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDEL 167
           EL++GDDIPD++L N++   +SLKEIAK NKI+V F +P+ASTPGCTRQACGFRDNY++L
Sbjct: 62  ELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDL 121

Query: 168 KKNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFV 227
           K++A VFGLSAD++ SQKKF+ KQ LPY LLSDPKR+ IGLLGAKKTP SG++RS+++FV
Sbjct: 122 KEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFV 181

Query: 228 EGKLSIKRIKVSPEISVAESKKEVIEFAKKL 258
           +GKL  KR+K+SPE+SV ++KKEV+E A+K 
Sbjct: 182 DGKLRFKRVKISPEVSVGDAKKEVMELAEKF 212

>Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W
           (REAL)
          Length = 214

 Score =  228 bits (580), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 111/193 (57%), Positives = 153/193 (79%), Gaps = 7/193 (3%)

Query: 75  EDKVDGIEHEEV--KKVKFDEQ----QVSDKSANNDSI-IELEIGDDIPDITLSNQNGKE 127
           E K D I   EV  K+VK D +    +  D+  N+ S   EL+IGD IPD++L +++   
Sbjct: 22  ESKFDPISPPEVLKKRVKTDLKVKVSETEDQGDNSASTSTELKIGDPIPDLSLLSEDNDS 81

Query: 128 ISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDELKKNAIVFGLSADAISSQKKF 187
           ISLK+IA+ NKI+V F +P+ASTPGCTRQACGFRDNYD+LKK++ VFGLS+D+++SQK+F
Sbjct: 82  ISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDNYDDLKKHSAVFGLSSDSVTSQKRF 141

Query: 188 EEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFVEGKLSIKRIKVSPEISVAES 247
           + KQ+LPY LLSDPKR+ IGLLGAKKTP SG++RS+++FV+GKL  KR+K+SPE+SV ++
Sbjct: 142 QTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVNDA 201

Query: 248 KKEVIEFAKKLSE 260
           KKE++E A+K+ E
Sbjct: 202 KKEILELAEKVKE 214

>Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADL018W
          Length = 224

 Score =  226 bits (576), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 130/150 (86%)

Query: 108 ELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDEL 167
           ELE+GD++P+I L NQ+ KE++LK++AK NKI++IFA+P+A+TPGCTRQACGFRDNY+EL
Sbjct: 70  ELEVGDNVPEIALKNQDDKEVNLKDVAKKNKIVLIFAYPKANTPGCTRQACGFRDNYEEL 129

Query: 168 KKNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFV 227
           +K+A++FG+S+D++ SQK F+ KQHLP+DLLSDP R+LIG+LGAKKT Q+G +RS+WIF 
Sbjct: 130 QKHAVIFGISSDSVKSQKAFQSKQHLPFDLLSDPDRELIGMLGAKKTAQAGVIRSHWIFC 189

Query: 228 EGKLSIKRIKVSPEISVAESKKEVIEFAKK 257
            GKL  KR+KVSPE S++E  +EV+   KK
Sbjct: 190 NGKLKYKRVKVSPETSISEGLEEVLGLIKK 219

>TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.126
           YIL010W
          Length = 288

 Score =  228 bits (581), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 144/185 (77%), Gaps = 11/185 (5%)

Query: 87  KKVKFDEQQVSDKSANND-----------SIIELEIGDDIPDITLSNQNGKEISLKEIAK 135
           KKV  +E++V DK A+ D           S+ ELE+GD++PD  L NQN + ISLK++ +
Sbjct: 94  KKVSTEEKEVKDKKASTDEKESKEKKDEPSVKELEVGDEVPDFELKNQNNETISLKKVME 153

Query: 136 TNKIIVIFAFPRASTPGCTRQACGFRDNYDELKKNAIVFGLSADAISSQKKFEEKQHLPY 195
            N+I+VIFA+P+A+TPGCTRQACG RDNY++LKK A+VFG+SAD++S+QK F+EKQ+LPY
Sbjct: 154 ENRIVVIFAYPKANTPGCTRQACGMRDNYNDLKKYAVVFGISADSVSAQKSFQEKQNLPY 213

Query: 196 DLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFVEGKLSIKRIKVSPEISVAESKKEVIEFA 255
           DLLSD  R+LIG LG KKTP SG +RS++I V GKL  KR+K+SPE+SV++ KKEV+E +
Sbjct: 214 DLLSDKNRELIGALGCKKTPTSGIIRSHFIIVNGKLKFKRVKISPEVSVSDCKKEVLEIS 273

Query: 256 KKLSE 260
           K  S+
Sbjct: 274 KSESD 278

>ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some
           similarities with uniprot|P40553 Saccharomyces
           cerevisiae YIL010W DOT5 Nuclear thiol peroxidase
          Length = 270

 Score =  225 bits (574), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 128/147 (87%)

Query: 112 GDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDELKKNA 171
           GD IPDI L NQ+GKEISLK+++  +KI+VIF +P+ASTPGCTRQACGFRDNY+++K++A
Sbjct: 95  GDPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHA 154

Query: 172 IVFGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFVEGKL 231
            VFGLSAD +++QKKF+EKQHLP+DLLSDP+R L+GLLGAKK+P+SG +RS+W+F +G L
Sbjct: 155 AVFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVL 214

Query: 232 SIKRIKVSPEISVAESKKEVIEFAKKL 258
             KR+K+SPE+S+ E KKEV+E  K+ 
Sbjct: 215 KHKRVKISPEVSIEEGKKEVLELVKQF 241

>ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL010W (DOT5)
          Length = 244

 Score =  224 bits (571), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 129/150 (86%)

Query: 108 ELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDEL 167
           EL++GD +P+ITL NQ+  ++ L ++ K NKI+V+FA+P+ASTPGCTRQACGFRDNY EL
Sbjct: 86  ELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYPKASTPGCTRQACGFRDNYQEL 145

Query: 168 KKNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFV 227
           +K+A+VFG+SAD++ SQK F++KQ LP+DLLSDPKR+LIG LGA+KT Q+G +RS+W+FV
Sbjct: 146 QKHAVVFGISADSVKSQKSFQQKQKLPFDLLSDPKRELIGALGARKTAQTGVIRSHWVFV 205

Query: 228 EGKLSIKRIKVSPEISVAESKKEVIEFAKK 257
           +GKL  KRIK+SPE+S+A+   EV+ FAKK
Sbjct: 206 DGKLGSKRIKISPEMSIADGLSEVLLFAKK 235

>TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON}
           Anc_7.126 YIL010W
          Length = 209

 Score =  217 bits (552), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 132/160 (82%), Gaps = 1/160 (0%)

Query: 99  KSANNDSIIELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQAC 158
           K    D   E+++GD+IPD+TL NQ G+E+SL+++A+ NKII IF +PRASTPGCTRQAC
Sbjct: 51  KETQKDDYEEIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQAC 110

Query: 159 GFRDNYDELKKNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSG 218
           GFRDN+D+LKK +++ GLS D+I++QK F+ KQ+LPYDLL D +++LI +LG KK P SG
Sbjct: 111 GFRDNFDDLKKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-SG 169

Query: 219 TVRSYWIFVEGKLSIKRIKVSPEISVAESKKEVIEFAKKL 258
            +RSY+IFV+GKL +KR+KVSPE+S+ ESKKE+++  K+L
Sbjct: 170 IIRSYFIFVDGKLKLKRVKVSPEVSITESKKEILDLVKEL 209

>KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} similar
           to uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 293

 Score =  212 bits (539), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 102/158 (64%), Positives = 130/158 (82%), Gaps = 1/158 (0%)

Query: 99  KSANNDSIIELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQAC 158
           K+  N S  ELE GD++PD+ L NQ G+E+SLK + + NK++V+FA+P+ASTPGCT+QAC
Sbjct: 34  KAKTNGSKGELEEGDEVPDVVLKNQEGEEVSLKSVVQQNKVVVVFAYPKASTPGCTKQAC 93

Query: 159 GFRDNYDELKKNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSG 218
           GFRDNY+ELKKNA VFGLS D  ++Q+KF+EK  LP+DLLSDP+R+LIG LGA K+P SG
Sbjct: 94  GFRDNYEELKKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SG 152

Query: 219 TVRSYWIFVEGKLSIKRIKVSPEISVAESKKEVIEFAK 256
           T RSYW+FV+GKL  KRI VSPE SV+E+KKE IE A+
Sbjct: 153 TKRSYWVFVQGKLRTKRISVSPEASVSEAKKEAIEAAQ 190

>Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W
           (DOT5) - involved in telomeric silencing [contig 138]
           FULL
          Length = 305

 Score =  208 bits (530), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 124/149 (83%), Gaps = 1/149 (0%)

Query: 108 ELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDEL 167
           ELE+GD++PD+ L NQ+ +E+SLK++A+ NK+++IF++P+ASTPGCT QACGFRDNY++L
Sbjct: 46  ELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYEDL 105

Query: 168 KKNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFV 227
           K+   VFGLSAD  ++Q+KF++   LP+DLLSDPKR+LIGLLGAKK+P SGT RS+W+F 
Sbjct: 106 KEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSP-SGTKRSHWVFA 164

Query: 228 EGKLSIKRIKVSPEISVAESKKEVIEFAK 256
            GKL  KRI VSPE+S+ ++K E  E AK
Sbjct: 165 NGKLINKRIAVSPEVSIRDAKTEAHEAAK 193

>KLLA0E20285g Chr5 (1803791..1804540) [750 bp, 249 aa] {ON} similar
           to uniprot|P34227 Saccharomyces cerevisiae YBL064C PRX1
           Mitochondrial peroxiredoxin (1-Cys Prx) with thioredoxin
           peroxidase activity has a role in reduction of
           hydroperoxides induced during respiratory growth and
           under conditions of oxidative stress
          Length = 249

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

Query: 109 LEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDEL- 167
           L I    P+ T     GK ++  E    N   V+F+ P   TP CT +   F     E  
Sbjct: 38  LRINSVAPNFTADTTAGK-VNFHEYIG-NSWAVLFSHPADFTPVCTTELGAFAKLKPEFD 95

Query: 168 KKNAIVFGLSADAISSQKKF 187
           ++N  + GLSA+ I S +K+
Sbjct: 96  QRNVKLIGLSAEGIESHQKW 115

>SAKL0F12320g Chr6 (963021..963767) [747 bp, 248 aa] {ON} highly
           similar to gnl|GLV|KLLA0E20383g Kluyveromyces lactis
           KLLA0E20383g and similar to YBL064C uniprot|P34227
           Saccharomyces cerevisiae YBL064C PRX1 Mitochondrial
           peroxiredoxin (1-Cys Prx) with thioredoxin peroxidase
           activity has a role in reduction of hydroperoxides
           induced during respiratory growth and under conditions
           of oxidative stress
          Length = 248

 Score = 32.3 bits (72), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 3/80 (3%)

Query: 109 LEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDEL- 167
           L I    P+ T +   GK I   E    +   V+F+ P   TP CT +   F     E  
Sbjct: 37  LRINSLAPNFTANTTQGK-IDFHEYIG-DSWTVLFSHPADFTPVCTTELGAFAKLKPEFD 94

Query: 168 KKNAIVFGLSADAISSQKKF 187
           K+N  + GLSA+ +   K++
Sbjct: 95  KRNVKLIGLSAEGVEKHKEW 114

>NCAS0E02630 Chr5 complement(526821..527516) [696 bp, 231 aa] {ON}
           Anc_7.388
          Length = 231

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 48/110 (43%), Gaps = 13/110 (11%)

Query: 102 NNDSIIELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFR 161
           N  ++  L +    P+ T ++  G  ++L E    +   ++F+ P   TP CT +   F 
Sbjct: 8   NTRALSTLRLNSRAPNFTAASTVG-PLNLHEYLG-DSWGILFSHPADFTPVCTTEMGAFA 65

Query: 162 DNYDEL-KKNAIVFGLSADAISSQKKF----------EEKQHLPYDLLSD 200
               E  K+N  + GLS +++ S  K+            KQ  P+ ++ D
Sbjct: 66  QLKPEFDKRNVKLVGLSLESVESHDKWIKDIQEVAKLPSKQPFPFPIIGD 115

>ZYRO0A07876g Chr1 complement(638258..639580) [1323 bp, 440 aa] {ON}
           similar to uniprot|Q12229 YDL091c Saccharomyces
           cerevisiae UBX3 UBX domain-containing protein that
           interacts with Cdc48p
          Length = 440

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 46/95 (48%), Gaps = 6/95 (6%)

Query: 52  VIKNAGSINGRETKKETK---PRSVVEDKVDGIEHEEVKKVKFDEQQVSDKSANNDSIIE 108
           ++K   +I+G   KK ++   P+S + + ++ ++HE  + +    Q V+  +   +S+  
Sbjct: 82  LLKPLCNISGFYKKKNSRLSDPKSQLNNLLETLDHESQRTLNPSVQDVNTPTYTFESLYS 141

Query: 109 LEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIF 143
           LE G   PDI    Q G    L   ++  K  +I+
Sbjct: 142 LEHGSLAPDIV---QGGYADLLNACSEQCKFAIIY 173

>Ecym_4687 Chr4 complement(1340392..1341150) [759 bp, 252 aa] {ON}
           similar to Ashbya gossypii AGR368W
          Length = 252

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

Query: 109 LEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDELK 168
           L +    P+ T    +GK ++L E    N   ++F+ P   TP CT +   F     E +
Sbjct: 40  LRVNSVAPNFTAETTDGK-LNLYEYFG-NSWGILFSHPADFTPVCTTELGAFAKLKPEFE 97

Query: 169 KNAI-VFGLSADAISSQKKF 187
           K  + + GLSA+ +    K+
Sbjct: 98  KRDVKLIGLSAEGVEKHHKW 117

>Smik_2.52 Chr2 complement(94285..95070) [786 bp, 261 aa] {ON}
           YBL064C (REAL)
          Length = 261

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 3/80 (3%)

Query: 109 LEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDEL- 167
           L I  D P+       GK I+  +    N   V+F+ P   TP CT +   F     E  
Sbjct: 49  LRINSDAPNFDADTTVGK-INFYDYLG-NSWGVLFSHPADFTPVCTTEVSAFAKLKPEFD 106

Query: 168 KKNAIVFGLSADAISSQKKF 187
           K+N  + GLS + + S +K+
Sbjct: 107 KRNVKLIGLSVEDVESHEKW 126

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (51%), Gaps = 19/87 (21%)

Query: 53  IKNAGSINGRETKKETKPRSVVEDKVDGIEHEEVKKV--KFDE-----QQVSDKSANNDS 105
           +KNA  IN  E K +T        K+D +++E++KKV  K DE     ++++ +   ND 
Sbjct: 169 VKNAAEINSLEGKYKT--------KIDTLKYEKIKKVEIKRDELLKEVEEINAQILANDR 220

Query: 106 IIELEIGDDIPDITLSNQNGKEISLKE 132
           I    +   + D  L + N KEI L+E
Sbjct: 221 I----LSQLLDDCKLKHSNDKEIWLRE 243

>KLTH0C06798g Chr3 complement(590991..591740) [750 bp, 249 aa] {ON}
           similar to uniprot|P34227 Saccharomyces cerevisiae
           YBL064C PRX1 Mitochondrial peroxiredoxin (1-Cys Prx)
           with thioredoxin peroxidase activity has a role in
           reduction of hydroperoxides induced during respiratory
           growth and under conditions of oxidative stress
          Length = 249

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 141 VIFAFPRASTPGCTRQACGFRDNYDEL-KKNAIVFGLSADAISSQKKF 187
           V+F+ P   TP CT +   F     E  K+N  + GLSA+ +   +K+
Sbjct: 68  VLFSHPADFTPVCTTELGAFAQLKPEFEKRNVKLIGLSAEEVDKHQKW 115

>Suva_2.53 Chr2 complement(97422..98207) [786 bp, 261 aa] {ON}
           YBL064C (REAL)
          Length = 261

 Score = 29.6 bits (65), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 141 VIFAFPRASTPGCTRQACGFRDNYDEL-KKNAIVFGLSADAISSQKKF 187
           V+F+ P   TP CT +   F     E  K+N  + GLS + + S +K+
Sbjct: 79  VLFSHPADFTPVCTTEVSAFAKLKPEFDKRNVKLIGLSVEDVESHQKW 126

>YBL064C Chr2 complement(100371..101156) [786 bp, 261 aa] {ON}
           PRX1Mitochondrial peroxiredoxin (1-Cys Prx) with
           thioredoxin peroxidase activity, has a role in reduction
           of hydroperoxides; reactivation requires Trr2p and
           glutathione; induced during respiratory growth and
           oxidative stress; phosphorylated
          Length = 261

 Score = 29.3 bits (64), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 141 VIFAFPRASTPGCTRQACGFRDNYDEL-KKNAIVFGLSADAISSQKKF 187
           V+F+ P   TP CT +   F     E  K+N  + GLS + + S +K+
Sbjct: 79  VLFSHPADFTPVCTTEVSAFAKLKPEFDKRNVKLIGLSVEDVESHEKW 126

>NDAI0E04200 Chr5 complement(949094..949858) [765 bp, 254 aa] {ON}
           Anc_7.388
          Length = 254

 Score = 29.3 bits (64), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 141 VIFAFPRASTPGCTRQACGFRDNYDEL-KKNAIVFGLSADAISSQKKF 187
           V+F+ P   TP CT +   F     E  K+N  + GLS + + S  K+
Sbjct: 58  VLFSHPADFTPVCTTEMSAFAKLKPEFDKRNVKLIGLSVEDVESHNKW 105

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.130    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,768,588
Number of extensions: 1158827
Number of successful extensions: 4359
Number of sequences better than 10.0: 122
Number of HSP's gapped: 4443
Number of HSP's successfully gapped: 122
Length of query: 261
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 154
Effective length of database: 41,212,137
Effective search space: 6346669098
Effective search space used: 6346669098
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 64 (29.3 bits)