Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G057501.319ON73473437310.0
NCAS0A092101.319ON71072519020.0
Suva_6.1371.319ON71873613641e-179
YJL061W (NUP82)1.319ON71372813461e-176
Smik_10.1791.319ON71373013181e-172
ZYRO0G20680g1.319ON69272713081e-171
Skud_10.1581.319ON71672813011e-169
KAFR0A017201.319ON71668612821e-166
TDEL0D018801.319ON69173211981e-154
KNAG0C058401.319ON74773510891e-137
Kpol_1035.241.319ON71773010291e-129
TBLA0F013101.319ON74274510091e-125
SAKL0D06930g1.319ON6907219611e-119
Kwal_14.25801.319ON6877188731e-106
TPHA0O014601.319ON7217348571e-103
KLTH0H10692g1.319ON6917338481e-102
CAGL0J05214g1.319ON7167287812e-92
Ecym_62901.319ON6716116522e-74
AEL168C1.319ON6737316294e-71
KLLA0F01661g1.319ON6876284475e-46
NDAI0G032308.52ON49959752.0
CAGL0J07656g1.119ON95275752.6
Skud_4.4048.323ON53552716.2
TDEL0H013101.260ON52555717.3
SAKL0G19030g2.637ON911104709.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G05750
         (734 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON} Anc_1...  1441   0.0  
NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa] ...   737   0.0  
Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON...   530   e-179
YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Link...   523   e-176
Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061...   512   e-172
ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]...   508   e-171
Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {...   505   e-169
KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {O...   498   e-166
TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.3...   466   e-154
KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON} Anc_1...   424   e-137
Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {O...   400   e-129
TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {O...   393   e-125
SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {...   374   e-119
Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {O...   340   e-106
TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {...   334   e-103
KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {...   331   e-102
CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa] ...   305   2e-92
Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar t...   255   2e-74
AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON} S...   246   4e-71
KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {...   176   5e-46
NDAI0G03230 Chr7 complement(760895..762394) [1500 bp, 499 aa] {O...    33   2.0  
CAGL0J07656g Chr10 complement(748336..751194) [2859 bp, 952 aa] ...    33   2.6  
Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W ...    32   6.2  
TDEL0H01310 Chr8 (224588..226165) [1578 bp, 525 aa] {ON} Anc_1.2...    32   7.3  
SAKL0G19030g Chr7 (1642608..1645343) [2736 bp, 911 aa] {ON} simi...    32   9.2  

>NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON}
           Anc_1.319 YJL061W
          Length = 734

 Score = 1441 bits (3731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 709/734 (96%), Positives = 709/734 (96%)

Query: 1   MSDNFSPIASHPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVIDTTYHSMKV 60
           MSDNFSPIASHPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVIDTTYHSMKV
Sbjct: 1   MSDNFSPIASHPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVIDTTYHSMKV 60

Query: 61  KSIFNNKRKIIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPDELLSKFQPFHYDIXXX 120
           KSIFNNKRKIIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPDELLSKFQPFHYDI   
Sbjct: 61  KSIFNNKRKIIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPDELLSKFQPFHYDISSS 120

Query: 121 XXXXXXXXDIKQVLFHPKSYHETCLVILYEDSIIQLIDTTASTETITINQPTGTLGVETR 180
                   DIKQVLFHPKSYHETCLVILYEDSIIQLIDTTASTETITINQPTGTLGVETR
Sbjct: 121 TSALSSPSDIKQVLFHPKSYHETCLVILYEDSIIQLIDTTASTETITINQPTGTLGVETR 180

Query: 181 VIDIESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSL 240
           VIDIESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSL
Sbjct: 181 VIDIESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSL 240

Query: 241 KENMSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVN 300
           KENMSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVN
Sbjct: 241 KENMSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVN 300

Query: 301 FQGPFTISPFPNELYSATAKESQCMKINENNELLIMTFDDGSVALLFRDLELTMSWDIAN 360
           FQGPFTISPFPNELYSATAKESQCMKINENNELLIMTFDDGSVALLFRDLELTMSWDIAN
Sbjct: 301 FQGPFTISPFPNELYSATAKESQCMKINENNELLIMTFDDGSVALLFRDLELTMSWDIAN 360

Query: 361 YIHDNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDDS 420
           YIHDNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDDS
Sbjct: 361 YIHDNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDDS 420

Query: 421 NLNILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMNNIK 480
           NLNILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMNNIK
Sbjct: 421 NLNILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMNNIK 480

Query: 481 GXXXXXXXXXXXXXXYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSNESN 540
           G              YKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSNESN
Sbjct: 481 GSSTSNSNEETAESEYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSNESN 540

Query: 541 EIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKNKN 600
           EIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKNKN
Sbjct: 541 EIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKNKN 600

Query: 601 KEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQVHKF 660
           KEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQVHKF
Sbjct: 601 KEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQVHKF 660

Query: 661 NSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKECNIE 720
           NSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKECNIE
Sbjct: 661 NSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKECNIE 720

Query: 721 LTKTTESMAGIGSK 734
           LTKTTESMAGIGSK
Sbjct: 721 LTKTTESMAGIGSK 734

>NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa]
           {ON} Anc_1.319 YJL061W
          Length = 710

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/725 (50%), Positives = 499/725 (68%), Gaps = 17/725 (2%)

Query: 4   NFSPIASHPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVIDTTYHSMKVKSI 63
           N   IASHPIF     T + + RF FTSH GTRMV+LQG +L+WC+V  ++++SM +   
Sbjct: 3   NIDSIASHPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSVTASSFNSMTIDFF 62

Query: 64  FNNKRKIIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPDELLSKFQPFHYDIXXXXXX 123
                      LS SG+F+C+YT  TI+++EIPWGY      ++SKFQ F Y+       
Sbjct: 63  QPESTAPQKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYN----NKD 118

Query: 124 XXXXXDIKQVLFHPKSYHETCLVILYEDSIIQLIDTTASTETITINQPTGTLGVETRVID 183
                 IKQVLFHP++Y ++CLV+LY++  I L+D T  T+TIT+N+   T G++T++ D
Sbjct: 119 DDGYSPIKQVLFHPEAYKDSCLVVLYDNGTISLMDVTQITKTITLNKRVATFGIDTQITD 178

Query: 184 IESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSLKEN 243
           IESICF K  G  LYALSISDGGDIYA YPCLP +L+V ++++  LL +S++LY+SLK +
Sbjct: 179 IESICFSKD-GWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLD 237

Query: 244 MSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVNFQG 303
              DVKRNVI+Q+QF  KL G   E  K   ++             ++++ EYRL+  QG
Sbjct: 238 TDRDVKRNVIRQVQFVNKLNGLLTENEKNSNED------------FIEIEQEYRLIRGQG 285

Query: 304 PFTISPFPNELYSATAKESQCMKINENNELLIMTFDDGSVALLFRDLELTMSWDIANYIH 363
           PFTI P+P  LYSATA E   + IN NNEL+ M FDDGS+ALLF+DL LTMSWD+ NY+H
Sbjct: 286 PFTIDPYPERLYSATALEISTLPINSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVH 345

Query: 364 DNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDDSNLN 423
           +NSF+LVEL++LK TD+ R++ Y D +G+FF+  D  + LVHT+ WSD LAKAID+SNLN
Sbjct: 346 NNSFSLVELMQLKDTDVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLN 405

Query: 424 ILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMNNIKGXX 483
            L E+ F S++ +F+       C+PCK+ G++ I+F++ ++V++  +  + S        
Sbjct: 406 ELLEMNFTSKLDFFETTNGITKCSPCKWRGRDVILFITKEDVYMHPVEMRKSGILGNNKP 465

Query: 484 XXXXXXXXXXXXYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSNESNEIQ 543
                       YK +FKQP++ELM LN+LFQ+QC M  SKLI PE+RQ+ L+NE+NE+Q
Sbjct: 466 VLVNNEELKHQEYKTSFKQPVEELMALNKLFQQQCSMGVSKLIAPEERQVLLNNENNEVQ 525

Query: 544 LEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKNKNKEI 603
           LE+L+D+SKE+I+KI  GQ L  NLH+RL EQQ ELTRQLK    +  KQ  ++ K++E 
Sbjct: 526 LELLSDVSKEVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQ 585

Query: 604 LKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQVHKFNSF 663
            +RW++Q +RS +L  RLQ+L+ K++ IN+SP L  YPI   ELEWFKEIRNQV KFNSF
Sbjct: 586 SRRWDDQTSRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSF 645

Query: 664 VHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKECNIELTK 723
           VH QRDA EEL+ LKK+L RIS + + + DEKS KEW+ELR IL+ D++II+ECN EL  
Sbjct: 646 VHNQRDAQEELNHLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKELLS 705

Query: 724 TTESM 728
           TTE++
Sbjct: 706 TTEAL 710

>Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON}
           YJL061W (REAL)
          Length = 718

 Score =  530 bits (1364), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 290/736 (39%), Positives = 445/736 (60%), Gaps = 42/736 (5%)

Query: 8   IASHPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVI-DTTYHSMKVKSIFNN 66
           +A+ PIF  S+  N+ S R+ F+SH GTR+V++Q  I++WC+++ D +YHS+       +
Sbjct: 7   LAALPIFQASLSANQ-SPRYIFSSHNGTRLVVIQDDIIRWCSLLTDPSYHSLNF-----S 60

Query: 67  KRKIIDVKL----SESGDFLCIYTTKTIDILEIPWGYEKIPD-ELLSKFQPFHYDIXXXX 121
           +  ++D       S SGD LC Y+ + I ++EIPWGY  + D  +   FQ FHY +    
Sbjct: 61  RHLVLDDTFHAISSASGDLLCFYSDQEIFVMEIPWGYLNLGDVSIQDAFQVFHYSVDELE 120

Query: 122 XXXXXXXDIKQVLFHPKSYHETCLVILYEDSIIQLIDTTASTET-ITINQPTGTLGVETR 180
                   IK+VLFHPKSY+++C+V+L  D  I + D     E  I +N+   + G++ R
Sbjct: 121 LGSNSP--IKKVLFHPKSYNDSCIVVLKNDDTITMFDILNQQEAPIILNKRNSSFGLDAR 178

Query: 181 VIDIESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSL 240
           V DI    F K  GL LY L+ ++GGDI+A YP LP+ L +S+K++  +L KS+V+Y+SL
Sbjct: 179 VNDITDFAFSKD-GLTLYCLNTTEGGDIFAFYPFLPSVLSLSEKDLGWILNKSLVMYESL 237

Query: 241 KENMSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLI-LDVDLEYRLV 299
                  VKRN+ KQLQF +KL                  H   D KL  + +D EYRLV
Sbjct: 238 NATTDYKVKRNITKQLQFVSKL------------------HKNWDSKLAKVKIDDEYRLV 279

Query: 300 NFQGPFTISPFPNELYSATAKESQCMKI-NENNELLIMTFDDGSVALLFRDLELTMSWDI 358
             QGPFTI+PFPNELY  TA +   + I N+ NE++ ++FDDGS+ +LF+DLE++MSWD+
Sbjct: 280 KMQGPFTINPFPNELYDFTASKITTIPIDNQQNEIVCVSFDDGSLIILFQDLEMSMSWDV 339

Query: 359 ANYIHDNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAID 418
            NY+++NS  L+E IKL+  ++  L    D  GK ++  +  +  +   SW+  L+K ID
Sbjct: 340 DNYVYNNSLILIERIKLQQKEMKSLTALPDQLGKLYVTLESSVHQLDCTSWTSVLSKCID 399

Query: 419 DSNLNILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLT---KKHS 475
           +S+LN L+++ F S+      + + +N     ++ K S+  +S + + ++N++   K+ S
Sbjct: 400 ESDLNALADVKFVSKFEDIATIHQLSNFAYINWNDKSSLALISKEKLTIQNISNHKKEQS 459

Query: 476 MNNIK--GXXXXXXXXXXXXXXYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQI 533
           +N                    Y+++F QPI+E+++LNE FQK C  P  ++I P DRQ+
Sbjct: 460 LNAPAELDTNVNSDKSDTGKRGYEISFTQPINEILSLNESFQKVCLSPCERIIPPADRQL 519

Query: 534 ELSNESNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQ 593
            L NE+NE QLEI TD+SKE + KII  Q+LG +++NR+ EQQ ELTRQL+ T  +  K 
Sbjct: 520 PLKNEANENQLEIFTDISKEFLRKIIKAQSLGVSIYNRIHEQQFELTRQLQSTSKIIAKD 579

Query: 594 DCIKNKNKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEI 653
           + ++ K +   ++WN Q +R  +L  R   L E L  + +S       I+  E+EWFKEI
Sbjct: 580 EILQKKLEAQTEKWNSQSSRQAELMTRFGKLTENLSKVAESDKFKEQNISHGEMEWFKEI 639

Query: 654 RNQVHKFNSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKI 713
           RNQ+ +FN FVH+Q+   ++LS+LK+EL RI ++  +  D+KS+ EW+ELR +LE DSKI
Sbjct: 640 RNQILQFNGFVHSQKSIQQDLSYLKRELIRIESETIN-ADKKSQNEWDELRKMLEVDSKI 698

Query: 714 IKECNIELTKTTESMA 729
           IKECN EL   ++ + 
Sbjct: 699 IKECNEELVHVSQQLT 714

>YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Linker
           nucleoporin component of the nuclear pore complex (NPC);
           also part of the NPC cytoplasmic filaments; contributes
           to nucleocytoplasmic transport and NPC biogenesis; forms
           stable associations with three FG-nucleoporins (Nsp1p,
           Nup159p, and Nup116p)
          Length = 713

 Score =  523 bits (1346), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 291/728 (39%), Positives = 447/728 (61%), Gaps = 33/728 (4%)

Query: 6   SPIASHPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVI-DTTYHSMKVKS-- 62
           S +++ PIF  S+  ++ S R+ F+S  GTR+V +Q  I++W NV+ D+ YHS+      
Sbjct: 5   SRLSALPIFQASLSASQ-SPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHL 63

Query: 63  IFNNKRKIIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPD-ELLSKFQPFHYDIXXXX 121
           + ++   +I    S SGD LC++    I ++E+PWGY  + D  +   FQ FHY I    
Sbjct: 64  VLDDTFHVIS---STSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEE 120

Query: 122 XXXXXXXDIKQVLFHPKSYHETCLVILYEDSIIQLIDTTASTE-TITINQPTGTLGVETR 180
                   IK+VLFHPKSY ++C+V+L ED  I + D   S E  I +N+P  + G++ R
Sbjct: 121 VGPKS--SIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNSQEKPIVLNKPNNSFGLDAR 178

Query: 181 VIDIESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSL 240
           V DI  + F K  GL LY L+ ++GGDI+A YP LP+ L +++K+++L+L KS+V+Y+SL
Sbjct: 179 VNDITDLEFSKD-GLTLYCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVMYESL 237

Query: 241 KENMSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVN 300
                  VKRNVIKQLQF +KL   +            +R  +      +D+  EYRL  
Sbjct: 238 DSTTDVIVKRNVIKQLQFVSKLHENW-----------NSRFGK------VDIQKEYRLAK 280

Query: 301 FQGPFTISPFPNELYSATAKESQCMKI-NENNELLIMTFDDGSVALLFRDLELTMSWDIA 359
            QGPFTI+PFP ELY  TA     + I N  NE++ ++FDDGS+ LLF+DLE++MSWD+ 
Sbjct: 281 VQGPFTINPFPGELYDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVD 340

Query: 360 NYIHDNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDD 419
           NY+++NS  L+E +KL+  +I  LI   +  GK +++SD++I  V+  SW+  L+K I++
Sbjct: 341 NYVYNNSLVLIERVKLQ-REIKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINE 399

Query: 420 SNLNILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMNNI 479
           S+LN L+ + FES++     + +  N     ++ + ++  +S+  +  +N++      + 
Sbjct: 400 SDLNPLAGLKFESKLEDIATIERIPNLAYINWNDQSNLALMSNKTLTFQNISSDMKPQST 459

Query: 480 KGXXXXXXXXXXXXX-XYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSNE 538
                            +K++F QPI+E++ LN+ FQK C  P  ++I   DRQI L NE
Sbjct: 460 AAETSISTEKSDTVGDGFKMSFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNE 519

Query: 539 SNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKN 598
           ++E QLEI TD+SKE + +I+  QTLG ++HNR+ EQQ ELTRQL+ T  +  K D ++ 
Sbjct: 520 ASENQLEIFTDISKEFLQRIVKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRR 579

Query: 599 KNKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQVH 658
           K +   K+W+ QL+R  +L +R   L++KL  I +S       I+  E++WFKEIRNQ+ 
Sbjct: 580 KFEAQNKKWDAQLSRQSELMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQIL 639

Query: 659 KFNSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKECN 718
           +FNSFVH+Q+   ++LS+LK EL RI  + T  VD+KS+ EW+ELR +LE DSKIIKECN
Sbjct: 640 QFNSFVHSQKSLQQDLSYLKSELTRIEAE-TIKVDKKSQNEWDELRKMLEIDSKIIKECN 698

Query: 719 IELTKTTE 726
            EL + ++
Sbjct: 699 EELLQVSQ 706

>Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061W
           (REAL)
          Length = 713

 Score =  512 bits (1318), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 286/730 (39%), Positives = 437/730 (59%), Gaps = 35/730 (4%)

Query: 8   IASHPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVI-DTTYHSMKVKS--IF 64
           +AS PIF  S+  ++ S R+ FTS  GTR+V +Q  I++W NV+ D  YHS+ +    + 
Sbjct: 7   LASLPIFQASLSASQ-SPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLSRHLVL 65

Query: 65  NNKRKIIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPD-ELLSKFQPFHYDIXXXXXX 123
           ++   +I    S SGD LC +  + I ++E+PWGY  + +  +   FQ FHY +      
Sbjct: 66  DDTFHVIS---STSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELG 122

Query: 124 XXXXXDIKQVLFHPKSYHETCLVILYEDSIIQLIDTTASTE-TITINQPTGTLGVETRVI 182
                 IK+VLFHPKSYH++C+V+L E+  I + D     E  I +N+P  + G++ R+ 
Sbjct: 123 PKSL--IKKVLFHPKSYHDSCIVVLKENDTIIMFDILNQQEKPIILNKPNNSFGLDARLN 180

Query: 183 DIESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSLKE 242
           DI  + F K  GL LY L+ ++GGDI+A YP LP+ L +++ ++  +L KS+V+Y+SL  
Sbjct: 181 DITDLVFSKD-GLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDP 239

Query: 243 NMSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKL-ILDVDLEYRLVNF 301
                VKRN+IKQLQF +KL                  H   D KL  +D+D EYRLV  
Sbjct: 240 TTDVTVKRNIIKQLQFVSKL------------------HENWDSKLNKVDIDSEYRLVKV 281

Query: 302 QGPFTISPFPNELYSATAKESQCMKI-NENNELLIMTFDDGSVALLFRDLELTMSWDIAN 360
           QGPFTI+PFPNELY  TAK    + I N+ NE+  ++FDDGS+ LL +DLE++MSWD+ N
Sbjct: 282 QGPFTINPFPNELYDYTAKNIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGN 341

Query: 361 YIHDNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDDS 420
           Y++++S  L+E +K++  +I  LI   +  GK ++ S + +  V++ SW+  ++K I++S
Sbjct: 342 YVYNDSLVLIERVKMQ-KEIESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINES 400

Query: 421 NLNILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMNNIK 480
           +LN L ++ FES+I     +    N     ++   ++   S+  +  + ++    M + +
Sbjct: 401 DLNPLGDLKFESKIENIATVEGMPNLAHIYWNNTSNLALASNKELTFQTVSVDQKMQSTE 460

Query: 481 GXXXXXXXXXXXXX-XYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSNES 539
                           Y++ F QP+ E++TLNE FQ+ C  P  ++I   DRQI L NE+
Sbjct: 461 TETDIGTEESGLAKCRYELRFTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEA 520

Query: 540 NEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKNK 599
           +E QLEI TD+SKE + KI   Q+LG +++NR+ EQQLELTRQL+ T  +  K   ++ K
Sbjct: 521 SENQLEIFTDVSKEFLQKIAKAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKK 580

Query: 600 NKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQVHK 659
            +   K+W+ Q+ R  KL +R   L E L  I+ S       I++ E+EWFKEIRNQ+ +
Sbjct: 581 FEAQNKKWDAQIIRQSKLMERFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQ 640

Query: 660 FNSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKECNI 719
           FN +VH+Q+   ++LS+LK+EL RI  + T  VD+KS+ EW ELR +LE DSKIIKECN 
Sbjct: 641 FNCYVHSQKSLQQDLSYLKRELTRIETE-TIQVDKKSQSEWNELRKMLEIDSKIIKECNE 699

Query: 720 ELTKTTESMA 729
           EL   ++ + 
Sbjct: 700 ELQHASQQLT 709

>ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 692

 Score =  508 bits (1308), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 286/727 (39%), Positives = 425/727 (58%), Gaps = 45/727 (6%)

Query: 8   IASHPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVIDTTYHSMKVKSIFNNK 67
           I SH IF  +   +  S+RF  TS  G+++V+ Q   ++WCN  D+ Y  M ++    + 
Sbjct: 3   IGSHSIFKRA---SGSSKRFLCTSQDGSKVVIYQDSSIRWCNAFDSKYEFMLLEPTIEDV 59

Query: 68  RKIIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPDELLSKFQPFHYDIXXXXXXXXXX 127
             ++   LS +G  L +Y ++ + I+EIPWGY ++  E    FQ F Y +          
Sbjct: 60  EHVV---LSPTGTLLLLYNSREVRIVEIPWGYSQVSYE---GFQKFRYSVDSRQDPL--- 110

Query: 128 XDIKQVLFHPKSYHETCLVILYEDSIIQLIDT----TASTETITINQPTGTLGVETRVID 183
             IK+VLFHP +Y E C+VIL  D+ I L+D         + + +NQ  G  G+E  V D
Sbjct: 111 --IKKVLFHPLAYREHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTD 168

Query: 184 IESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSLKEN 243
           IESI F +  GL LYALS+++G DIYA YPCLP  +++   ++DLL+ KS+V Y++L   
Sbjct: 169 IESITFSQD-GLTLYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVE 227

Query: 244 MSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVNFQG 303
             +  KRN IKQ QF +KL+         E D+ +           +D+ +++  V  QG
Sbjct: 228 TPDATKRNTIKQFQFISKLRQGL------ENDQTK-----------IDIPMDWLRVRGQG 270

Query: 304 PFTISPFPNELYSATAKESQCMKINENNELLIMTFDDGSVALLFRDLELTMSWDIANYIH 363
           PFTI+PFP+  Y  TA + + + I  NN+LL+M+FDDG++ +L++DLELTM WD   Y +
Sbjct: 271 PFTIAPFPDRYYDRTAVQLKILPIGANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSY 330

Query: 364 DNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDV-IMLVHTNSWSDKLAKAIDDSNL 422
           +NS  LVE I+L   + G L++ Q    +FF+L     I LV T+ WS  L+  ID+S+L
Sbjct: 331 NNSLVLVESIRL---ERGELVLKQGTLSQFFVLGGTSDIYLVDTSPWSKILSNCIDNSDL 387

Query: 423 NILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMNNIKGX 482
             ++++ F+SEI+  + + + ++    K   +   +FVS D VFV    K  ++N+    
Sbjct: 388 EPIADLQFKSEISKIEGVSQIDSYAMWKKDTEPKDVFVSKDTVFV----KSTAVNDQPST 443

Query: 483 XXXXXXXXXXXXXYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSNESNEI 542
                        Y+V   QP+ E+++LN  FQ + + P SKL++P  RQ +L+NESNE 
Sbjct: 444 VKDEKKANVDIPRYEVALNQPMSEILSLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEE 503

Query: 543 QLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKNKNKE 602
           QLEILT +SKE + KI+  Q LGFNLHNR  EQQ ELTRQL+++  +  KQD +++K + 
Sbjct: 504 QLEILTTVSKEFLQKIVKAQALGFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQS 563

Query: 603 ILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQVHKFNS 662
                  ++ R  KL  R  +L+EKL  IN+SP      IT  E+ WFKEIRNQV  FN 
Sbjct: 564 QSSECESKIQRQDKLLQRFNSLSEKLGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQ 623

Query: 663 FVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKECNIELT 722
           +VH Q++  ++L +L+KEL+ IS +    V EKSK EW EL +ILE D+KIIKECN +L 
Sbjct: 624 YVHHQKNQQDQLRYLQKELENISLEDKD-VGEKSKSEWTELLSILESDTKIIKECNNQLA 682

Query: 723 KTTESMA 729
             +  + 
Sbjct: 683 HASSEVG 689

>Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {ON}
           YJL061W (REAL)
          Length = 716

 Score =  505 bits (1301), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 279/728 (38%), Positives = 437/728 (60%), Gaps = 31/728 (4%)

Query: 8   IASHPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCN-VIDTTYHSMKVKS--IF 64
           + + PIF  S+  ++ S  + F+SH GTR+V +Q  I++WCN + +++Y S+      I 
Sbjct: 7   LVALPIFQASLSASQ-SPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFSRHLIL 65

Query: 65  NNKRKIIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPD-ELLSKFQPFHYDIXXXXXX 123
           ++  ++I    S SGD L  +  + I ++E+PWGY  I +  +   FQ FHY +      
Sbjct: 66  DDTFRVIS---SASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVENG 122

Query: 124 XXXXXDIKQVLFHPKSYHETCLVILYEDSIIQLIDT-TASTETITINQPTGTLGVETRVI 182
                 IK+VLFHPKSYH++C+V+L ED  I + D      + I +N+ + + G++ RV 
Sbjct: 123 SRSL--IKKVLFHPKSYHDSCIVVLKEDDTITMFDILNQQHKPIVLNKRSNSFGLDARVN 180

Query: 183 DIESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSLKE 242
           DI  + F +  GL LY L+ ++GGD++A YP LP  L + +K++  +L KS+V+Y+SL  
Sbjct: 181 DITDLAFSRD-GLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDS 239

Query: 243 NMSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVNFQ 302
                VKRN+IKQLQ  +KL      QL                   +++D EYRLV  Q
Sbjct: 240 TTDITVKRNIIKQLQLVSKLHENLDSQLGK-----------------VEIDEEYRLVKMQ 282

Query: 303 GPFTISPFPNELYSATAKESQCMKI-NENNELLIMTFDDGSVALLFRDLELTMSWDIANY 361
           GPFTI+PFP+ELY  TA     + I N  NE++ + FDDGS+ LLF+DLE++MSWD+ NY
Sbjct: 283 GPFTINPFPDELYEYTAANITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNY 342

Query: 362 IHDNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDDSN 421
           +H+NS  L+E IK++ TDI  L    +  GK ++ S++ +  + + +WS  L++ I++S+
Sbjct: 343 VHNNSLVLIERIKIQETDIKSLKTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESD 402

Query: 422 LNILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMNNIKG 481
           LN L ++ FES++     +   +N     ++   +++  +   +  +N++    +   K 
Sbjct: 403 LNALGDVKFESKLENIVTIEHPSNLAYISWNDTSNLVLTARGKLTFQNISNDKELQTTKF 462

Query: 482 XXXXXXXXXXXXXXYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSNESNE 541
                         Y+++F QPI+E+++LNE FQK C  P  K+I P  RQ+ L NE++E
Sbjct: 463 DANNKSDRIDAGKHYEMSFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASE 522

Query: 542 IQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKNKNK 601
            QLEI T +SKE + KII  Q+LGF+++NR++EQQ ELTRQL+ T  +  K   ++ K  
Sbjct: 523 NQLEIFTGISKEFLQKIIKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLG 582

Query: 602 EILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQVHKFN 661
              K+W+ Q++R VKL +R + L E L  I +S  L    I   E++WFKEIRNQ+ +FN
Sbjct: 583 AQNKKWDAQVSRQVKLMERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFN 642

Query: 662 SFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKECNIEL 721
           +FV +Q+   ++LS++KKEL RI  + T   DEK++ EW+ELR +LE+DSKIIKECN EL
Sbjct: 643 NFVRSQKSLQQDLSYMKKELTRIEAE-TIKTDEKTQNEWDELRKMLEEDSKIIKECNEEL 701

Query: 722 TKTTESMA 729
              ++ + 
Sbjct: 702 MHVSQQLT 709

>KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {ON}
           Anc_1.319 YJL061W
          Length = 716

 Score =  498 bits (1282), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 276/686 (40%), Positives = 412/686 (60%), Gaps = 37/686 (5%)

Query: 45  LKWCNVIDTTYHSMKVKSIFNNKRKIIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPD 104
           L+W +V  + YHS+ +  +F +     +V +S SG FLC+Y  K++ ++EIPWGY+    
Sbjct: 54  LRWGSVASSQYHSLPL--LFFDDSAYENVIISNSGQFLCLYDKKSLSLIEIPWGYDGAVT 111

Query: 105 ELLSKFQPFHYDIXXXXXXXXXXXDIKQVLFHPKSYHETCLVILYEDSIIQLIDTTASTE 164
            + S FQ    D+           DIK++LFHPK+  + C+VIL+E+ +I L D   S E
Sbjct: 112 SIKSSFQRVFRDVNKSS-------DIKKILFHPKAADDGCVVILFENDVICLFDLRKS-E 163

Query: 165 TITINQPTGTLGVETRVIDIESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKK 224
            + +N+    LG+ETRV DIE + F +  GL LY LS++DGGDIYA YPCLP +L + K 
Sbjct: 164 KLFLNKTANKLGIETRVTDIEDMEFSQD-GLTLYMLSVTDGGDIYAFYPCLPPKLSLKKS 222

Query: 225 EVDLLLQKSIVLYDSLKENMSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQK 284
            ++ L  KS +LYDSL   +S +V++NV+KQ++F   L+    ++ K             
Sbjct: 223 VLEDLFNKSRILYDSLDSTVSIEVRKNVLKQIKFIASLRDSSSDETKNS----------- 271

Query: 285 DLKLILDVDLEYRLVNFQGPFTISPFPNELYSATAKESQCMKINENNELLIMTFDDGSVA 344
                L++  ++R V  QGPFT++P+P +LY ATAKE   + I  NNEL  +TFD+G+V 
Sbjct: 272 ----CLEISNDFRQVKAQGPFTVAPYPEKLYEATAKEIYTLDIGNNNELFAITFDNGTVT 327

Query: 345 LLFRDLELTMSWDIANYIHDNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSD-DVIML 403
           LL +DLEL+MSW+  NY+++NSF L+E +++ P  I +L+      G+ F+  +   +  
Sbjct: 328 LLLKDLELSMSWNADNYVYNNSFVLIESVEMGPESI-KLLKSSSLTGQMFISQNHSSVRK 386

Query: 404 VHTNSWSDKLAKAIDDSNLNILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSD 463
           + T +WS K++K I +S+L  L ++ F+S+I+  D+    +        G+  I+FVS+ 
Sbjct: 387 IDTTAWSFKVSKCITNSDLTSLIDVDFKSKISDLDIKENVDCYGVWSLRGERGILFVSNS 446

Query: 464 NVFVENLTKKHSMNNIK--GXXXXXXXXXXXXXXYKVTFKQPIDELMTLNELFQKQCRMP 521
           +V    L +  S   IK                 Y+V+F QPI E+M LN+ FQ+ CR P
Sbjct: 447 SVISRTLPESDSSFVIKLDEMSRSKNIEDPVTKKYEVSFTQPISEIMNLNDSFQRICRHP 506

Query: 522 FSKLIKPEDRQIELSNESNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTR 581
           F K+I PE+RQ  LSN+SNE QL  LT++S +L++ I++GQ+LG  L NRL EQQ ELT+
Sbjct: 507 FKKIISPEERQTVLSNDSNETQLATLTEISNDLVSNIVEGQSLGLVLRNRLYEQQYELTK 566

Query: 582 QLKHTQIVFEKQDCIKNKNKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYP 641
           QLK +  + EKQ  +K+   + + RWN+ L +  +L  R   LN  L  I++S  +S  P
Sbjct: 567 QLKESIQLIEKQSLLKSSYDDKMVRWNKNLKKQDELIQRFNALNGNLAKIHESKEISKTP 626

Query: 642 ITSVELEWFKEIRNQVHKFNSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSK---K 698
           I+  E+EWFKE+RNQ+ KFN FVH  R+  E+++FL+K L RI     S V ++S     
Sbjct: 627 ISEKEVEWFKEVRNQILKFNDFVHVHRNMQEQINFLRKGLSRIE----SKVGQRSSHLTS 682

Query: 699 EWEELRAILEQDSKIIKECNIELTKT 724
           EW E + ILE D+ IIKECN ELTK 
Sbjct: 683 EWAEFKKILETDTNIIKECNEELTKA 708

>TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.319
           YJL061W
          Length = 691

 Score =  466 bits (1198), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 262/732 (35%), Positives = 413/732 (56%), Gaps = 54/732 (7%)

Query: 8   IASHPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVIDTTYHSMKVKSIFNNK 67
           + +HPIF  S+     S RFF T+  G R V++Q   ++WCNV +  YHSM ++  F + 
Sbjct: 3   VETHPIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNVSEPGYHSMTLERAFKDV 62

Query: 68  RKIIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPDELLSKFQPFHYDIXXXXXXXXXX 127
           + ++   +S SG+FLC+Y    + I+E+PW Y ++   + + FQ F +            
Sbjct: 63  KHVV---MSNSGEFLCLYNDDELRIIEVPWAYTEV-SSMANAFQLFRF--------VSDE 110

Query: 128 XDIKQVLFHPKSYHETCLVILYEDSIIQLIDTT--ASTETITINQPTGTLGVETRVIDIE 185
             IKQVLFHP +Y +  +VIL +D  I +++      ++   +N   GT  +++ + D+E
Sbjct: 111 ARIKQVLFHPLAYQQETVVILKDDDSITIMNWQDFGDSKPDVLNLSNGTYSLDSSITDVE 170

Query: 186 SICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSLKENMS 245
            I F +  GL LY LS+S+G DIYA YPCL  R+   K+ +D L+ KS++ YD L     
Sbjct: 171 CITFSQD-GLTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTD 229

Query: 246 NDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVNFQGPF 305
           ++VKRN IKQL+F + L                  H Q++ + IL++    R V  QGPF
Sbjct: 230 SEVKRNTIKQLKFVSGL------------------HKQQNSQRILEIPEAQRQVRGQGPF 271

Query: 306 TISPFPNELYSATAKESQCMKINENNELLIMTFDDGSVALLFRDLELTMSWDIANYIHDN 365
           TI+PFP ++YS+T      + IN+ NELLIM+ DDG++A+L +DL++TM+WD A Y ++N
Sbjct: 272 TIAPFPKQIYSSTGTGIASLPINDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNN 331

Query: 366 SFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDDSNLNIL 425
           SFALVELI L   +I ++++    +G+F +++ + +  + T+ WS  +A  + +S+L  L
Sbjct: 332 SFALVELITLGSQEIQQIVVGDHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPL 391

Query: 426 SEIGFESEITWFDVMG-----KFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSM--NN 478
           +E   ESE+T+ ++        + N TP      +S++ VS+  V  + +++  S   ++
Sbjct: 392 AETKLESEVTFTELKDSPKSVAWWNTTP------QSVVKVSNREVKSKQVSEGVSKQDDD 445

Query: 479 IKGXXXXXXXXXXXXXXYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSNE 538
           I G              Y   + QPI E+M LN+ FQ +     SK+I P +RQ  L NE
Sbjct: 446 ITG-------SRQEPEKYNAHYSQPIAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNE 498

Query: 539 SNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKN 598
           ++EIQL++LT+ SK+ ++KI  GQTLG  LHNR+ EQQL+LT QLK +  + EKQ  I  
Sbjct: 499 ASEIQLDLLTEASKDFVSKIAVGQTLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILT 558

Query: 599 KNKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQVH 658
                  R +    R   L  R     + L  I +S       I+  E+EWFKEIR QV 
Sbjct: 559 HFHSQSSRSDAVHARHSTLMSRFNKFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVL 618

Query: 659 KFNSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKECN 718
            FN  VH Q+   ++L  LK+E++RI+  VT   + +++ EW ELR +LE+D+ I+++CN
Sbjct: 619 TFNRDVHNQKRLQDQLIHLKQEMNRIAQ-VTGDQNSQARDEWHELRHMLEEDTIILQDCN 677

Query: 719 IELTKTTESMAG 730
            +L      +  
Sbjct: 678 NQLKSAARQVPA 689

>KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON}
           Anc_1.319 YJL061W
          Length = 747

 Score =  424 bits (1089), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 256/735 (34%), Positives = 398/735 (54%), Gaps = 57/735 (7%)

Query: 8   IASHPIF-GTSIITNEDSQRFFFTSHQGTRMVLLQ--GCILKWCNVIDTTYHSMKVKSIF 64
           +   PI   T+ + ++ S R+ FT+ +GT+ V L     +L+W +V +  Y+SM +K I 
Sbjct: 20  MGQRPILQPTAGLPSDLSSRYVFTTDKGTKYVYLDKTNGLLRWGSVSEDEYNSMPLK-IS 78

Query: 65  NNKRKIIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPDELLSKFQPFHYDIXXXXXXX 124
           N   K ++V LS+SG+FLC+Y+   + ++E+PW Y   P+E+   FQ    +I       
Sbjct: 79  NFADKSVNVILSDSGEFLCVYSKDCVTVIEVPWRYRN-PEEMSYVFQTSFKEIRKDSF-- 135

Query: 125 XXXXDIKQVLFHPKSYHETCLVILYEDSIIQLIDTTASTETITINQPTGTLGVETRVIDI 184
                IK+VLFHP++  +TC+VIL+ED  I L D   + + I +N P+G +G+E R+  I
Sbjct: 136 -----IKKVLFHPRAIKKTCMVILFEDDTIYLFDVEDNNK-IALNVPSGNIGIEDRITSI 189

Query: 185 ESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSLKENM 244
             I F +  GL LY LS  D GD+YA+YPCLP  L +S+KE+  L+ +S++LYDSL E  
Sbjct: 190 ADIEFSQD-GLTLYVLSAEDCGDVYAIYPCLPPILAMSQKELKSLMNRSVLLYDSLTETT 248

Query: 245 SNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVNFQGP 304
            + VK+ VIKQ++F ++LQ                 H ++++  +L++D  YRL   QGP
Sbjct: 249 PSAVKKGVIKQVEFISQLQ--------------NISHGKEEISNVLEIDTIYRLAKPQGP 294

Query: 305 FTISPFPNELYSATAKESQCMKINENNELLIMTFDDGSVALLFRDLELTMSWDIANYIHD 364
           FTI+PFP +LYSATA E   + I   NE+L + +D+G+   LF+DLEL+M+WD+    ++
Sbjct: 295 FTIAPFPEKLYSATATEICPLNIGGGNEILCIAYDNGTALFLFKDLELSMAWDVGGIYYN 354

Query: 365 NSFALVE--------------------LIKLKPTDIGRLIIYQDNF---GKFFLLSDDVI 401
           NS  L+E                    LI  K +D  + I    +F   G   +    +I
Sbjct: 355 NSLVLMEEFDLQTESAVSILKSFKMDGLILFKVSDSVQHIDVSKSFIQDGDLLVQQSSMI 414

Query: 402 MLVHTNSWSDKLAKAIDDSNLNILSEIGFESEI-TWFDVMGKFNNCTPCKYHGKESIIFV 460
             V T +WS  ++  ID  ++N L  + F+S+  TW        +C    + G E + ++
Sbjct: 415 RCVDTKAWSSVVSDCIDRHDINALITVSFKSKGHTWAIAGSDITSCGAWNHGGTEGVTWI 474

Query: 461 SSDNVFVENLTKKHSMNNIKGXXXXXXXXXXXXXXYKVTFKQPIDELMTLNELFQKQCRM 520
           ++ +V  + L K+ S    +                K  F  PI EL  LN  +Q  CR+
Sbjct: 475 TNKSVTCKELKKQVSWKPEQSTSSEKKKQAFP----KPEFSVPISELNALNINYQDTCRI 530

Query: 521 PFSKLIKPEDRQIELSNESNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELT 580
            F  +I P DRQ  L N SNE QL+++T LS  L+  +  GQ LG  L+NRL EQQLELT
Sbjct: 531 GFHDIISPLDRQKPLLNPSNEKQLQVMTSLSNYLLATVGKGQGLGMTLYNRLLEQQLELT 590

Query: 581 RQLKHTQIVFEKQDCIKNKNKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSY 640
           +QL+ +  +  KQ  I  K +E    WNE+L +  KL +R  +L +KL  I+ +   +  
Sbjct: 591 KQLQCSNKILMKQPAIAKKLEEQKSVWNEKLAKQNKLKERFSSLQQKLAAIDKTKKSTDL 650

Query: 641 PITSVELEWFKEIRNQVHKFNSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEW 700
            IT  E  WFKE++ +   FN  V+ Q    ++L FLK+EL    +D +  +   +  EW
Sbjct: 651 VITDEESVWFKEVKKEALTFNDLVYKQESVQDDLRFLKRELSTFVSD-SQRLPGTANTEW 709

Query: 701 EELRAILEQDSKIIK 715
             L+ +L+ DS +++
Sbjct: 710 HSLQEMLKHDSLLLR 724

>Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {ON}
           complement(57897..60050) [2154 nt, 718 aa]
          Length = 717

 Score =  400 bits (1029), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 245/730 (33%), Positives = 403/730 (55%), Gaps = 39/730 (5%)

Query: 11  HPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVIDTT-YHSMKVKSIFNNKRK 69
           +PIF    ++ E ++RFFF+++ GTR++L Q   ++W    D   Y SM ++   ++   
Sbjct: 6   NPIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMALR---DSDMD 62

Query: 70  IIDVKLSESGDFLCIYTTKTIDILEIPWG---YEKIPDELLSKFQPFHYDIXXXXXXXXX 126
           +    +S+ GD+LC+Y +  I ++EIPWG    ++I + + S  Q   Y+          
Sbjct: 63  VTGAIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKL---- 118

Query: 127 XXDIKQVLFHPKSYHETCLVILYEDSIIQLID--TTASTETITIN-----QPTGTLGVET 179
              +KQVLFHP S     LV+L+  S I  +D      +  I I+       +  +G++ 
Sbjct: 119 --SVKQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDN 176

Query: 180 RVIDIESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDS 239
           RV +I+ + F     L LY+L+     D+Y  YPCLP    +SK  VD L+ KSIVLY++
Sbjct: 177 RVENIQYVVFADDC-LSLYSLT---DTDVYCFYPCLPPVASLSKNRVDELINKSIVLYEN 232

Query: 240 LKENMSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLV 299
           L  +  + V++NVIKQLQ A+ L+          K  E   +A  ++++ +++DLE+R  
Sbjct: 233 LGIDADDIVRKNVIKQLQLASSLR----------KKIEEFENANGEVEVNVEIDLEFRQT 282

Query: 300 NFQGPFTISPFPNELYSATAKESQCMKINENNELLIMTFDDGSVALLFRDLELTMSWDIA 359
             QG F+ISP+P  LY+ T K+   + I E NEL +++FD+G+V ++F+D E TMSWD+ 
Sbjct: 283 KAQGYFSISPYPESLYTCTGKQISVLPIGEGNELFLVSFDNGTVLVVFKDKESTMSWDVN 342

Query: 360 NYIHDNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDD 419
           +Y  +NSF LVE+IK KP ++  +++ Q   GKF +  +   +LV T  WS  ++K I D
Sbjct: 343 DYSFNNSFTLVEIIKFKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRD 402

Query: 420 SNLNILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMNNI 479
           ++L  L  +  +S IT  +   + N+C        +S++ V ++ V    L KK     +
Sbjct: 403 NDLRPLVGLEMKSTITHINSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKE----V 458

Query: 480 KGXXXXXXXXXXXXXXYKV-TFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSNE 538
           +               + +  F  P +EL   N  FQ+   +P+SK+I    +Q+   + 
Sbjct: 459 EFKPESAEEISTELENFTLDKFTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSN 518

Query: 539 SNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKN 598
           + E QL+IL D+S+++ +KI+ GQ+LG  L++RL EQQ +L+ QL  T  +  +   ++ 
Sbjct: 519 AMEEQLKILNDISRDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQG 578

Query: 599 KNKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQVH 658
                L + +E+L +   L   L  +   L TI +S  L S P++  E++ FKE+R+Q+ 
Sbjct: 579 DYPAQLSKLDEKLKKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQIL 638

Query: 659 KFNSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKECN 718
            FN+FVH Q+D  + + FLKKEL +I +   S   +    EWEELR IL  D+KIIKECN
Sbjct: 639 LFNNFVHKQKDQKQNIQFLKKELQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECN 698

Query: 719 IELTKTTESM 728
            +LT+ ++ +
Sbjct: 699 EQLTQISKEL 708

>TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {ON}
           Anc_1.319 YJL061W
          Length = 742

 Score =  393 bits (1009), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 260/745 (34%), Positives = 398/745 (53%), Gaps = 53/745 (7%)

Query: 9   ASHPIFGTSIITN---EDSQRFFFTSHQGTRMVLLQGCILKWCNVIDTTYHSMKVKSIFN 65
            SHPIF  + +++   E S RFFFT+++  R+V++Q   ++WC      YHS  + S   
Sbjct: 16  TSHPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQNYHSYTIAS--- 72

Query: 66  NKRKIIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPDELLSK-FQPFHYDIXXXXXXX 124
               I D  +S SG F+C Y+   I I+EIPW +    +   S   Q + Y         
Sbjct: 73  RNFDIKDSLISNSGSFVCYYSDTDISIMEIPWSHSNSVNASSSHCIQKYRYSFKKYSLT- 131

Query: 125 XXXXDIKQVLFHPKSYHETCLVILYEDSIIQLIDTTASTETIT----INQPTGTLGVETR 180
                +KQVLFHP +  E+CLV+L  D  I  ID + S + ++    +N+ + ++G+ ++
Sbjct: 132 -----VKQVLFHPLATLESCLVVLLSDDTIVFIDFSKSFDLLSSDYILNKKSKSIGLSSQ 186

Query: 181 VIDIESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSL 240
           + DI+S+ F +  GL LYALS S   D+YA YPCLP     S ++++ L+ KS+V Y+ L
Sbjct: 187 ISDIQSLTFSQD-GLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEEL 245

Query: 241 KENMSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVN 300
           +E+    +K N+IKQL+F + L  +    L+ + D +  ++         DV LEYRL+ 
Sbjct: 246 REDDPTALKINIIKQLKFTSDLYKKGKRALEEDTDSKTWKY---------DVPLEYRLIR 296

Query: 301 FQGPFTISPFPNELYSATAKESQCMKINENNELLIMTFDDGSVALLFRDLELTMSWDIAN 360
            QGPFTISPFP+ LY ++      + I+  NELL+++F DGSV  LF+DLELTMSWD  N
Sbjct: 297 PQGPFTISPFPDSLYYSSPTHIVSVPIDTTNELLVLSFSDGSVVSLFQDLELTMSWDQDN 356

Query: 361 YIHDNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDDS 420
           +  +NS  L+ELIK K  +I +L  Y   +G F++L       V T+ WS  LA  I  S
Sbjct: 357 FNENNSLVLLELIKTKEQNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSS 416

Query: 421 NLNILSEIGFESEITWFD------VMGKFNNCTPCKYHGKESIIFVSSDNVFVEN----- 469
           ++  LS +  +S I  FD        G +  C+P       S++F++   V   N     
Sbjct: 417 DIRDLSNLLIKSVIKPFDNAAYELTSGGW-WCSPT----ISSLLFINKSTVIELNEKPKL 471

Query: 470 LTKKHSMNNIKGXXXXXXXXXXXXXXYKVTFKQP--IDELMTLNELFQKQCRMPFSKLIK 527
           L    + + +                +K+       I +L  +N +F+++     +  I 
Sbjct: 472 LLSDDTTHLLTSELAQKYIPPLEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIP 531

Query: 528 PEDRQIELSNESNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQ 587
            ++R + L N++NE QLE LT +SK +  KI  GQ+LGF ++N++ +QQ  +  QL+ TQ
Sbjct: 532 SQERNVTLFNKTNENQLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVELQLRQTQ 591

Query: 588 IVFEKQDCIKNKNKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVEL 647
            + EK+  +  K  E   +      R  KL  RL  +NEKL   +   NL +  I+  EL
Sbjct: 592 RLLEKEKILNTKYNEQADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKEL 651

Query: 648 EWFKEIRNQVHKFNSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAIL 707
           E+FKEIR QV  FN FVH Q+D ++ L F+KKEL RI  +  ++VDE   K+W+ LR +L
Sbjct: 652 EFFKEIRKQVLLFNEFVHKQKDQHDTLLFIKKELIRIKGE-NAIVDENDFKQWDRLRDML 710

Query: 708 EQDSKIIKECNIELTKTTESMAGIG 732
             D+  I+ C       TES+  I 
Sbjct: 711 HDDATTIETC-------TESIKNIN 728

>SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 690

 Score =  374 bits (961), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 237/721 (32%), Positives = 381/721 (52%), Gaps = 43/721 (5%)

Query: 11  HPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVIDTTYHSMKVKSIFNNKRKI 70
           HPIF    +  E   +   T+  G R+V++QG  ++ C+  ++ Y  ++          +
Sbjct: 6   HPIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSSGNSQYQIIEC-----GINTV 60

Query: 71  IDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPDELLSKFQPFHYDIXXXXXXXXXXXDI 130
               L+ SG  LC Y    + ++ +P  +      +L   +P  Y+I            I
Sbjct: 61  AGAALNNSGTLLCAYNETELQVIVLPSPFVSSHGGIL---KPHTYNITVKS-------PI 110

Query: 131 KQVLFHPKSYHETCLVILYEDSII---QLIDTTASTETITINQPTGTLGVETRVIDIESI 187
           KQV +HP+   ++  V+L++D  I   +L +      T  +N     LGV + + DIES+
Sbjct: 111 KQVQWHPRGKLDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESM 170

Query: 188 CFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSLKENMSND 247
           CF K  GL LY L+ S+GGD+YALYP LP+ L + ++ +++   KS + Y++L  + S  
Sbjct: 171 CFSKD-GLALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPT 229

Query: 248 VKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVNFQGPFTI 307
           VKRNVIKQLQF ++L  Q+         +  T    ++  L+ ++   YR    QGPFTI
Sbjct: 230 VKRNVIKQLQFVSRLHKQY---------KSETVDKARNGDLVFNIQESYRNAKIQGPFTI 280

Query: 308 SPFPNELYSATAKESQCMKINENNELLIMTFDDGSVALLFRDLELTMSWDIANYIHDNSF 367
           +PF  +LYSATA +   M I+E NEL+++ FD+G++   F+DL+L+M W+  +   +NS 
Sbjct: 281 NPFAEKLYSATATQITTMPIDEFNELILVYFDNGTILQCFQDLDLSMCWEEIDSSSNNSL 340

Query: 368 ALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDDSNLNILSE 427
            ++E + +     G++I    +  KF +L      +V ++ W+  L++ I+ SNL +LS+
Sbjct: 341 VVLESLDILS---GQIICLTPH--KFAVLGPKS-FVVDSSEWTKALSECINFSNLEVLSQ 394

Query: 428 IGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMNNIKGXXXXXX 487
           I  +S IT   V G F      + +G++ +IF+S  +V    L + +   +         
Sbjct: 395 INIKSTIT--PVNGAFTQAGLWESNGEKQLIFMSDKSVKSITLPEPNKTKD----AVSKT 448

Query: 488 XXXXXXXXYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSNESNEIQLEIL 547
                   Y+  F QPI E++ LN+ FQ +C      +I P    + L N+SNE QL +L
Sbjct: 449 VQPVTEVKYEPVFSQPIGEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALL 508

Query: 548 TDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKNKNKEILKRW 607
           TD+SKE+ +KII GQTLG  +HNRL EQ+ ELTRQL+ +  +  K  C++ +  +   RW
Sbjct: 509 TDISKEVFSKIIQGQTLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRW 568

Query: 608 NEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQVHKFNSFVHTQ 667
                +   +  R + L  +L  I+ S  L    I+  E+EWFKEI++QV  FN FV  Q
Sbjct: 569 EHVSKKQENIDSRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQ 628

Query: 668 RDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKECNIELTKTTES 727
           +D  E+L F++ EL        S  D     +W EL+ +L  DS+IIKECN  L +  + 
Sbjct: 629 QDVKEQLEFVQSELKTAGERRVSKED---VFDWAELQELLSVDSEIIKECNEGLVEAAKE 685

Query: 728 M 728
           +
Sbjct: 686 L 686

>Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {ON}
           YJL061W (NUP82) - 82-kDa protein, with putative
           coiled-coil domain, has carboxy-terminal domain,
           containing heptad repeats, that binds Nsp1p; nucleoporin
           [contig 224] FULL
          Length = 687

 Score =  340 bits (873), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 228/718 (31%), Positives = 362/718 (50%), Gaps = 58/718 (8%)

Query: 10  SHPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVIDTTYHSMKVKSIFNNKRK 69
           SHPIF T   ++  S+RF F     ++  +LQG  L+WC+     Y  ++    F  +  
Sbjct: 5   SHPIFDTKTNSSGKSRRFVFNIGIASKYGVLQGNTLRWCSAGGHEYQYLE----FEPRID 60

Query: 70  IIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPDELLSKFQPFHYDIXXXXXXXXXXXD 129
              V ++ESG  LC+Y +K + IL + W   K    L+S                     
Sbjct: 61  YTSVVINESGSLLCLYNSKQVQILAVSWDESKSDTILISP-----------------PAG 103

Query: 130 IKQVLFHPKSYHETCLVILY---EDSIIQLIDTTASTETITINQPTGTLGVETRVIDIES 186
           IKQ L+HP+    +CL +L    E  + +L+    +  T  +N  T  LG+ + V DI S
Sbjct: 104 IKQALWHPRGRLGSCLAVLTTQDEICLYELLTEDYTEPTTILNTCTKELGMGSVVKDITS 163

Query: 187 ICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSLKENMSN 246
           + F  + GL LY LS S+G DIY++YPCLP+ +++S   +  +  K+++ Y  L +N S 
Sbjct: 164 MSFS-SDGLTLYLLSTSEGADIYSIYPCLPSEMEISGALLKSVFNKALLQYQDLNDNDSP 222

Query: 247 DVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVNFQGPFT 306
           D++R V KQLQF +KLQ +        KD E           ++ +   +R    QGPFT
Sbjct: 223 DLRRKVTKQLQFVSKLQKK-----NDYKDTESH---------VVTISKAHRSPRAQGPFT 268

Query: 307 ISPFPNELYSATAKESQCMKINE-NNELLIMTFDDGSVALLFRDLELTMSWDIANYIHDN 365
           I+PFP+ LY AT ++ + +K+     ELL+++FDDG++   F D E  MSW+   +  +N
Sbjct: 269 INPFPDNLYLATGRQVEVIKLQGCAAELLLISFDDGTILECFPDREPVMSWEDEGFCENN 328

Query: 366 SFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDDSNLNIL 425
           S     LI L   +IG  I   + +  F +LS   +  V     +  +  +++D +++  
Sbjct: 329 S-----LIVLGSVNIGGEIALVNGY-TFVVLSSAKVTFVSLRKLAQVIESSLNDCDISYF 382

Query: 426 SEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMNNIKGXXXX 485
            E     E+   +  G+F +   C    K  +  +S       ++    S++  K     
Sbjct: 383 DEADLSEEVV--EKNGRFCSAIICASSEKSCVALLSETT--TSHIDIPFSLDAPK-MRTA 437

Query: 486 XXXXXXXXXXYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSNESNEIQLE 545
                     Y+  + QP++E++ LNE  Q   + P    + P  RQ +L+NESNE QL 
Sbjct: 438 LGTAKTDVEQYR-PYGQPLNEVLALNEKVQALLKKPLQTGVSPSLRQAKLNNESNEDQLS 496

Query: 546 ILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKNKNKEILK 605
           +LT +SKE++T+I   QTL  +L+ RL  QQ ELT+ L+    V E Q  +  + K+   
Sbjct: 497 LLTSISKEVMTRIASAQTLALSLYLRLSCQQGELTQHLETVSKVEELQSKVLRRLKDQSS 556

Query: 606 RWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQVHKFNSFVH 665
           RW     ++  ++ RL+ ++ KL  ++ S    S PI++ ELEWFKEIR+QV +FN  VH
Sbjct: 557 RWEAAQAKNKSISSRLEQISSKLKQVSSSGKFQSQPISNHELEWFKEIRDQVIRFNRLVH 616

Query: 666 TQRDANEELSFLKKELDRI------SNDVTSVVDEKSKKEWEELRAILEQDSKIIKEC 717
            Q+     LS LK EL+ +          +S  D K +  W+ELRA+L +D +II EC
Sbjct: 617 EQQSLGNTLSNLKCELEYVHVESKEGKSGSSSADNKDEVPWDELRALLAKDLRIIGEC 674

>TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {ON}
           Anc_1.319 YJL061W
          Length = 721

 Score =  334 bits (857), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 231/734 (31%), Positives = 372/734 (50%), Gaps = 41/734 (5%)

Query: 11  HPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVIDTTYHSMKVKSIFNNKRKI 70
           H IF    +    S+R   T   G +++L Q   +++  V D   +    KSI   K  I
Sbjct: 7   HTIFNRFSVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGN---FKSITLEKEMI 63

Query: 71  IDVKL--SESGDFLCIYTTKTIDILEIPW----GYEKIPDELLSKFQPFHYDIXXXXXXX 124
            DV +   + G++LC++    I ++E+PW      E    +L +  Q   YD+       
Sbjct: 64  GDVSIIADQIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFGTT- 122

Query: 125 XXXXDIKQVLFHPKSYHETCLVILYEDSIIQLIDTTA-------STETITINQPTGTLGV 177
                I+++LFHP      CLV+L ++S I  ID           +  IT     G +G+
Sbjct: 123 -----IQKILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGL 177

Query: 178 ETRVIDIESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLY 237
            + + DI  I F  +  L LYAL+     DIY  YP L   + V+K E+D L QKSI+L+
Sbjct: 178 SSCIDDIIDISF-SSDKLSLYALT---ETDIYLFYPFLIPTISVTKNEIDQLFQKSIILF 233

Query: 238 DSLKENMSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYR 297
           ++L+ + S  V+RN+IKQLQ  + L G    Q+K  K+ + T+         +D++ EYR
Sbjct: 234 ENLENDSSEAVRRNIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYN------IDINTEYR 287

Query: 298 LVNFQGPFTISPFPNELYSATAKESQCMKINENNELLIMTFDDGSVALLFRDLELTMSWD 357
            VN QG F+I+PFP ELY  +A     ++I   NEL ++T+DDG+V +L+RDLE +MSWD
Sbjct: 288 SVNAQGSFSIAPFPEELYKQSAVNLSVIQIGHGNELYVITYDDGTVLILYRDLESSMSWD 347

Query: 358 IANYIHDNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAI 417
             +Y  +NSF L+E +K  P +   ++      G F +  D  + L+ T+ WSD L++ I
Sbjct: 348 SNDYTFNNSFILLEKLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCI 407

Query: 418 DDSNLNILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMN 477
            D+++  L+ +  ES     + + + N+C     H K+ ++F++   +   ++ + ++ +
Sbjct: 408 KDNDIRNLAGLSIESHKQTINTLEEPNSCILWNEHNKKELLFITETKLISSDILESNNES 467

Query: 478 NIKGXXXXXXXXXXXXXXYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSN 537
             K                   + QPI E+    + ++  C++P+SK+I    RQ   +N
Sbjct: 468 AEKLPVPAINDIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFAN 527

Query: 538 ESNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIK 597
           + NE QL  +T++S+E+ +KI+ GQT+   +H RL+EQQ     QL HT         IK
Sbjct: 528 DENEDQLAYITEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIK 587

Query: 598 NKNKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQV 657
                   +      R+ KL +R   L E +  I  S    + PI   E + FKEI+ QV
Sbjct: 588 QTYDIQSTKIKHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQV 647

Query: 658 HKFNSFVHTQRDANEELSFLKKELDRI------SNDVTSVVDEKSKKEWEELRAILEQDS 711
             FN  V+ Q++  E + FL+ EL+ I      S+D     DE    EW EL  +L +D+
Sbjct: 648 LIFNDAVNRQQEQQEAIKFLQTELNNIIEQPAQSHDAIIDSDE---DEWNELCDLLNRDA 704

Query: 712 KIIKECNIELTKTT 725
           KII++CN EL+  +
Sbjct: 705 KIIEDCNAELSSAS 718

>KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 691

 Score =  331 bits (848), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 233/733 (31%), Positives = 371/733 (50%), Gaps = 62/733 (8%)

Query: 10  SHPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVIDTTYHSMKVKSIFNNKRK 69
           +HPIF    +    S+R    +   +R +LL+G  LKWC +    Y  M++ +I N    
Sbjct: 5   AHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWCLMDAPNYEYMELNAISNYTSA 64

Query: 70  IIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPDELLSKFQPFHYDIXXXXXXXXXXXD 129
           +    L++SG  LC+     I +L + W           + +P  Y I            
Sbjct: 65  V----LNDSGTLLCLNNVDEIQVLALSWD----------QTRPESYRIKVPA-------G 103

Query: 130 IKQVLFHPKSYHETCLVILYE-DSII--QLIDTTASTETITINQPTGTLGVETRVIDIES 186
           +KQVL+HP+   ++CL +L + D I+  +L+    S  T  +N  T  LG+ + V DIES
Sbjct: 104 VKQVLWHPRGRLDSCLTVLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIES 163

Query: 187 ICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSLKENMSN 246
           +CF    GL LY +S+S+G D++++YPC+P+ L +++K +     K+++ Y  L E  S 
Sbjct: 164 VCFS-ADGLTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSP 222

Query: 247 DVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVNFQGPFT 306
           ++K    +QL F + L  Q  +    + +  +T H +K           YR    QGPFT
Sbjct: 223 ELKLKATRQLHFMSSLYNQPHDADDSQTNLLQTFHIRK----------AYRNARAQGPFT 272

Query: 307 ISPFPNELYSATAKESQCMKI-NENNELLIMTFDDGSVALLFRDLELTMSWDIANYIHDN 365
           ISPFP +LY ATAK+ + + + +E  ELL++TFDD ++   F DL   MSW+ +     N
Sbjct: 273 ISPFPEKLYLATAKQIKAIALEDETTELLLITFDDDTILECFPDLTPVMSWEDSGSSEKN 332

Query: 366 SFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDDSNLNIL 425
           S   V  +KL P  I   +IY      F L+S +   +V+ +  +  + +++DD +   L
Sbjct: 333 SLISVGSLKL-PGSIS--LIYGSC---FVLISAEKAAVVNLSRLTRSIERSLDDCDATEL 386

Query: 426 SEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMNNIKGXXXX 485
           SE     EIT  +  G F +       G + I+ +S   +   +++   +          
Sbjct: 387 SEEDLTEEIT--EKKGTFQSAGLWPESGMQKIVLLSEKEITSIDISSMQT-----PASST 439

Query: 486 XXXXXXXXXXYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSNESNEIQLE 545
                      +  + QP+ E+ TLN+  Q   + P S +I    RQ  L+N  NE QL 
Sbjct: 440 TEKIEKSETNRQRPYSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLS 499

Query: 546 ILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKNKNKEILK 605
           +LTD+SKE+++++   QTLG +LH RL  QQ EL + L+    +  K++ +         
Sbjct: 500 LLTDISKEVLSRVTLAQTLGLSLHLRLLGQQDELAQHLRDVSELRTKKERVSAHLASQKP 559

Query: 606 RWN--EQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQVHKFNSF 663
           RW   ++ N+S+ L  R ++L+  +  I+ S  L S PI   E+EWFKE+RNQV +FN  
Sbjct: 560 RWEAIQEKNKSIAL--RFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRL 617

Query: 664 VHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKE--------WEELRAILEQDSKIIK 715
           VH Q+D  E LS LK  L+ +  D       +SKK         W+EL+A+L +DS+IIK
Sbjct: 618 VHEQQDLAEALSSLKLSLEYVRVDSAEAAS-RSKKSAESAGGVPWDELQAMLAKDSRIIK 676

Query: 716 ECNIELTKTTESM 728
           EC  EL  TT+ +
Sbjct: 677 ECQAELQCTTQEL 689

>CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061w NUP82 nuclear pore protein
          Length = 716

 Score =  305 bits (781), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 229/728 (31%), Positives = 365/728 (50%), Gaps = 73/728 (10%)

Query: 20  TNEDSQRFFFTSHQGTRMV-LLQGCILKWCNVIDTTYHSMKVKSIFNNKRKIIDVKLSES 78
           T   +QRF F+S  GT++V +     L+WC+   TTY S+     F  + K+     S +
Sbjct: 14  TGNAAQRFLFSSSDGTKIVSIADRGHLRWCHSTSTTYKSLDFDLQF--EGKVEGAVSSTT 71

Query: 79  GDFLCIYTTKTIDILEIPWGYEKIPDEL--LSKFQPFHYDIXXXXXXXXXXXDIKQVLFH 136
            D++CIY    + +LE+PW Y    + L  L       +D             IKQVLFH
Sbjct: 72  ADYVCIYNRDELHVLEVPWMYSGEENGLKHLCHIYSHKFD---------ENHSIKQVLFH 122

Query: 137 PKSYHETCLVILYEDSIIQLIDT---TASTETITINQPTGTLGVETRVIDIESICFDKTT 193
           PKSY ++ +++L  D  I +I+T    +    I +N     LG+  R+ DI+ I F +  
Sbjct: 123 PKSYLDSTILVLTNDDSIFMINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQD- 181

Query: 194 GLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSLKENMSNDVKRNVI 253
           GL L  LS  +G DI+ +YPCLP R D+S  EVD L  KS++LY+++  N +   KRN++
Sbjct: 182 GLSLLILSAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIV 241

Query: 254 KQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVNFQGPFTISPFPNE 313
           KQL F  K++GQ              + A ++ K  L ++  Y     QGPF+++P+PNE
Sbjct: 242 KQLNFMEKIRGQ--------------KTAFRNDKKPLILEDAYLNAQPQGPFSMTPYPNE 287

Query: 314 LYSATAKESQCMKINENNELLIMTFDDGSVALLFRDLELTMSWDIANYIHDNSFALVELI 373
           LY   A +   ++I +N  LL + F +G+V L   DLE  MSWDI+ +   NS AL+E I
Sbjct: 288 LYDFMATDINIIQITQNISLLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQI 347

Query: 374 KLKPTDIGRLIIYQDNFGKFFLLSDDVI--MLVHTNSWSDKLAKAIDDSNLNILSEIGFE 431
           KL+ TD  + +     +GK F+++D+V     V+T  WS  LA+ IDDS++ +L+ +  +
Sbjct: 348 KLEITDNAKFLSIPGTYGK-FVVTDNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVK 406

Query: 432 SEI--------TWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVE-------NLTKKHSM 476
           S I        T+  ++   N    C Y        + SD    E       + T KH +
Sbjct: 407 SNIENLQQLATTFKSIIYWKNENISCNY--------IISDKKIEELDMLDGISSTTKHKL 458

Query: 477 NNIKGXXXXXXXX--XXXXXXYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIE 534
            +                   Y+V F +P+ E+    +++ K  +      I  E R   
Sbjct: 459 IDQSNSQVESKLDLPELKNGLYEVKFARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAP 518

Query: 535 LSNESNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIV----- 589
           L N SNE QLE LT +S+  +  I   QTLG+    R+ +   E +RQ++ T  +     
Sbjct: 519 LKNSSNENQLESLTKISESYMKMISMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWD 578

Query: 590 -FEKQDCIKNKNKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELE 648
            FE+   ++N   + +K       +  KL +RL +L +K+    +  ++++  I++ E E
Sbjct: 579 NFEQIREVQNTKIDKVKE------KQQKLMERLSSLYDKVEGQKEMGSMNNSNISAAESE 632

Query: 649 WFKEIRNQVHKFNSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILE 708
           WF EI+  V +FNS+V      ++EL F+K++  +I+N    +  E   KEW +L+ +L 
Sbjct: 633 WFAEIKRSVIEFNSYVRKASTNHQELEFIKEQQAQIANQKPDISSENG-KEWNDLQQLLR 691

Query: 709 QDSKIIKE 716
            D KII E
Sbjct: 692 TDLKIISE 699

>Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar to
           Ashbya gossypii AEL168C
          Length = 671

 Score =  255 bits (652), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 178/611 (29%), Positives = 313/611 (51%), Gaps = 54/611 (8%)

Query: 130 IKQVLFHPKSYHETCLVILYEDSIIQLIDTTAST---ETITINQPTGTLGVETRVIDIES 186
           IKQVL+HP +Y ++CLV+L +++ I+L +   +     T+ +N+    LG+ + V +I S
Sbjct: 97  IKQVLWHPLAYLDSCLVVLTKENTIELYELAKANFMYPTVVLNEKLPQLGISSHVSEICS 156

Query: 187 ICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSLKENMSN 246
           + F    GL LY LS+ +GGD+YAL+P LP+RL + +   +    K+  LY+S+ ++  N
Sbjct: 157 MAFSPD-GLTLYLLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPN 215

Query: 247 DVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDL--EYRLVNFQGP 304
           + K  +I+   F +K+          +KD E             DV++    R+V  +GP
Sbjct: 216 EKKIAMIEHFDFVSKIYKMI------DKDSE-----------FFDVNIPEHKRMVTPRGP 258

Query: 305 FTISPFPNELYSATAKESQCMKIN-ENNELLIMTFDDGSVALLFRDLELTMSWDIANYIH 363
           F+I  FP ELY+ TA +   + +N E   +LI++FDDG++  LF D+EL MSW   +  +
Sbjct: 259 FSIYGFPEELYNTTATKLITLPVNDEGAYVLILSFDDGTILSLFPDIELLMSWS-RSLNN 317

Query: 364 DNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNS------WSDKLAKAI 417
             SF L+E  +                G+ F +   V +L   N+      +   L + I
Sbjct: 318 ACSFVLIEKFRAG--------------GEIFAIESGVAILEKNNAHIVRFPYLKALGECI 363

Query: 418 DDSNLNILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMN 477
            + ++  + ++   S+IT   + G ++          + I+F+   N  + ++     ++
Sbjct: 364 KEGDIAPMVDVKLTSDIT--PLAGSYHTVVTWNEPSTKGILFIG--NSVIRSIPDDVGLS 419

Query: 478 NIKGXXXXXXXXXXXXXXYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSN 537
           + K               Y V F   ++EL+  N+  Q   R P   L+  E + + L++
Sbjct: 420 SFKPRVDPAISQNGK---YTVCFPSTMEELLKTNKALQHTLRQPLP-LVPLEQKNVPLNS 475

Query: 538 ESNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIK 597
           E NE QL  LT +S E++ +II  Q+LG+ ++NR   QQ EL RQL+    + ++   +K
Sbjct: 476 EFNEHQLATLTKISTEVMDRIILAQSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLK 535

Query: 598 NKNKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQV 657
              K +  R +    + + L  RL+ L + L  +N+SP  +  P++  E  WF+E++N V
Sbjct: 536 QNTKSLTCRLDSVSKKDIALRSRLEKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDV 595

Query: 658 HKFNSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKEC 717
             FN +V       EEL+FLKKEL+ I ++  ++ +E+    +E+L+ +L  DSK+I +C
Sbjct: 596 LAFNEYVLQNSKLCEELNFLKKELELIESNHGNIPNEELFN-FEKLQDLLTLDSKMIGDC 654

Query: 718 NIELTKTTESM 728
           N +L    + +
Sbjct: 655 NDQLLAAAKDL 665

>AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL061W
           (NUP82)
          Length = 673

 Score =  246 bits (629), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 200/731 (27%), Positives = 322/731 (44%), Gaps = 82/731 (11%)

Query: 11  HPIFGTSIITNEDSQRFFFTSH-QGTRMVLLQGCILKWCNVIDTTYHS------MKVKSI 63
           HPIF    +    S R    +H  GT++V      L+     + TY S       K  SI
Sbjct: 6   HPIFNADALGA--SHRLHAHTHGDGTKIVGYYNKHLRLGRFTEQTYKSWHAEVDAKASSI 63

Query: 64  FNNKRKIIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPDELLSKFQPFHYDIXXXXXX 123
            N            SG  L  Y    I+++                      D       
Sbjct: 64  LNG-----------SGSLLAFYGDHIIEVV----------------------DREGKKIT 90

Query: 124 XXXXXDIKQVLFHPKSYHETCLVILYEDSIIQLIDTTAST---ETITINQPTGTLGVETR 180
                 IKQVL+HP +Y ++CLV+L     I++ +         T+ +N+PT  LG+ +R
Sbjct: 91  LTVNGGIKQVLWHPLAYLDSCLVVLTGQETIEIYELNEPRYEKPTLVLNEPTSQLGISSR 150

Query: 181 VIDIESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSL 240
           VIDI +I F    GL LY  S S+GGD++ + P LP+R+   + +      K+  LY +L
Sbjct: 151 VIDITNIAF-APDGLSLYLFSTSEGGDVHVICPLLPSRIKADRAKWARQWNKATALYSTL 209

Query: 241 KENMSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVN 300
            ++  +D K   I+ L+F T+L  Q +E+   + +     H ++ +              
Sbjct: 210 TKDTPDDAKVATIEYLEFVTQLL-QAIEKNGSDGELVIPEHRRRTIS------------- 255

Query: 301 FQGPFTISPFPNELYSATAKESQCMKINENN-ELLIMTFDDGSVALLFRDLELTMSW--D 357
            QGP+ I  FP +LYSA   +   + + E+   LL+++FDD +  LLF   E+ MSW  D
Sbjct: 256 -QGPYNIHGFPEKLYSAVGTKLTVVPLGESEAHLLLLSFDDSTNILLFPSTEVLMSWTKD 314

Query: 358 IANYIHDNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAI 417
           + N     +  LVE      T  G      D      + S   + + +  +  D     I
Sbjct: 315 LKNAY---TLMLVEEF----TATGTAFATCDGVAVLGIDSAQRVEIPYLQALED----CI 363

Query: 418 DDSNLNILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMN 477
            D NL  L +I F S I    + GKF++       G + II V   +  +   T+    +
Sbjct: 364 RDCNLAALQDINFTSSIC--KIPGKFHSVARFNAPGNKGIILVGDHHAKIVPSTEAAKSD 421

Query: 478 NIKGXXXXXXXXXXXXXXYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSN 537
                             Y V F   ++E++  N+  Q++   P   L+ P  + I L++
Sbjct: 422 T----ETELDSQPGKEPTYTVCFPNSLEEILNTNKELQRRKHQPLP-LVPPALKNIPLNS 476

Query: 538 ESNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIK 597
           + NE  L  LT++SKE++ +II  Q+ G  +HNRL  QQ EL RQ++    +  +   ++
Sbjct: 477 DLNEQHLATLTNISKEVMDRIILSQSAGLLMHNRLSLQQYELHRQVETVADICSRHSVLR 536

Query: 598 NKNKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQV 657
           + ++ +  R    L R  +L  RL  L   L  IN S   S  P++  E +WF+E++NQ 
Sbjct: 537 DSSEAMSSRLTSVLKRDRRLKQRLCMLQSTLNRINSSHKFSDLPLSKKEADWFRELKNQA 596

Query: 658 HKFNSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKEC 717
             FN +V       +EL+FLK EL+ +         E+   ++  L+ +L+ DSKII EC
Sbjct: 597 ISFNDYVLQSAQLRDELAFLKNELESLPEHRQHDRQEEEPFDFRRLQELLKLDSKIITEC 656

Query: 718 NIELTKTTESM 728
              L+     +
Sbjct: 657 TDNLSAAAREL 667

>KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {ON}
           weakly similar to uniprot|P40368 Saccharomyces
           cerevisiae YJL061W NUP82 Subunit of the nuclear pore
           complex (NPC) forms a subcomplex with Nup159p and Nsp1p
           interacts with Nup116p and is required for proper
           localization of Nup116p in the NPC
          Length = 687

 Score =  176 bits (447), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 170/628 (27%), Positives = 280/628 (44%), Gaps = 71/628 (11%)

Query: 130 IKQVLFHPKSYHETCLVILYEDSIIQLIDTT-ASTETITI-NQPTGTLGVETRVIDIESI 187
           IK++L+HP + +    VIL++DS I++ D      E+IT+ N+ + + G+   V  +  I
Sbjct: 102 IKKLLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDI 161

Query: 188 CFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKE-------------VDLLLQKSI 234
            FD T GL LY LS  +  DIYA++PCLP    +   +              D +L KS+
Sbjct: 162 AFDPT-GLTLYLLSSFNYCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSL 220

Query: 235 VLYDSLKENMS------NDV-------KRNVIKQLQFATKLQGQFLEQLKGEKDEERTRH 281
            LY+SL + +        DV       K +++KQ+QF       F    K +  +  T  
Sbjct: 221 SLYNSLDKQLKLISGSDPDVESDYLTLKHDLLKQIQF-------FDNYKKNDGIDTFTSK 273

Query: 282 AQKDLKLILDVDLEYRLVNFQGPFTISPFPNELYSATAKESQCMKINENNELLIMTFDDG 341
           A ++                QGPF I  FP  L +        + + E   LL + F DG
Sbjct: 274 AIRNSVP-------------QGPFIIKKFPTALNAKEVTGLTIIPVGERLGLLNLQFIDG 320

Query: 342 SVALLFRDLELTMSWDIANYIHDNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVI 401
           +  +LF D E+ MSW + +    N+ +++ +   K    G+  +   +  K     D   
Sbjct: 321 TNVVLFSDSEIVMSWSLRSNTTFNNLSVITMFNAK----GQCQLLNSSEPKLVFTGDSST 376

Query: 402 MLVHTNSWSDKLAKAIDDSNLNILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVS 461
            ++    W + LA+ I   + +I+ ++ FE++I    V G F                +S
Sbjct: 377 TIMEM-PWLEPLAQCIRLHDFSIIDDVKFENKIR--TVSGTFLGVLST----------LS 423

Query: 462 SDNVFVENLTKKHSMNNIKGXXXXXXXXXXXXXXYKVTFKQPIDELMTLNELFQKQCRMP 521
            D ++  N  K    N+                 YK +      EL  L   ++ +    
Sbjct: 424 GDILYNGNSFKVIESNDKSTTQKPINRTDEVKYTYKPSLPTSGKELDMLLTKYKTEAN-G 482

Query: 522 FSKLIKPEDRQIELSNESNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTR 581
           F   I      + L N SNE QLE++++L KE + ++  GQ + F + N+  E+  EL R
Sbjct: 483 FISGIPDSLAPLPLKNNSNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAELHR 542

Query: 582 QLKHTQIVFEKQDCIKNKNKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYP 641
           QL+ T  +   ++ +     ++ +R++    +S  L  RL  L E   +I ++  L +  
Sbjct: 543 QLRKTNEIEMLRNKLNGNLGDLQERYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSS 602

Query: 642 ITSVELEWFKEIRNQVHKFNSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWE 701
           I+  EL WFK I+NQV KFN++VH      EEL FL  +L       T   D  S+ E+ 
Sbjct: 603 ISEAELVWFKSIKNQVLKFNNYVHLTNKLREELEFLDTQL----RSTTKGDDFFSELEFS 658

Query: 702 ELRAILEQDSKIIKECNIELTKTTESMA 729
            L+ +L  D K+I  C  EL+ + E +A
Sbjct: 659 SLQQMLLNDKKVINSCMNELSASIEDLA 686

>NDAI0G03230 Chr7 complement(760895..762394) [1500 bp, 499 aa] {ON}
           Anc_8.52 YFL022C
          Length = 499

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 38/59 (64%)

Query: 525 LIKPEDRQIELSNESNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQL 583
           ++K ++ ++E+S++     L+ + D +K L+ KI+DG+TL     N LK+++L   R+L
Sbjct: 111 IVKNKENELEVSDKFKSQPLDTIEDETKILLQKIVDGETLDTKTINDLKKRKLITPRKL 169

>CAGL0J07656g Chr10 complement(748336..751194) [2859 bp, 952 aa]
           {ON} highly similar to uniprot|P33338 Saccharomyces
           cerevisiae YNL243w SLA2 cytoskeleton assembly control
           protein
          Length = 952

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 48/75 (64%), Gaps = 4/75 (5%)

Query: 568 LHNRLKEQQLELTRQLKHTQI-VFEKQDCIKNKN--KEILKRWNEQLNRSVKLTDRLQNL 624
           L+++L+++ L+L  + K  QI V   Q+ + NK   ++ LK+ + QL  ++K  DRL+  
Sbjct: 473 LYSQLRQEHLQLLPRFKKLQIKVGSIQEAVANKEVLEQKLKKKDLQLIDAIKERDRLRLD 532

Query: 625 NEKLITINDSPNLSS 639
           NE+LI+ N S +L+S
Sbjct: 533 NERLIS-NKSEDLNS 546

>Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W
           (REAL)
          Length = 535

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 672 EELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKECNIELTK 723
           E  +FLK+ +DR+  ++    DE +K++ EE +  L  D K++K   IE TK
Sbjct: 169 EREAFLKQNVDRLEQEINKQTDEGTKQQLEEKKNELLNDWKVLK---IEYTK 217

>TDEL0H01310 Chr8 (224588..226165) [1578 bp, 525 aa] {ON} Anc_1.260
           YJL103C
          Length = 525

 Score = 32.0 bits (71), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 424 ILSEIGFESEITWFDVMGKFNNCTP-CKYHGKESIIFVSSDNVFVENLTKKHSMN 477
           +L EI  +  +  F+ M K  NCTP C +     I FVS++   +   +KK  +N
Sbjct: 383 LLQEIILQRTLLEFESMAKLLNCTPICIWRRSGEICFVSNEFASLTGFSKKEVLN 437

>SAKL0G19030g Chr7 (1642608..1645343) [2736 bp, 911 aa] {ON} similar
           to uniprot|Q04748 Saccharomyces cerevisiae YMR066W SOV1
           Synthesis Of Var (putative) involved in respiration
          Length = 911

 Score = 31.6 bits (70), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 51/104 (49%), Gaps = 5/104 (4%)

Query: 514 FQKQCRMPFSKLIKPEDRQIELSNESNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLK 573
           F+K+ R P + +  P+ R +E ++     +L +  D +++++    D + LGF   N+L 
Sbjct: 20  FRKRARFPSTHI--PQVRNVESNDSFGAKELRLHADSAEKVVE---DLKKLGFKDINQLN 74

Query: 574 EQQLELTRQLKHTQIVFEKQDCIKNKNKEILKRWNEQLNRSVKL 617
             +  L   L HT+  F+K     N+ K  L    ++ N  +K+
Sbjct: 75  SAEETLLEYLDHTKTDFKKSSKNLNRFKTALSNEKKESNNRMKV 118

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,958,249
Number of extensions: 3670994
Number of successful extensions: 15974
Number of sequences better than 10.0: 370
Number of HSP's gapped: 16560
Number of HSP's successfully gapped: 485
Length of query: 734
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 617
Effective length of database: 40,065,477
Effective search space: 24720399309
Effective search space used: 24720399309
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)