Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G029203.165ON48648624760.0
NCAS0C035803.165ON49150717340.0
Skud_15.913.165ON49150216240.0
YOL062C (APM4)3.165ON49150416190.0
Suva_15.1033.165ON49150316170.0
Smik_15.963.165ON49150416160.0
CAGL0C05203g3.165ON47549315870.0
ZYRO0B04840g3.165ON47649115690.0
TDEL0D045803.165ON48249515610.0
Kpol_1045.443.165ON46948814930.0
SAKL0C07414g3.165ON48250414780.0
KNAG0K011503.165ON47450014390.0
TPHA0P006603.165ON47348713900.0
TBLA0F008403.165ON48149313900.0
KLTH0F06534g3.165ON46648813830.0
Kwal_33.141823.165ON46749113820.0
Ecym_52393.165ON46449012491e-169
KLLA0C03894g3.165ON47549811641e-156
KAFR0C010203.165ON42849110791e-143
ADR315W3.165ON49245710801e-143
KNAG0L009507.127ON4615045033e-57
KLLA0D14311g7.127ON4434835004e-57
ADL017C7.127ON4434974928e-56
CAGL0K00539g7.127ON4564934928e-56
YPL259C (APM1)7.127ON4755104948e-56
Kwal_55.208437.127ON4414844892e-55
SAKL0F05346g7.127ON4474944874e-55
Ecym_83507.127ON4454924874e-55
KLTH0F12584g7.127ON4414994858e-55
Suva_16.457.127ON4785094878e-55
NDAI0E036807.127ON4444944832e-54
TBLA0A009507.127ON4695054842e-54
ZYRO0C05236g7.127ON4474944796e-54
NCAS0E021407.127ON4814274809e-54
Smik_6.4667.127ON4765064791e-53
TPHA0C043207.127ON4544984735e-53
KAFR0L004707.127ON4654404729e-53
Kpol_1062.567.127ON4505004603e-51
Skud_16.197.127ON4765134607e-51
TDEL0H028907.127ON4424994578e-51
KLLA0F25432g2.555ON5073532141e-17
KLTH0D07502g2.555ON5044722061e-16
KAFR0A020602.555ON5403421873e-14
Kwal_26.81462.555ON5053361856e-14
SAKL0D13090g2.555ON4994951802e-13
Ecym_45912.555ON5013411793e-13
ZYRO0E05874g2.555ON5493371722e-12
Kpol_1056.132.555ON5413481633e-11
ABR047W2.555ON4983481615e-11
TPHA0I023902.555ON5593581518e-10
TDEL0B064302.555ON5253351511e-09
NDAI0B016102.555ON6723241473e-09
NCAS0A126502.555ON5883661463e-09
Skud_8.262.555ON5963721421e-08
CAGL0K03223g2.555ON5982591421e-08
TBLA0B067602.555ON6572481375e-08
Suva_8.332.555ON5963701359e-08
KLTH0D06556g2.522ON4563181303e-07
KNAG0C055502.555ON5821461285e-07
Smik_8.232.555ON6033721286e-07
YHL019C (APM2)2.555ON6053771286e-07
KAFR0D035602.522ON4551491251e-06
KLLA0E18789g2.522ON4971451187e-06
Kwal_26.79572.522ON4563171106e-05
AGL061W2.522ON4113301081e-04
TBLA0I006202.522ON6091621082e-04
Kpol_1018.422.522ON5751591063e-04
SAKL0A09218g2.522ON473145970.003
TDEL0A029702.522ON496158940.007
TPHA0C041302.522ON533155910.015
ZYRO0B01738g2.522ON492155810.27
KNAG0F010602.44ON42860780.52
Skud_65.1singletonON322135770.63
CAGL0L02145g2.522ON543162770.69
KNAG0A069702.522ON50536741.7
Kpol_1065.303.344ON522105732.3
NDAI0K019302.522ON612174732.3
Suva_10.3198.432ON408182723.1
Kpol_507.73.575ON53361713.6
KAFR0A077602.44ON42588705.1
Smik_15.2515.677ON59134705.3
AGL332W5.23ON64752705.4
KAFR0B017808.76ON19054668.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G02920
         (486 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   958   0.0  
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   672   0.0  
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   630   0.0  
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   628   0.0  
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   627   0.0  
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   627   0.0  
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   615   0.0  
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   608   0.0  
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   605   0.0  
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   579   0.0  
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   573   0.0  
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   558   0.0  
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   540   0.0  
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   540   0.0  
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   537   0.0  
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   536   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   485   e-169
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   452   e-156
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   420   e-143
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   420   e-143
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   198   3e-57
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   197   4e-57
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   194   8e-56
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   194   8e-56
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   194   8e-56
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   192   2e-55
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   192   4e-55
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   192   4e-55
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   191   8e-55
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   192   8e-55
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   190   2e-54
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   191   2e-54
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   189   6e-54
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   189   9e-54
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   189   1e-53
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   186   5e-53
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   186   9e-53
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   181   3e-51
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   181   7e-51
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   180   8e-51
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...    87   1e-17
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...    84   1e-16
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...    77   3e-14
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...    76   6e-14
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...    74   2e-13
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...    74   3e-13
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...    71   2e-12
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...    67   3e-11
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...    67   5e-11
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...    63   8e-10
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...    63   1e-09
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    61   3e-09
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...    61   3e-09
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...    59   1e-08
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...    59   1e-08
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    57   5e-08
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...    57   9e-08
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    55   3e-07
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...    54   5e-07
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...    54   6e-07
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...    54   6e-07
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    53   1e-06
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    50   7e-06
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    47   6e-05
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    46   1e-04
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    46   2e-04
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    45   3e-04
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    42   0.003
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    41   0.007
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    40   0.015
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    36   0.27 
KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.4...    35   0.52 
Skud_65.1 Chr65 complement(2..967) [966 bp, 322 aa] {ON}  YPL060...    34   0.63 
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    34   0.69 
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    33   1.7  
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    33   2.3  
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    33   2.3  
Suva_10.319 Chr10 complement(560044..561270) [1227 bp, 408 aa] {...    32   3.1  
Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON} (49309..50...    32   3.6  
KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa] ...    32   5.1  
Smik_15.251 Chr15 (425070..426845) [1776 bp, 591 aa] {ON} YOR073...    32   5.3  
AGL332W Chr7 (88378..90321) [1944 bp, 647 aa] {ON} Syntenic homo...    32   5.4  
KAFR0B01780 Chr2 (348976..349548) [573 bp, 190 aa] {ON} Anc_8.76...    30   8.4  

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  958 bits (2476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/486 (96%), Positives = 469/486 (96%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60
           MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60

Query: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120
           KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS
Sbjct: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120

Query: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXXXXXXX 180
           CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKR        
Sbjct: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRNDSSQSHD 180

Query: 181 XXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGTPV 240
                    WRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGTPV
Sbjct: 181 SNFSFNDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGTPV 240

Query: 241 CQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQC 300
           CQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQC
Sbjct: 241 CQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQC 300

Query: 301 VSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIALKSL 360
           VSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIALKSL
Sbjct: 301 VSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIALKSL 360

Query: 361 FPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENTLSAVT 420
           FPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENTLSAVT
Sbjct: 361 FPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENTLSAVT 420

Query: 421 VPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKYVSKSG 480
           VPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKYVSKSG
Sbjct: 421 VPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKYVSKSG 480

Query: 481 SYEVRF 486
           SYEVRF
Sbjct: 481 SYEVRF 486

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/507 (66%), Positives = 401/507 (79%), Gaps = 37/507 (7%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60
           MIN +LI++ RGEL+VSKLFKG++KRSIADIFRIQVINNLDVRSPILTLGSTTFHHI+S+
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIKST 60

Query: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVML-G 119
           +  DNLW+VA +RNN +SAAIWEFLYKLDS+L  YGLN EEYLKEEFMIVHELLDVM+ G
Sbjct: 61  R-GDNLWIVAVSRNNVDSAAIWEFLYKLDSLLDSYGLNHEEYLKEEFMIVHELLDVMMCG 119

Query: 120 SCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNE--------------IS 165
           S GIP+ TE S VI++MSVKP+K       S+L+      G++               +S
Sbjct: 120 SGGIPMLTENSLVISRMSVKPSK-------SILEAQNSGNGSSNTNSNNNNNNVPDLLMS 172

Query: 166 MPKFLKRXXXXXXXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYV 225
            PK L+R                 WRPK I HKKNEVILHVNE+INILV+KDGS+LKAYV
Sbjct: 173 GPKLLRRNSASLSQDLSILTDFK-WRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYV 231

Query: 226 DGSIDLQTRLSGTPVCQFGLNDSLTLGSNDSE-YSSRN-----GRTGNNKSSMLDSNLSN 279
           DGSIDL+T LSGTP+CQFGLNDSL++   DS+ Y S N     G    +K+         
Sbjct: 232 DGSIDLETHLSGTPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDVNFDKTD-------K 284

Query: 280 KVLSKASVGNVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKIT 339
           K LS ASVG+VILEDCKFHQCVSLDKFD++RIIKFVPPDGS+ELMKYH+R+NLNLPFK++
Sbjct: 285 KQLSMASVGSVILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVS 344

Query: 340 PIVTNSVTGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAEN 399
           PIVTN+  G AL+YRI +KSLFPGRLSAK V LHIPVPP  MDC I+V+NG+CKF+P E+
Sbjct: 345 PIVTNTRNGTALEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEES 404

Query: 400 AMVWKFNKYNGLTENTLSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFT 459
           AM+W+FNK+NGLTENTLSAVT+P+K+  Q +LQQW++PPMSLDFEILMFSNSGLVVRYFT
Sbjct: 405 AMIWRFNKFNGLTENTLSAVTIPTKDNTQLSLQQWSKPPMSLDFEILMFSNSGLVVRYFT 464

Query: 460 ISEGHQNYKAVKWIKYVSKSGSYEVRF 486
           I+E  Q YKAVKWIKY+S+SGSYE+R+
Sbjct: 465 ITERDQKYKAVKWIKYISRSGSYEIRY 491

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/502 (61%), Positives = 383/502 (76%), Gaps = 27/502 (5%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60
           MI+G+L+YS RGELI++K FK +LKRSI+DIFR+QVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRS- 59

Query: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120
           K  DNLWLV  TR+NANSAAIWEFLYKLD+++  Y L++EE LKEEFMIVHE+LD+MLG 
Sbjct: 60  KHGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLGG 119

Query: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSK----------GNNEISMPKFL 170
            GIP++TE + V+A+MSVKP +    NT  LLDG  GS              E+  PKFL
Sbjct: 120 NGIPIDTELNSVVARMSVKPMR----NTGGLLDGADGSDILSSSSSPSSAGGELHFPKFL 175

Query: 171 KRXXXX-----XXXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYV 225
           K+                      WR   I HKK+EV L+VNE++NILV++DGSILK+YV
Sbjct: 176 KKSSSSFLGQGDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILKSYV 235

Query: 226 DGSIDLQTRLSGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNK-VLSK 284
           DG+ID+ T L+GTPVC+FGLNDSL + S D     +N     ++ S   S+  NK  L K
Sbjct: 236 DGTIDIVTHLNGTPVCRFGLNDSLGMQSEDE----KNWLAQQHQHSR--SDFGNKNFLPK 289

Query: 285 ASVGNVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTN 344
           A+ G+V+LEDCKFH+CVS++KF++  II+F+PPDGS+ELMKYH+R+N+NLPFKITPIV++
Sbjct: 290 AAAGSVLLEDCKFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNINLPFKITPIVSH 349

Query: 345 SVTGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWK 404
           S   + +DYRI LKSLFPG+LSAK V+LHIPVPP  +DC ISVSNG CKFVP ENAM+W+
Sbjct: 350 STRDNEIDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWR 409

Query: 405 FNKYNGLTENTLSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGH 464
           FNKYNGLTENTLSA TV + +  Q + QQW RPPMSLDFE++MFSNSGLVVRYFTIS   
Sbjct: 410 FNKYNGLTENTLSAATVSTSDTTQLSFQQWTRPPMSLDFEVMMFSNSGLVVRYFTISGKD 469

Query: 465 QNYKAVKWIKYVSKSGSYEVRF 486
             ++AVKWIKY+SKSGSYEVR+
Sbjct: 470 SKHRAVKWIKYISKSGSYEVRY 491

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/504 (61%), Positives = 383/504 (75%), Gaps = 31/504 (6%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60
           MI+G+L+YS RGEL+++K FK +LKRSI+DIFR+QVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRS- 59

Query: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120
           +  DNLWLV  TR+NANSAAIWEFLYKLD+++  Y L++EE LKEEFMIVHE+LD+MLG 
Sbjct: 60  RHGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLGG 119

Query: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSK----------GNNEISMPKFL 170
            GIP++TE + VIA+MSVKP +    N   LLD   G+              E+  PKFL
Sbjct: 120 NGIPIDTELNSVIAQMSVKPVR----NMGGLLDSPDGNDVLSSSSSPTSSAGELHFPKFL 175

Query: 171 KRXXXXXXXXXXXXXX-----XXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYV 225
            +                      WRPK I HKK+EV L+VNE+INILV++DGSILK+YV
Sbjct: 176 TKRSSSFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKSYV 235

Query: 226 DGSIDLQTRLSGTPVCQFGLNDSLTLGSNDSE--YSSRNGRTGNNKSSMLDSNLSNK-VL 282
           DG+ID+ T LSGTP+C+FGLNDSL + S D +   + +   +G        S+  NK  +
Sbjct: 236 DGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQRHSG--------SDFGNKNFI 287

Query: 283 SKASVGNVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIV 342
            KA+ G+V+LEDCKFH+CVSLDKF+R  II+FVPPDGS+ELMKYH+R+N+NLPFK+TPIV
Sbjct: 288 PKAAAGSVLLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNINLPFKVTPIV 347

Query: 343 TNSVTGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMV 402
           T+S   + +DYRI LKSLFPG+LSAK VVLHIPVPP  +DC ISVSNG CKFVP ENAM+
Sbjct: 348 THSTRDNEIDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMI 407

Query: 403 WKFNKYNGLTENTLSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISE 462
           W+FNKYNGLTENTLSAVTV + +  Q  LQQW RPP+SL+FE++MFSNSGLVVRYFTIS 
Sbjct: 408 WRFNKYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISG 467

Query: 463 GHQNYKAVKWIKYVSKSGSYEVRF 486
               ++AVKWIKY+SK+GSYEVR+
Sbjct: 468 KDSKHRAVKWIKYISKAGSYEVRY 491

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/503 (62%), Positives = 382/503 (75%), Gaps = 29/503 (5%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60
           MI+G+L+YS RGELI++K FK +LKRSI+DIFR+QVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSM 60

Query: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120
           +  DNLWLV  TR+NANSAAIWEFLYKLDS++  Y L++EE LKEEFMIVHE+LD+MLG 
Sbjct: 61  R-GDNLWLVTITRSNANSAAIWEFLYKLDSVMNAYRLDREEALKEEFMIVHEMLDIMLGG 119

Query: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDG----------HLGSKGNNEISMPKFL 170
            GIP++TE + VIA+MSVKP +    N   LL+              S    E+  PKFL
Sbjct: 120 NGIPIDTELNSVIAQMSVKPIR----NVGGLLESPDSIDMLSSTSSPSSVGGELHFPKFL 175

Query: 171 KRXXXX-----XXXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYV 225
           K+                      WRPK I HKK+EV L+VNE++NILV++DGSILK+YV
Sbjct: 176 KKRSSSFLGQGDSHSDFSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSILKSYV 235

Query: 226 DGSIDLQTRLSGTPVCQFGLNDSLTLGSNDSE-YSSRNGRTGNNKSSMLDSNLSNK-VLS 283
           DG+ID+ T LSGTPVC+FGLNDSL + S D E + S+  +  +N          NK    
Sbjct: 236 DGTIDITTHLSGTPVCRFGLNDSLGMQSEDQENWLSQQDQHSHN-------GFENKNCFP 288

Query: 284 KASVGNVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVT 343
           KA+ G+V+LEDCKFH+CVS+DKF++  II+FVPPDGS+ELMKYH+R+N+NLPFKITPIV 
Sbjct: 289 KAAAGSVLLEDCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNINLPFKITPIVA 348

Query: 344 NSVTGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVW 403
           +S   + +DYRI LKSLFPG+LSAK V+LHIPVPP  +DC ISVSNG CKFVP ENAM+W
Sbjct: 349 HSARDNEVDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIW 408

Query: 404 KFNKYNGLTENTLSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEG 463
           +FNK+NGLTENTLSAVTV + +  Q +LQQW RPPMSLDFE++MFSNSGLVVRYFTIS  
Sbjct: 409 RFNKFNGLTENTLSAVTVSTSDTTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTISSR 468

Query: 464 HQNYKAVKWIKYVSKSGSYEVRF 486
              ++AVKWIKY+SKSGSYEVR+
Sbjct: 469 DSKHRAVKWIKYISKSGSYEVRY 491

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/504 (61%), Positives = 380/504 (75%), Gaps = 31/504 (6%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60
           MI+G+LIYS RGEL+++K FK +LKRSI+DIFR+QVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRS- 59

Query: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120
           +  DNLWLV  TR+NANSAAIWEFLYKLD ++  Y L++EE LKEEFMIVHE+LD+MLG 
Sbjct: 60  RHGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGG 119

Query: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSK----------GNNEISMPKFL 170
            GIP++TE + VIA+MSVKP +    NT  LLD   G+            + E+  PKFL
Sbjct: 120 NGIPIDTELNSVIAQMSVKPVR----NTGGLLDSPDGNDMLSSSSSPSSVSGELHFPKFL 175

Query: 171 KRXXXXXXXXXXXXXX-----XXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYV 225
           K+                      WRPK I HKK+EV L+VNE++NILV++DGSILK+YV
Sbjct: 176 KKSSSSFLGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYV 235

Query: 226 DGSIDLQTRLSGTPVCQFGLNDSLTLGSNDSE---YSSRNGRTGNNKSSMLDSNLSNKVL 282
           DG+ID+ T LSGTP+C+FGLNDSL + S D +      ++   GN +S           +
Sbjct: 236 DGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESK--------NFI 287

Query: 283 SKASVGNVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIV 342
            KA+ G+V+LEDCKFH+CVSLDKF++   I+FVPPDGS+ELMKYH+R+N+NLPFKITPIV
Sbjct: 288 HKAAAGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIV 347

Query: 343 TNSVTGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMV 402
           T+S   + +DYRI LKSLFPG+LSAK V LHIPVPP  +DC ISVSNG CKFVP ENAM+
Sbjct: 348 THSTRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMM 407

Query: 403 WKFNKYNGLTENTLSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISE 462
           W+FNKYNGLTENTLSAVTV + +  Q  LQQW RPPMSLDFE++MFSNSGLVVRYFTI  
Sbjct: 408 WRFNKYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFG 467

Query: 463 GHQNYKAVKWIKYVSKSGSYEVRF 486
               ++AVKWIKY+S+SGSYEVR+
Sbjct: 468 KDSKHRAVKWIKYISRSGSYEVRY 491

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/493 (61%), Positives = 371/493 (75%), Gaps = 25/493 (5%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60
           MI+ +L++S RGELIVSK FK  LKRSI+DIFRIQVINNLDVRSPILTLGSTTF HIRS+
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60

Query: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120
              D+LWLV+ TR+N N  A+WEFLYK D ML  YGLN EE+LKEEFM+ +ELLDVMLG 
Sbjct: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120

Query: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXXXXXXX 180
            G P++T+P+ VI KMSVKP+K    N +      + +K +    +PKFL+R        
Sbjct: 121 NGTPMDTDPATVIKKMSVKPSKETIENFAI----SVQNKNSTLPKIPKFLRRTSSFLNQE 176

Query: 181 XXXXXXXXX-------WRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQT 233
                           WRPK I HKKNE+ L+VNEKI+ILV+K+GSILK+YVDG+IDL T
Sbjct: 177 SSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLVT 236

Query: 234 RLSGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILE 293
            LSGTPVCQFGLNDSL++ ++D   S              D   + K + KA+ G+V+LE
Sbjct: 237 HLSGTPVCQFGLNDSLSVKNDDYGDS-------------FDYIKNKKAIPKAAAGSVLLE 283

Query: 294 DCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDY 353
           DCKFHQCVSL+KFD++RIIKFVPPDGS+ELMKYH+R+N+NLPFK++PIVT S +G A++Y
Sbjct: 284 DCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEY 343

Query: 354 RIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTE 413
           RI LKSLFP +L+AK V + IPVPP  +DC I VSNG+CKF P E AM+W FNKYNGLTE
Sbjct: 344 RITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTE 403

Query: 414 NTLSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWI 473
           NTLSAVT+ SK+  +  +QQW +PP+SLDFEI+MFSNSGLVVRYFTI E  + YK VKWI
Sbjct: 404 NTLSAVTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESER-YKTVKWI 462

Query: 474 KYVSKSGSYEVRF 486
           +YVSKSGSYE+R+
Sbjct: 463 RYVSKSGSYEIRY 475

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/491 (62%), Positives = 374/491 (76%), Gaps = 20/491 (4%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60
           MIN I IYS RGELIVSKLF  +LKRSI+DIFRIQVINNLDVRSPILTLGSTTFHHIRS+
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120
             SD+LW+V  +R NANS AIWEFLYK +++L  Y L KEE LKE+FMI +E+LDV++G+
Sbjct: 61  -GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGA 119

Query: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNT---SSLLDGHLGSK-GNNEISMPKFLKRXXXX 176
            GIP++TE   + +K+SVKP K    ++   SS +    GS    + +SMPKFL R    
Sbjct: 120 GGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRNNRS 179

Query: 177 XXXXX-XXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRL 235
                         WRP  IK+KKNEV L+VNEKINILV++DGSILKAYVDG+ID+ T L
Sbjct: 180 MSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTTHL 239

Query: 236 SGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDC 295
           SGTP+CQFGLNDS ++   DS +   + +  +NK          K + KA+ G+V+LEDC
Sbjct: 240 SGTPICQFGLNDSPSVEFGDSLW--LDTQEFHNK----------KAVPKAAAGSVMLEDC 287

Query: 296 KFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRI 355
           KFHQCVSLDKF++ERIIKFVPPDG++ELMKY +R+NLNLPFKITP+VT    G  ++YRI
Sbjct: 288 KFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTP--CGSTVEYRI 345

Query: 356 ALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENT 415
            LKSLFP +LSAK V LHIPVPPG +DC I++SNG CKF   ENAMVW+FNKY+GLTENT
Sbjct: 346 TLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENT 405

Query: 416 LSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKY 475
           LSAVTVP+ +  Q TLQQW RPPMSL FEI+MFSNSGLVVRYF +S+  + Y+ VKWIKY
Sbjct: 406 LSAVTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKY 465

Query: 476 VSKSGSYEVRF 486
           +SKSGSYEVR+
Sbjct: 466 ISKSGSYEVRY 476

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/495 (61%), Positives = 374/495 (75%), Gaps = 22/495 (4%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60
           MI+ ILI+S RGELIV+K  K +LK+SI+DIFRIQVINNLDVRSPILTLGSTTFHHIRS 
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60

Query: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120
             SD+LWLVA +R+NANS AIWEFLYKL+ ++  YGL KE  LKE FM  +E+LD +L  
Sbjct: 61  -GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEE 119

Query: 121 CGIPLETEPSKVIAKMSVKPAKLHHNN--------TSSLLDGHLGSKGNNEISMPKFLKR 172
            GIP++TE + VI+KM+VKP K    N        T S L+       ++ +SMPKFL R
Sbjct: 120 GGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFLTR 179

Query: 173 XXXXXXXXXXXXX-XXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDL 231
                             WRP  IK+KKNEV+L+VNEKI+ILV++DGSILK+YVDG+IDL
Sbjct: 180 NNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTIDL 239

Query: 232 QTRLSGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVI 291
            T LSG P+CQFGLNDSL++     E+       G++  S ++   + K + KA+ G V+
Sbjct: 240 TTHLSGMPICQFGLNDSLSV-----EF-------GDDSISEVEDFANKKAIPKAAAGRVM 287

Query: 292 LEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDAL 351
           LEDCKFHQCVSLDKF+++R+IKFVPPDGS+ELMKY +R+NLNLPFK+TPIVT+   G+ +
Sbjct: 288 LEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTI 347

Query: 352 DYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGL 411
           DYR+ LKSLFPG+LSAK V L IPVPPG +DC I+VSNG CKFVP E+AM+WKF KY GL
Sbjct: 348 DYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGL 407

Query: 412 TENTLSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVK 471
           TENTLSAVTVPS +  Q T+QQW RPPMSL+FEI+MFSNSGLVVRYF +S+  + Y+  K
Sbjct: 408 TENTLSAVTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAK 467

Query: 472 WIKYVSKSGSYEVRF 486
           WIKY+SKSGSYE+R+
Sbjct: 468 WIKYISKSGSYEIRY 482

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/488 (60%), Positives = 356/488 (72%), Gaps = 21/488 (4%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60
           MING+L+Y+ +GELIVSK  K   KRSI+DIFR+QVINNLDVRSPILTLGSTTFHHIRS+
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120
              D+LWLVA TR+NANS AIWEFLYK DS+L  +GL+ E  LKEEFM  +ELLD+ML  
Sbjct: 61  S-RDHLWLVAVTRSNANSGAIWEFLYKFDSLLNAFGLDNETTLKEEFMTCYELLDLMLNV 119

Query: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXXXXXXX 180
            G+PL+TE S V AKMS KP  LH  N+ S       S     +S+ KFL R        
Sbjct: 120 DGVPLDTELSSVSAKMSTKP--LHSINSPSDSSLDNSSS---PLSISKFLNRNNRSMSVD 174

Query: 181 XXXXXXXXX-WRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGTP 239
                     WRP  IK+KKNE+ L++NEKI+ILV+KD +ILKAYVDG++DL + LSGTP
Sbjct: 175 TMNTEPSNYPWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTSHLSGTP 234

Query: 240 VCQFGLNDSLTLGSNDSEYSSRNG-RTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFH 298
            CQFGLNDSL++   +   S  NG R   N             + +A+ G V+LEDCKFH
Sbjct: 235 TCQFGLNDSLSVDEPNYYNSDDNGFRNQQN-------------IPRATAGTVVLEDCKFH 281

Query: 299 QCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIALK 358
           +CVSLDKF+R+RIIKFVPPDG +ELMKYH+R+N+NLPFK+TP V NS +   LDYRI LK
Sbjct: 282 ECVSLDKFNRDRIIKFVPPDGHIELMKYHVRDNINLPFKVTPNVINSRSRTGLDYRITLK 341

Query: 359 SLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENTLSA 418
           SLFP +LSA  VVL IPVP   +DC ++VSNG C+FVP E+ ++WKF KYNGLTEN LSA
Sbjct: 342 SLFPSKLSANDVVLKIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLTENKLSA 401

Query: 419 VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKYVSK 478
           VTV S +  Q  LQQWARPP+SLDFEI+MFSNSGLVVRY  I E  Q Y+ VKWIKY+S+
Sbjct: 402 VTVSSNDTTQLMLQQWARPPISLDFEIMMFSNSGLVVRYLKIMEKDQKYRTVKWIKYISR 461

Query: 479 SGSYEVRF 486
           SGSYEVR+
Sbjct: 462 SGSYEVRY 469

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/504 (58%), Positives = 361/504 (71%), Gaps = 40/504 (7%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60
           M+N + ++S +GEL+VSKL + T+KRS+A+IFRIQVINNLDVRSP+LTLGSTTFHHIRSS
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS 60

Query: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120
               NLW+VA TR+NA+SAAIWEFLYK +++L  YGLN EE LKEEFM  +ELLDV+L +
Sbjct: 61  S---NLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLEN 117

Query: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNN---EISMPKFLKRXXXXX 177
            G+P++TE S V +KMS +P     NN   L D  L S   N      MPKFL +     
Sbjct: 118 -GVPVDTELSSVASKMSRRPVVSLENN--PLTDELLMSAAANVDLGFRMPKFLNKGSRSS 174

Query: 178 XXXXXXXX-------XXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSID 230
                              WR   IK+KKNE+ L VNE+INILV+KDGSILK+YVDGS+D
Sbjct: 175 SSVSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVD 234

Query: 231 LQTRLSGTPVCQFGLNDSLTLG----SND----SEYSSRNGRTGNNKSSMLDSNLSNKVL 282
           L T LSGTP+CQFGLNDSL+L     S D    SEY  +N                 K +
Sbjct: 235 LTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKN----------------KKAI 278

Query: 283 SKASVGNVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIV 342
            KA+ G+V LEDCKFHQCV L++F+ +RII+FVPPDGS ELM+YH+R+NLNLPFKITPI 
Sbjct: 279 PKAAAGSVQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIF 338

Query: 343 TNSVTGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMV 402
           +      A++YR+ALKSLFP +L+AK VVL IPVPPG +DC I+ SNG C+FVP ENA++
Sbjct: 339 SVRSNNGAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVL 398

Query: 403 WKFNKYNGLTENTLSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISE 462
           WKF KY GLTENTLSA+TVP    +   LQQW+RPPMSL FEILMFSNSGLVVR+F +SE
Sbjct: 399 WKFAKYQGLTENTLSALTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSE 458

Query: 463 GHQNYKAVKWIKYVSKSGSYEVRF 486
              +Y  VKW+KY+S+SG+YEVR+
Sbjct: 459 RDHSYHTVKWVKYISRSGAYEVRY 482

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/500 (55%), Positives = 354/500 (70%), Gaps = 40/500 (8%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60
           MIN +L+YS RGELIVSK+FK TLKRS+ DIFR+QVIN+LDVRSPILTLGSTTFH++R+ 
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPILTLGSTTFHYVRTP 60

Query: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120
              + LW+V+ +RNN NSAA WEFLYK  +ML  Y L+ EE LKEEFM+  ELLD M+  
Sbjct: 61  --GEGLWVVSVSRNNENSAATWEFLYKFATMLAAYRLDSEEVLKEEFMLAWELLDTMVEG 118

Query: 121 CGIPLETEPSKVIAKMSVKPA----------KLHHNNTSSLLDGHLGSKGNNEISMPKFL 170
            GIP ET+P ++I+ MSVKPA          +     TS+   GH         + P+ L
Sbjct: 119 GGIPSETDPHRIISAMSVKPAMSPVDVRADARQQQTTTSTGAFGH---------AFPQLL 169

Query: 171 KRXXXXXXXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSID 230
            R                       + K+NE+++ V E I+ILV+KDGSILKAYVDG ID
Sbjct: 170 HRASNPGGISILPHATG-----DGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGID 224

Query: 231 LQTRLSGTPVCQFGLNDSL-TLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGN 289
           L T+L G  VCQFGLNDSL T  S++S++     +         ++  +N  +  A VG 
Sbjct: 225 LTTKLEGAAVCQFGLNDSLSTDNSSNSKWDPLRSK---------ETQGTNLEMKNAHVGT 275

Query: 290 VILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGD 349
           V+L DCKFHQCVSL++FDR+RII+F PP+G++ELMKYH+R+NLNLPFK+T +V  +   +
Sbjct: 276 VLLRDCKFHQCVSLERFDRDRIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPTANNE 335

Query: 350 ALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYN 409
             DYR+ +KSLFPG+LSAK V + IPVPPG +DC I+VSNG CKF+P ENAMVWKF+KYN
Sbjct: 336 T-DYRVTIKSLFPGKLSAKNVTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYN 394

Query: 410 GLTENTLSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQN--- 466
           GLTEN LSA+TVP+++  Q  LQQW+RPP+SLDFEILM+SN+GLVVRYFT+ + H N   
Sbjct: 395 GLTENKLSAITVPTRDTTQLALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTK 454

Query: 467 YKAVKWIKYVSKSGSYEVRF 486
           +K VKWIKYVS SGSYEVR+
Sbjct: 455 FKTVKWIKYVSHSGSYEVRY 474

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/487 (56%), Positives = 351/487 (72%), Gaps = 15/487 (3%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60
           MING+LIYS RG+LIV  L K +LKR+I+DIF+IQVIN+L+++SPILTLGSTTFHHIRSS
Sbjct: 1   MINGVLIYSSRGDLIVCDLLKSSLKRTISDIFKIQVINSLEMKSPILTLGSTTFHHIRSS 60

Query: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120
            +S  LW+VA TR+NANS  IWEFLYKLDSML  Y LN EE L E+FM+ +E++DVML S
Sbjct: 61  SES-KLWIVAITRSNANSGVIWEFLYKLDSMLTAYDLNNEEKLMEKFMVYYEMIDVMLTS 119

Query: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXXXXXXX 180
             +P+ TE S + +K+S +  K   N+ ++          NN +S+PKFL R        
Sbjct: 120 NAMPINTELSSIASKISYRLPKTISNSPTN------EKNNNNGLSIPKFLTRNSRSMSQE 173

Query: 181 XXXXXXXXX-WRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGTP 239
                     WRP  IK+KKNEV L+VNEKINILV+KD +ILKAYVDGSIDL + LSGTP
Sbjct: 174 FSNITQSDIPWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLVSHLSGTP 233

Query: 240 VCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQ 299
           +CQFGLND L++  N+   S+R     ++   M D +LS     ++S  +V +EDC FHQ
Sbjct: 234 ICQFGLNDYLSMTGNN--ISNRGDEFRHD--FMDDEDLST---GRSSSSSVKIEDCTFHQ 286

Query: 300 CVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIALKS 359
           CVSLDKF+ ER+I FVPPDGS ELM+YH+R++LN+PFK+TP V+ S +  ++ Y+I LKS
Sbjct: 287 CVSLDKFNDERLINFVPPDGSFELMRYHVRDDLNIPFKVTPRVSISSSRCSMRYKIILKS 346

Query: 360 LFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENTLSAV 419
           LFP  LSA   +L IP+PPG +DC I+ S+G C F  ++N  +WKFNKY GLTEN L   
Sbjct: 347 LFPTSLSAADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKGLTENELILE 406

Query: 420 TVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKYVSKS 479
           TVPS   +  +LQQW RPPMS++FEI+MFSNSGLVV+Y  + E  Q Y+ VKWIKYVSKS
Sbjct: 407 TVPSSSTDILSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMERVQKYRPVKWIKYVSKS 466

Query: 480 GSYEVRF 486
           GSYE+R+
Sbjct: 467 GSYEIRY 473

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/493 (52%), Positives = 356/493 (72%), Gaps = 19/493 (3%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60
           MIN ++I++PRGEL+V K+FK ++KR+I+DIFR+QVINN ++RSPILTLGSTTFH IR++
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRVQVINNDNIRSPILTLGSTTFHFIRTT 60

Query: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120
             S  LWLVA TR+NA+S AIWE+LYKL+S++  YGL  E+ LK+EF++ HELLD+ LG 
Sbjct: 61  AGS-KLWLVAVTRSNADSGAIWEYLYKLNSLMEVYGLTHEDILKDEFIVCHELLDITLGM 119

Query: 121 CGIPLETEPSKVIAKMSVKPAKL--HHNNTSSLLDGHLGSKGNNE--ISMPKFLKRXXXX 176
            G+P++TE S VI KM++KPA++     + S +L   + + G+N   ISMPKFL R    
Sbjct: 120 NGLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGHNSTPISMPKFLSRNSNR 179

Query: 177 XXXXXXXXXXXXX---WRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQT 233
                           WR +DIK+KKNE+I++V EKIN+LV KD +IL+AYVDG+ID+  
Sbjct: 180 SVTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTIDITA 239

Query: 234 RLSGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILE 293
            LSG P+CQ G+ND  T+   ++ + +   R  +N+ +M D           S   VILE
Sbjct: 240 HLSGMPMCQIGMNDLSTIQGGENAHWTNEDR-ASNRDAMPD----------VSGDRVILE 288

Query: 294 DCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDY 353
             KFHQCV+LDK++++ +I F+PPDG  ELMKYH+ NNLNLPF+ITP VT +  G AL Y
Sbjct: 289 GSKFHQCVALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTLTSHGTALSY 348

Query: 354 RIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTE 413
            I LKSLFP +LSA+ VVL IPVPPG +DC I+ S+G CKF+P EN MVW F+++NG TE
Sbjct: 349 AIKLKSLFPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHRFNGSTE 408

Query: 414 NTLSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWI 473
           N L+A TVP++ +   +++QW RPPMSLDF++LMFSN+GL+VRY  + E + +Y  +KWI
Sbjct: 409 NHLNAQTVPTQSIASQSIKQWTRPPMSLDFKVLMFSNTGLIVRYLKVQEKNMHYNTIKWI 468

Query: 474 KYVSKSGSYEVRF 486
           KY+S +GSYEVR+
Sbjct: 469 KYISAAGSYEVRY 481

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/488 (54%), Positives = 357/488 (73%), Gaps = 24/488 (4%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60
           M++ + I+S RGEL++SK  + ++ +S+++IFRIQVINNLDVRSP+LTLGSTTFHH++S 
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60

Query: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120
               NLW+VA +R+NA+SAAIWEFLYKL ++L  +GL+ E  LKE+FM  +ELLD++L  
Sbjct: 61  ---GNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLED 117

Query: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXXXXXXX 180
            G+P++TE S V +KMSVKP+       + +  G+ G+  N  + + +FL+         
Sbjct: 118 -GVPVDTELSSVASKMSVKPSASAERINTFIESGNGGT--NRILPVAQFLRARSSSSNLH 174

Query: 181 XXXXXXXXX--WRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGT 238
                      WR   IK+KKNEV L+VNE+I+ILV+KDGSILK+YVDG+++  T LSG 
Sbjct: 175 DSHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGM 234

Query: 239 PVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFH 298
           PVC+FGLNDSL++ +            G+N+S   +     K + KA+ G+V+LEDCKFH
Sbjct: 235 PVCRFGLNDSLSVST----------PFGDNESPTTN----KKAIPKAAAGSVMLEDCKFH 280

Query: 299 QCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIALK 358
           QCV LDKF  ER I F+PPDGS ELMKYH+R NLNLPFKITP+VT     +++DYR+ +K
Sbjct: 281 QCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVT-LFKANSIDYRVTIK 339

Query: 359 SLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENTLSA 418
           SLFP +L+AK V L IPVPP  +DC+IS SNG CKFVP E+A++WKF+KY GLTEN+LSA
Sbjct: 340 SLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSA 399

Query: 419 VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKYVSK 478
             VP K+ +   + QW++PPMSL FEI+MFSNSGLVVR+F +SEG +NYK VKWIKY+SK
Sbjct: 400 TAVPMKD-SALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSK 458

Query: 479 SGSYEVRF 486
           SG+YEVR+
Sbjct: 459 SGAYEVRY 466

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/491 (55%), Positives = 355/491 (72%), Gaps = 29/491 (5%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60
           M+N + IYS RGEL++SK  KG++++S+++IFRIQVINNLDVRSP+LTLGSTTFHHI+S+
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA 60

Query: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120
           K   NLW+VA +R+NA+SAAIWEFLY+L+ +L  + L  E  LKE FMI +ELLD++L  
Sbjct: 61  K---NLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLED 117

Query: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXXX--XX 178
            G+P++TE S V +KMSVKP     N      +GH G+  N  + + +FL+         
Sbjct: 118 -GLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGT--NRILPVSQFLRGRPSAGNLQ 174

Query: 179 XXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGT 238
                      WR   IK+KKNEV L+VNE+I+ILV+KDGSILK+YVDG+++  T LSG 
Sbjct: 175 DIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGM 234

Query: 239 PVCQFGLNDSLTLGS---NDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDC 295
           PVC+FGLND+L++ +   +D EY   N                 K + KA+ G+V+LEDC
Sbjct: 235 PVCRFGLNDALSVSTPFGDDDEYQVTN----------------KKAIPKAAAGSVMLEDC 278

Query: 296 KFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRI 355
           KFHQCV LDKF  ER I F+ PDGS ELMKYH+R NLNLPFK+TPIVT  V  +++DY+I
Sbjct: 279 KFHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVT-VVRSNSIDYQI 337

Query: 356 ALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENT 415
            +KSLFP +L+AK V L IPVPP  + C+IS SNG CKFVP E+A+VWKF+KY GLTEN+
Sbjct: 338 TIKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENS 397

Query: 416 LSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKY 475
           +SA  VP K+ +   ++QW RPP+SL FEI+MFSNSGLVVR+F +SE  +NYK VKWIKY
Sbjct: 398 ISATAVPMKD-STLNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKY 456

Query: 476 VSKSGSYEVRF 486
           +SKSG+YEVR+
Sbjct: 457 LSKSGAYEVRY 467

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  485 bits (1249), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 253/490 (51%), Positives = 335/490 (68%), Gaps = 30/490 (6%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60
           MI+ + +YSPRG+LI+SKL K  +K  +++IFRIQVINNLDVRSPILTLGSTTFHHIRS+
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120
                LWLV  +R N +SA IWEFLY  + +L  Y +N E+ L+ +FM+ +E+LD++L +
Sbjct: 61  ---GGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLDN 117

Query: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXXXXXXX 180
            GIP +TE + ++  +S KP          L +  LGS  ++ ++ P +L +        
Sbjct: 118 -GIPRDTELTHIMPYISKKP----------LSENLLGS--DDILNTPSWLVKAGARGMSS 164

Query: 181 X---XXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSG 237
                       WR + I++KKNEV L V E I+ILV KDG+ILK+YVDGS+     LSG
Sbjct: 165 ENLGLTSKDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSG 224

Query: 238 TPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKF 297
            PVCQFG ND L+  SN ++ S  +G       +        K +  A  G+VILEDCKF
Sbjct: 225 MPVCQFGFNDYLSPSSN-TQSSGNDGWAEEENGT--------KAIKNAITGSVILEDCKF 275

Query: 298 HQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIAL 357
           HQCV LDKFD+ER+I+FVPPDG  ELMKYH+R+NLNLPFK+TP+VT ++ G +++YRI L
Sbjct: 276 HQCVQLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVT-TLKGKSVEYRITL 334

Query: 358 KSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENTLS 417
           KSLFP +L AK V L+IP PP  ++  I+VS+G  KF+P ENA+VWK +KY+GLTEN  S
Sbjct: 335 KSLFPSKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFS 394

Query: 418 AVTVPSKEVNQT-TLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKYV 476
           AV VP    N +  L+QW+RPP+S+ FEI MFSNSGLVVRY  + E   NY  VKW+KY+
Sbjct: 395 AVIVPMGNGNDSLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYI 454

Query: 477 SKSGSYEVRF 486
           SKSG+YEVR+
Sbjct: 455 SKSGAYEVRY 464

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  452 bits (1164), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 231/498 (46%), Positives = 329/498 (66%), Gaps = 35/498 (7%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHH-IRS 59
           M++ I IY+ +G+L++SKL K  +KRS+AD+FR QVIN+  VRSPILTLGSTTF H IR 
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60

Query: 60  SKDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLG 119
           S D+  +WLVA +R+N +S+ IWE+L+KL  ++  +G+N E+ LK+EFM+++E+L++ L 
Sbjct: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120

Query: 120 SCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXXXXXX 179
           + GIP  T+ +++I ++S KP + +  + S  LD  L   G+N +  PK  KR       
Sbjct: 121 N-GIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLS--GSNILKAPKLSKRSSSSIAL 177

Query: 180 XXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGTP 239
                     WRP  +K+KKNEV L +NEKI ILV KDGSI+K++VDGS+D  + LSG P
Sbjct: 178 SSLSECP---WRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMP 234

Query: 240 VCQFGLNDSLTLGSND----------SEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGN 289
           +CQ GLND+ ++  N+          SEY  +N                 K +  A+ G+
Sbjct: 235 LCQLGLNDTYSIHGNEKSELSIVEMMSEYDIKN----------------KKAIPNAAAGS 278

Query: 290 VILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGD 349
           VILEDCKFHQCV L+K++   +I+FVPPDG  +LM+Y + +N+N+PF + P V   V   
Sbjct: 279 VILEDCKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEV-EIVKNS 337

Query: 350 ALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYN 409
            L+Y++ L+SLFP  +SAK V + IPVPP  + C+ +VS G CK+   E  MVWK+NKY 
Sbjct: 338 TLNYKVTLRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYK 397

Query: 410 GLTENTLSA-VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYK 468
           G TENTLS  V +P+   + + L +W+RPP+S+ FEI+MFSNSGLVVR+    E   NY+
Sbjct: 398 GSTENTLSGKVAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQ 457

Query: 469 AVKWIKYVSKSGSYEVRF 486
            VKWIKY+S SG+YE+R+
Sbjct: 458 PVKWIKYISHSGAYEIRY 475

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  420 bits (1079), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 233/491 (47%), Positives = 299/491 (60%), Gaps = 68/491 (13%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60
           MI+ ILIY+PRGELIVSKL++  +KRSI++IFRIQVINN +VRSPILTLGSTTFHHIRS+
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVINNFNVRSPILTLGSTTFHHIRST 60

Query: 61  KDS---DNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVM 117
            +    D LWLV   RNNANSAAIWEFL KL+ +L +YG+  E  LK+EFM VHE+LD M
Sbjct: 61  ANDPTDDELWLVCVNRNNANSAAIWEFLQKLNLILQQYGITSESKLKDEFMTVHEILDNM 120

Query: 118 LGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXXXX 177
           L   GI   T+   ++ KMSVKP     N T+S   G              FLKR     
Sbjct: 121 LLGTGIIQNTDLKSIVDKMSVKPIS-RTNETTSTQTG--------------FLKRRNTIL 165

Query: 178 XXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSG 237
                        R     HKKNE+   VNE +N+LV+KDGSILK YVDG I++++ L+G
Sbjct: 166 TTPGANFSLIPTNRHD--AHKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSHLNG 223

Query: 238 TPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKF 297
            P CQF L D  T                                         + D KF
Sbjct: 224 NPTCQFELVDDQTK----------------------------------------ITDFKF 243

Query: 298 HQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNN-LNLPFKITPIVTNSVTGDALDYRIA 356
            QC+  +K  + R ++    DG +E++ YH+R++ +N+PFKITPIV  S   D +DYRI+
Sbjct: 244 DQCI--EKV-QSRTVRVAATDGELEIVNYHVRDDKINIPFKITPIV--STVKDTVDYRIS 298

Query: 357 LKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENTL 416
           LKSLFP  LSA  VVL IPVPP  +DC I+VSNG CKF   +NA++W FNK+NG TENTL
Sbjct: 299 LKSLFPKNLSATDVVLTIPVPPNTIDCKINVSNGHCKFKAEQNAVIWTFNKFNGSTENTL 358

Query: 417 SAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISE-GHQNYKAVKWIKY 475
           SA+T+         L+ W RP + L FEI M+S SGL++R   I++   + YKA +WIKY
Sbjct: 359 SAITIADGR-QIMNLESWTRPSIQLTFEITMYSISGLLLRNLMITDKDKRRYKASRWIKY 417

Query: 476 VSKSGSYEVRF 486
           +S++GSYE+RF
Sbjct: 418 ISRAGSYEMRF 428

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  420 bits (1080), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 216/457 (47%), Positives = 295/457 (64%), Gaps = 39/457 (8%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60
           MI+   +++PRG LIVSKL  G  K S++++FR+QVIN L++RSP+LTLGSTTF HIR+S
Sbjct: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60

Query: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120
                LW+V   R NA+SAAIWEFLY ++ +L  Y +N EE L ++FM+ +ELLDV+L S
Sbjct: 61  ---GGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLDS 117

Query: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLD-GHLGSKGNNEISMPKFLKRXXXXXXX 179
            G+P +TE S ++  +S KPA     +    L+   L   G   +S+             
Sbjct: 118 -GLPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSVETL---------- 166

Query: 180 XXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGTP 239
                     WR + IK+KKNEV L V EK+++LV +DG+ILKAYVDG++     LSG P
Sbjct: 167 -DHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMP 225

Query: 240 VCQFGLNDSLTLG--SNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKF 297
           +C FG NDS +L   S   +Y+ R   T   +S                   V+LEDCKF
Sbjct: 226 LCHFGFNDSQSLRQRSPRRQYAPRVFGTDERES-------------------VVLEDCKF 266

Query: 298 HQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIAL 357
           HQCV L+KFD+ER+I+FVPPDG  ELMKYHIR++L  PFK+TP+V+  V   +++YRI L
Sbjct: 267 HQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSK-VNERSIEYRITL 325

Query: 358 KSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENTLS 417
           +SLFP +LSAK V L+IP PP  +   ++VS G CKFVP ENA++WK +K++GLTENTLS
Sbjct: 326 QSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLS 385

Query: 418 AVTVPSKEVN-QTTLQQWARPPMSLDFEILMFSNSGL 453
           AVT+  ++ +    L QW RPP+S+  EI+MFS + L
Sbjct: 386 AVTIADEQGHYAQVLDQWPRPPISMKLEIMMFSTAAL 422

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  198 bits (503), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 146/504 (28%), Positives = 248/504 (49%), Gaps = 64/504 (12%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLD---VRSPILTLGSTTFHHI 57
           M + +     +G+ ++S+ +K  +  S  D F   + +  D   V  P +      +  I
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 58  RSSKDSDNLWLVA-ATRNNANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELLD 115
           +     ++L++VA AT    N A ++ FL+KL  +L EY    +EE +++ F+I++EL+D
Sbjct: 61  QH----NDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMD 116

Query: 116 VMLGSCGIPLETEP---SKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKR 172
            M+   GIP  TEP    K I + S K  K H    ++       S+ NN +S       
Sbjct: 117 EMM-DYGIPQITEPRMLKKYITQKSFKLEKAHKKKRNA---ARPPSELNNSVS------- 165

Query: 173 XXXXXXXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQ 232
                            WR + IK+KKNE  L + E IN+L+ + G +L++ + G++ ++
Sbjct: 166 -----------------WRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAVKIK 208

Query: 233 TRLSGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGN------NKSSMLDSNLSNKVLSKAS 286
           +RLSG P  + G+ND        ++Y   N    N      + S + +S+++N    K  
Sbjct: 209 SRLSGMPDLKLGINDRGIF----TKYLEGNNIGVNIPDPQEHGSGVAESSITND--GKKR 262

Query: 287 VGNVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSV 346
             N+ LED KFHQCV L KF+ E+II F+PPDG  +LM Y +  ++  P     +     
Sbjct: 263 KTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK-PLIWCDVSIQVH 321

Query: 347 TGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFN 406
           +   ++ R   K+    +  A  V + IPVP      +   S+G+ K+VP ++A++WK  
Sbjct: 322 SKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKIK 381

Query: 407 KYNGLTENTLSAVTVPSKEVNQTTLQQWARP----PMSLDFEILMFSNSGLVVRYFTISE 462
            + G  E  + A      E+   ++  +  P    P+ + FEI  F+ SG+ VRY  I+E
Sbjct: 382 SFPGGKEYAMFA------EMGLPSMDSYEEPKVKRPVQVKFEIPYFTTSGIQVRYLKINE 435

Query: 463 GHQNYKAVKWIKYVSKSG-SYEVR 485
               YK+  W++Y+++SG  Y +R
Sbjct: 436 PKLQYKSYPWVRYITQSGDDYTIR 459

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  197 bits (500), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 133/483 (27%), Positives = 240/483 (49%), Gaps = 57/483 (11%)

Query: 11  RGELIVSKLFKGTLKRSIADIFR---IQVINNLDVRSPILTLGSTTFHHIRSSKDSDNLW 67
           +G+ ++S+ ++  + +S  + F+   ++      V  P        + +++     ++++
Sbjct: 11  KGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYVQY----NDVY 66

Query: 68  LVAATRN-NANSAAIWEFLYKLDSMLIEYGLN-KEEYLKEEFMIVHELLDVMLGSCGIPL 125
           ++A TR+ + N+  ++ F+YKL +++ EY    +EE +++ ++I++ELLD M+   G+P 
Sbjct: 67  VLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMMDK-GVPQ 125

Query: 126 ETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXXXXXXXXXXXX 185
            TE   +   ++ K  KL  +           ++  N +S                    
Sbjct: 126 VTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVS-------------------- 165

Query: 186 XXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGTPVCQFGL 245
               WRP+ IK+KKNE  L V E IN+L+ + G +L++ + G++ +++RLSG P  + GL
Sbjct: 166 ----WRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGL 221

Query: 246 NDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDK 305
           ND     +ND E S     +   K+S                 N+ LED KFHQCV L K
Sbjct: 222 NDKGIFTTNDQEDSPEPVVSSKKKNS-----------------NIELEDLKFHQCVRLSK 264

Query: 306 FDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIALKSLFPGRL 365
           F+ E+II F+PPDG  +LM Y +   +  P     +     +G  ++     K+    + 
Sbjct: 265 FENEKIITFIPPDGEFDLMTYRLSTPIK-PLIWCDVKVQVHSGSRIEIHCRAKAQIKKKS 323

Query: 366 SAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENTLSA-VTVPSK 424
            A  V + IP+P          S G  K+VP +NA++WKF+ + G  E +++A + +PS 
Sbjct: 324 VANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPS- 382

Query: 425 EVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKYVSKSG-SYE 483
            V+     +  R P+ + F+I  F+ SG+ VRY  I E    Y +  W++Y+++SG  Y 
Sbjct: 383 -VSDAEPPKLKR-PVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYT 440

Query: 484 VRF 486
           +R 
Sbjct: 441 IRL 443

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  194 bits (492), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 144/497 (28%), Positives = 243/497 (48%), Gaps = 67/497 (13%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFR---IQVINNLDVRSPILTLGSTTFHHI 57
           M +GI     +G+L++S+ +K  +  +  + F    I+      V  P  +     +  I
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 58  RSSKDSDNLWLVAATRN-NANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELLD 115
           +     ++L+++  T++ + N A ++ +L+KL  +L EY  + +EE +K+ F+I++ELLD
Sbjct: 61  QH----NDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLD 116

Query: 116 VMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXX 175
            M+   GIP  T+   +   ++ K  KL  +            K  N +  P  L     
Sbjct: 117 EMMDH-GIPQITDTKMLRQYITQKSFKLIRS----------AKKKKNVVRPPATL----- 160

Query: 176 XXXXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRL 235
                         WRP+ I +KKNE  L V E IN+L+ + G +L++ + G + +++RL
Sbjct: 161 ---------TNSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKVKSRL 211

Query: 236 SGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDC 295
           SG P  + GLND       D +        G  K S                 N+ LED 
Sbjct: 212 SGMPDLKLGLNDKGIFAQGDDDDDEEGASGGTKKKS-----------------NIELEDL 254

Query: 296 KFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSV-----TGDA 350
           KFHQCV L KF+ E+II F+PPDG  ELM Y     L+ P K  P++   V     +   
Sbjct: 255 KFHQCVRLTKFENEKIITFIPPDGDFELMSYR----LSTPIK--PLIWCDVKLQVHSRSR 308

Query: 351 LDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNG 410
           ++     K+    + +A  V + IPVP          S+GT K+VP++NA++WK   + G
Sbjct: 309 IEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPG 368

Query: 411 LTENTLSA-VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKA 469
             + +++A + +PS  V+  +  +  R P+ + F+I  F+ SG+ VRY  I+E    Y +
Sbjct: 369 GKDYSMAAEMGLPS--VSDNSDHKLKR-PVQIKFQIPYFTTSGIQVRYLKINEPKMQYNS 425

Query: 470 VKWIKYVSKSG-SYEVR 485
             W++Y+++SG  Y +R
Sbjct: 426 YPWVRYITQSGDDYTIR 442

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  194 bits (492), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 144/493 (29%), Positives = 242/493 (49%), Gaps = 45/493 (9%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVIN---NLDVRSPILTLGSTTFHHI 57
           M + I     +G  ++S+ ++  +  S  D F I + N     ++  P +      F  I
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 58  RSSKDSDNLWLVA-ATRNNANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELLD 115
           +     ++L+LVA AT  + N+A I+ FL+K+  +L EY    +EE +++ F+I++ELLD
Sbjct: 61  QH----NDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLD 116

Query: 116 VMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXX 175
            M+   GIP  TEP  +   ++ K  KL              +   N +S          
Sbjct: 117 EMM-DYGIPQITEPKMLKQYITQKSFKLKKAAKKKRNAARPPTSLTNSVS---------- 165

Query: 176 XXXXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRL 235
                         WRP+ IKHKKNE  L + E IN+L+ + G +L++ + G + ++++L
Sbjct: 166 --------------WRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKL 211

Query: 236 SGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDC 295
           SG P  + G+ND        S+Y    G       +  DS++      K    N+ LED 
Sbjct: 212 SGMPDLKLGINDKGLF----SKY--LEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDL 265

Query: 296 KFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRI 355
           KFHQCV L KF+ E+ I F+PPDG  ELM Y +   +  P     +   + +   ++   
Sbjct: 266 KFHQCVRLSKFENEKQITFIPPDGDFELMSYRLSTAIK-PLIWCDVNIKTHSKSRIEIFC 324

Query: 356 ALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENT 415
             K+    + +A  V + IPVP          S+G+ K+VP +NA++WK   + G  E +
Sbjct: 325 RAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYS 384

Query: 416 LSA-VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIK 474
           ++A + +PS    + +  +  + P+ + F+I  F+ SG+ VRY  I E +  YK+  W++
Sbjct: 385 MAAEMGLPSTNAGEES--EKLKRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVR 442

Query: 475 YVSKSG-SYEVRF 486
           Y++KSG  Y +R 
Sbjct: 443 YITKSGDDYTIRL 455

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  194 bits (494), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 148/510 (29%), Positives = 255/510 (50%), Gaps = 60/510 (11%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M + +      G+ ++S+ ++  +  S  D F I ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSSKDSDNLWLVA-ATRNNANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELL 114
           I+     ++L++VA  T  +AN+AAI+ FL+KL  +L +Y    +EE +++ F+I++ELL
Sbjct: 60  IQH----NDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELL 115

Query: 115 DVMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXX 174
           D ++   GIP  TE   +   ++ K  KL  +            K  N    P  L    
Sbjct: 116 DEVM-DYGIPQITETKMLKQYITQKSFKLVKS----------AKKKRNATRPPVAL---- 160

Query: 175 XXXXXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTR 234
                          WRP+ I HKKNE  L + E IN+L+ + G +L++ + G + + ++
Sbjct: 161 ----------TNSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSK 210

Query: 235 LSGTPVCQFGLNDSLTLG---SNDSEYSSRNGRTGNN------KSSMLDSNLSNKVLSKA 285
           LSG P  + G+ND         +D+   S +  T +N      K S+  S+ +NK     
Sbjct: 211 LSGMPDLKLGINDKGIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNK----- 265

Query: 286 SVGNVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNS 345
              N+ LED KFHQCV L KF+ E+II F+PPDG  +LM Y +   +  P     +    
Sbjct: 266 KKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQV 324

Query: 346 VTGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKF 405
            +   ++     K+    + +A  V + IPVP          S+G+ K+VP ++A++WK 
Sbjct: 325 HSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKI 384

Query: 406 NKYNGLTENTLSA-VTVPS----KEVNQTTLQQWA---RPPMSLDFEILMFSNSGLVVRY 457
             + G  E ++SA + +PS    ++ N+T  +  A   + P+ + F+I  F+ SG+ VRY
Sbjct: 385 RSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQVRY 444

Query: 458 FTISEGHQNYKAVKWIKYVSKSG-SYEVRF 486
             I+E    YK+  W++Y+++SG  Y +R 
Sbjct: 445 LKINEPKLQYKSYPWVRYITQSGDDYTIRL 474

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  192 bits (489), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 140/484 (28%), Positives = 235/484 (48%), Gaps = 66/484 (13%)

Query: 12  GELIVSKLFKGTLKRSIADIFR---IQVINNLDVRSPILTLGSTTFHHIRSSKDSDNLWL 68
           G++I+S+ ++  +  S  + F    ++      V  P LT     +  I+     +++++
Sbjct: 12  GKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFIQH----NDIYV 67

Query: 69  VAATRN-NANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELLDVMLGSCGIPLE 126
           +  +R+ + N A ++ FLYKL  +L EY    +EE +++ F+I++ELLD ML   GIP  
Sbjct: 68  LTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEML-DYGIPQI 126

Query: 127 TEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXXXXXXXXXXXXX 186
           TE   +   ++ K  KL  +            K  N +  P  L +              
Sbjct: 127 TETKMLKQYITQKSYKLIKS----------VKKSKNVVRPPAQLTKSVS----------- 165

Query: 187 XXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGTPVCQFGLN 246
              WRP+ I +KKNE  L V E IN+L+   G +L++ + G + +++RLSG P  + GLN
Sbjct: 166 ---WRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLN 222

Query: 247 DSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKF 306
           D    G   SE    N   G+ K S                 N+ LED +FHQCV L KF
Sbjct: 223 DK---GIFTSEEGGNNAEGGSGKKS-----------------NIELEDLQFHQCVRLSKF 262

Query: 307 DRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIALKSLFPGRLS 366
           + E+II F+PPDG  +LM Y +   +  P           +   ++     K+    + +
Sbjct: 263 ENEKIISFIPPDGDFDLMNYRLSTPIK-PLIWCDAKIQVHSQSRIEIHCRAKAQIKKKST 321

Query: 367 AKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENTLSA-VTVPSK- 424
           A  V + IPVP          S+G+ K+VP ++A++W+   +NG  E + +A + +PS  
Sbjct: 322 ANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMT 381

Query: 425 --EVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKYVSKSG-S 481
             EV +      A+ P+ + F+I  F+ SG+ VRY  + E    Y++  W++Y+++SG  
Sbjct: 382 DVEVPK------AKRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDD 435

Query: 482 YEVR 485
           Y +R
Sbjct: 436 YTIR 439

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  192 bits (487), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 138/494 (27%), Positives = 239/494 (48%), Gaps = 56/494 (11%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRS---PILTLGSTTFHHI 57
           M + I     +G+ I+S+ +K  +  +  D F + ++      S   P L      +  +
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 58  RSSKDSDNLWLVAATRN-NANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELLD 115
           +     ++L+++  TR+ + N A ++ FLYK+  +L EY  + +EE +++ F+I++ELLD
Sbjct: 61  QH----NDLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLD 116

Query: 116 VMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXX 175
            M+   GIP  TE   +   ++ K  KL  +            K  N I  P  L     
Sbjct: 117 EMM-DYGIPQITETKMLKQYITQKSFKLMKS----------AKKSKNVIRPPIAL----- 160

Query: 176 XXXXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRL 235
                         WRP+ I +KKNE  L V E IN+L+ + G +L++ + G + +++ L
Sbjct: 161 ---------TNSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEILGKVKVKSHL 211

Query: 236 SGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDC 295
           SG P  + GLND               G   N+ S  ++    +   +     N+ LED 
Sbjct: 212 SGMPDLKLGLND--------------KGIFSNHVSGGVEDEADDLSATGKKKANIELEDL 257

Query: 296 KFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRI 355
           KFHQCV L KF+ E+II F+PPDG  ELM Y +   +  P     I     +   ++   
Sbjct: 258 KFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIK-PLIWCDIKIQVHSKSRIEVHC 316

Query: 356 ALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENT 415
             K+    + +A  V + IPVP          S+G+ K+ P +NA++WK   + G  E +
Sbjct: 317 RAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYS 376

Query: 416 LSA-VTVPS-KEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWI 473
           ++A + +PS  +  +  +++    P+ + F+I  F+ SG+ VRY  I+E    Y++  W+
Sbjct: 377 MAAQLGLPSVSDFEEPVMKR----PVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWV 432

Query: 474 KYVSKSG-SYEVRF 486
           +Y+++SG  Y +R 
Sbjct: 433 RYITQSGDDYTIRM 446

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  192 bits (487), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 143/492 (29%), Positives = 242/492 (49%), Gaps = 66/492 (13%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVI---NNLDVRSPILTLGSTTFHHI 57
           M +GI     +G+L++S+ +K  +  S  + F   +I      +V  P  +     +  I
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 58  RSSKDSDNLWLVAATRN-NANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELLD 115
           +     ++L+++  TR+  AN A ++ FL+ L  +L EY  + +EE +K+ F+I++ELLD
Sbjct: 61  QH----NDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLD 116

Query: 116 VMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXX 175
            ++ S GIP  T+   +   ++ K  KL  +            K  N +  P  L     
Sbjct: 117 EVMDS-GIPQITDTKMLRQYITQKSFKLIRS----------AKKKKNVVRPPSSL----- 160

Query: 176 XXXXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRL 235
                         WRP+ IK+KKNE  L V E IN+++ + G +L++ + G + +++RL
Sbjct: 161 ---------TTAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKVRSRL 211

Query: 236 SGTPVCQFGLNDS-LTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILED 294
           SG P  + GLND  +   SN+ E    + +    +                   N+ LED
Sbjct: 212 SGMPDLKLGLNDKGIFTQSNEEEEDEPSSQPSITRKK----------------SNIELED 255

Query: 295 CKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSV-----TGD 349
            KFHQCV L KF+ E+II F+PPDG  ELM Y     L+ P K  P++         +  
Sbjct: 256 LKFHQCVRLSKFENEKIITFIPPDGDFELMSYR----LSTPIK--PLIWCDAKIQVHSRS 309

Query: 350 ALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYN 409
            ++     K+    + +A  V + IPVP          S+G+ K+VP +NA++WK   + 
Sbjct: 310 RVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNAILWKIKSFP 369

Query: 410 GLTENTLSA-VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYK 468
           G  + +++A + +PS  VN      + R P+ + F+I  F+ SG+ VRY  I+E    Y 
Sbjct: 370 GGKDYSMAAEMGLPS--VNDIADYNFKR-PVQIKFQIPYFTTSGIQVRYLKINEPKLQYN 426

Query: 469 AVKWIKYVSKSG 480
           +  W++Y+++SG
Sbjct: 427 SYPWVRYITQSG 438

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  191 bits (485), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 143/499 (28%), Positives = 241/499 (48%), Gaps = 74/499 (14%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFR---IQVINNLDVRSPILTLGSTTFHHI 57
           M + I     +G++I+S+ ++  +  S  + F    ++      +  P LT     +  I
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 58  RSSKDSDNLWLVAATRN-NANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELLD 115
           +     ++++++  +R+ + N A ++ FLYKL  +L EY    +EE +++ F+I++ELLD
Sbjct: 61  QH----NDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLD 116

Query: 116 VMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXX 175
            ML   GIP  TE   +   ++ K  KL  +            K  N I  P  L +   
Sbjct: 117 EML-DYGIPQITETKMLKQYITQKSYKLIKS----------AKKSKNVIRPPSQLTKSVS 165

Query: 176 XXXXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRL 235
                         WRP+ I +KKNE  L V E IN+L+   G +L++ + G +++++RL
Sbjct: 166 --------------WRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVNVRSRL 211

Query: 236 SGTPVCQFGLNDS--LTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILE 293
           SG P  + GLND    T   + S   +  G+                        N+ LE
Sbjct: 212 SGMPDLKLGLNDKGIFTSVESASSSEATEGKK----------------------SNIELE 249

Query: 294 DCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSV-----TG 348
           D KFHQCV L KF+ E+II F+PPDG  ELM Y     L+ P K  P++         + 
Sbjct: 250 DLKFHQCVRLSKFENEKIITFIPPDGDFELMNYR----LSTPIK--PLIWCDAKIQVHSQ 303

Query: 349 DALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKY 408
             ++     K+    + +A  V + IPVP          S+G+ K+VP ++A++WK   +
Sbjct: 304 SRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWKIKTF 363

Query: 409 NGLTENTLSA-VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNY 467
           NG  E + +A + +PS    +      A+ P+ + F+I  F+ SG+ VRY  I+E    Y
Sbjct: 364 NGGKEYSFAAQLGLPSMTDAEVPR---AKRPIQVKFQIPYFTTSGIQVRYLKINEPKLQY 420

Query: 468 KAVKWIKYVSKSG-SYEVR 485
           ++  W++Y+++SG  Y +R
Sbjct: 421 QSYPWVRYITQSGDDYTIR 439

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  192 bits (487), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 146/509 (28%), Positives = 257/509 (50%), Gaps = 55/509 (10%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M + +      G+ ++S+ ++  +  S  D F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSSKDSDNLWLVA-ATRNNANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELL 114
           I+     ++L+LVA AT  +AN+AAI+ FL+KL  +L +Y    +EE +++ F+I++ELL
Sbjct: 60  IQH----NDLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELL 115

Query: 115 DVMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXX 174
           D ++   GIP  TE   +   ++ K  KL  +            K  N    P  L    
Sbjct: 116 DEVM-DYGIPQITETKMLKQYITQKSFKLVKS----------AKKKRNATRPPVAL---- 160

Query: 175 XXXXXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTR 234
                          WRP+ I HKKNE  L + E IN+L+ + G +L++ + G + + ++
Sbjct: 161 ----------TNSVSWRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSK 210

Query: 235 LSGTPVCQFGLND----SLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVG-- 288
           LSG P  + G+ND    S  L  + +   + +  T +NK+  +D++    + S ++    
Sbjct: 211 LSGMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTD-VDTDKKPSITSSSTASKR 269

Query: 289 --NVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSV 346
             N+ LED KFHQCV L KF+ E+II F+PPDG  +LM Y +   +  P     +     
Sbjct: 270 KVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVH 328

Query: 347 TGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFN 406
           +   ++     K+    + +A  V + IPVP          S+G+ K+VP ++A++WK  
Sbjct: 329 SNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLR 388

Query: 407 KYNGLTENTLSA-VTVPS----KEVNQTTLQQWA---RPPMSLDFEILMFSNSGLVVRYF 458
            + G  E ++SA + +PS     + ++T  +  A   + P+ + F+I  F+ SG+ VRY 
Sbjct: 389 SFPGGKEYSMSAELGLPSISNGNDGSKTIPKNNAEILKGPVQIKFQIPYFTTSGIQVRYL 448

Query: 459 TISEGHQNYKAVKWIKYVSKSG-SYEVRF 486
            I+E    YK+  W++Y+++SG  Y +R 
Sbjct: 449 KINEPKLQYKSYPWVRYITQSGDDYTIRL 477

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  190 bits (483), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 137/494 (27%), Positives = 238/494 (48%), Gaps = 59/494 (11%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M + I     +G  ++S+ ++  +  +  D F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFA-SLLADLEEESSVIPPCLTYNNTQYLF 59

Query: 57  IRSSKDSDNLWLVAATRN-NANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELL 114
           I+ S    +++LVA T     N A ++ FLYK+  +L +Y    +EE +++ ++I++ELL
Sbjct: 60  IQHS----DIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELL 115

Query: 115 DVMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXX 174
           D ++   GIP  TE   +   ++ K  KL              S   + +S         
Sbjct: 116 DELMDY-GIPQITETKMLKQYITQKSFKLVKAAKKKQNAARPPSALTDSVS--------- 165

Query: 175 XXXXXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTR 234
                          WR + IK+KKNE  L + E IN+L+ + G IL++ + G + +++R
Sbjct: 166 ---------------WRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKIKSR 210

Query: 235 LSGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILED 294
           LSG P  + G+ND        +E  + N  T   ++                   + LED
Sbjct: 211 LSGMPDLKLGINDKGIFSKQLTEDDTNNNATSKKQN------------------KIELED 252

Query: 295 CKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYR 354
            KFHQCV L KF+ E+II F+PPDG  ELM Y +  ++  P     +     +   ++  
Sbjct: 253 LKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNVQVHSNSRIEIH 311

Query: 355 IALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTEN 414
              K+    + +A  V + IPVP      N   S+G+ K+VP ++A++WK   + G  E 
Sbjct: 312 CRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEY 371

Query: 415 TLSA-VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWI 473
           +++A + +PS       +Q   + P+ + F+I  F+ SG+ VRY  I+E    YK+  W+
Sbjct: 372 SMAAELCLPSTSSKSEEVQN--KKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWV 429

Query: 474 KYVSKSG-SYEVRF 486
           +Y+++SG  Y +R 
Sbjct: 430 RYITQSGDDYTIRL 443

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  191 bits (484), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 146/505 (28%), Positives = 252/505 (49%), Gaps = 57/505 (11%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFR---IQVINNLDVRSPILTLGSTTFHHI 57
           M++ I     +G+ ++S+ ++  +  +  D F    +++     V  P LT     +  I
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 58  RSSKDSDNLWLVAATRN-NANSAAIWEFLYKLDSMLIEYGLN-KEEYLKEEFMIVHELLD 115
           +     ++L++VA T + + N++ ++ FL+KL  ++ EY  + +EE +++ F+I++ELLD
Sbjct: 61  QH----NDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLD 116

Query: 116 VMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXX 175
            M+   GIP  TE   +   ++ K  KL                  N +S          
Sbjct: 117 EMM-DYGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPQALTNSVS---------- 165

Query: 176 XXXXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRL 235
                         WRP+ IK+KKNE  L + E IN+L+ + G +L++ + G + +++RL
Sbjct: 166 --------------WRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKVRSRL 211

Query: 236 SGTPVCQFGLND----SLTLGSNDSEYSSRNG---RTGNNKSSMLDSNLSNKVLSKASVG 288
           SG P  + G+ND    S  L S  S  +S +       ++KSS    +      S     
Sbjct: 212 SGMPDLKLGINDKGIFSKYLESTSSNSNSNDDNSNEVNSSKSSTPQPSTGQDEGSSRKTS 271

Query: 289 NVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSV-- 346
           NV LED KFHQCV L KF+ E+II F+PPDG+ ELM Y     L  P K  P++   V  
Sbjct: 272 NVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYR----LTTPIK--PLIWCDVNI 325

Query: 347 ---TGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVW 403
              +   ++     K+    +  A  V + IPVP      +   S+G+ K+VP +NA++W
Sbjct: 326 HVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILW 385

Query: 404 KFNKYNGLTENTLSA-VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISE 462
           K   + G  E +++A + +PS + N+   +   + P+ + F+I  F+ SG+ VRY  ++E
Sbjct: 386 KIRSFAGGKEYSMAAQLGLPSIDDNE---KPKLKRPVQIKFQIPYFTTSGIQVRYLKVNE 442

Query: 463 GHQNYKAVKWIKYVSKSG-SYEVRF 486
               YK+  W++Y+++SG  Y +R 
Sbjct: 443 PKLQYKSYPWVRYITQSGDDYTIRL 467

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  189 bits (479), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 144/494 (29%), Positives = 241/494 (48%), Gaps = 70/494 (14%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFR---IQVINNLDVRSPILTLGSTTFHHI 57
           M++ +     +G  I+S+ ++  +  S  D F    +Q+     V  P L+     +  I
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 58  RSSKDSDNLWLVA-ATRNNANSAAIWEFLYKLDSMLIEYGLN-KEEYLKEEFMIVHELLD 115
           +     ++L++VA AT    N A ++ FL+KL  +L EY  + +EE +++ F+I++ELLD
Sbjct: 61  QH----NDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLD 116

Query: 116 VMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXX 175
            M+   GIP  TE   +   ++ K  KL      S       ++  N +S          
Sbjct: 117 EMM-DYGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVS---------- 165

Query: 176 XXXXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRL 235
                         WR  +I HKKNE  L + E IN+L+ + G +L++ + G I ++++L
Sbjct: 166 --------------WRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQIKVKSKL 211

Query: 236 SGTPVCQFGLNDSLTLG---SNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVIL 292
           SG P  + G+ND          DS+  +     G  K+                  N+ L
Sbjct: 212 SGMPDLKLGINDKGIFSKYVEGDSDPVTTAVTEGKKKT------------------NIEL 253

Query: 293 EDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSV-----T 347
           ED KFHQCV L KF+ E+II F+PPDG+ ELM Y     L++P K  P++   V     +
Sbjct: 254 EDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYR----LSMPVK--PLIWCDVNVQVHS 307

Query: 348 GDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNK 407
              ++     ++    R  A  V + IPVP      +   ++G+ K+VP +NA++WK   
Sbjct: 308 QSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRS 367

Query: 408 YNGLTENTLSA-VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQN 466
           + G  E ++SA + +PS  +N     +  R P+ + F+I  F+ SG+ VRY  I+E    
Sbjct: 368 FTGGKEYSMSAQMGLPS--INALDKPKVKR-PVQIKFQIPYFTTSGIQVRYLKITEPKLL 424

Query: 467 YKAVKWIKYVSKSG 480
           YK+  W++Y+++SG
Sbjct: 425 YKSYPWVRYITQSG 438

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  189 bits (480), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 129/427 (30%), Positives = 214/427 (50%), Gaps = 44/427 (10%)

Query: 64  DNLWLVA-ATRNNANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELLDVMLGSC 121
           ++++LVA A   +AN+A I+ FLYKL  +L  Y    +EE +++ F+I++ELLD  +   
Sbjct: 94  NDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETM-DY 152

Query: 122 GIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXXXXXXXX 181
           GIP  TE   +   ++ K  KL                  N +S                
Sbjct: 153 GIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPEALTNSVS---------------- 196

Query: 182 XXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGTPVC 241
                   WR  DIK+KKNE  L + E IN+L+ + G IL++ + G + +++RLSG P  
Sbjct: 197 --------WRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDL 248

Query: 242 QFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCV 301
           + G+ND      +       +  + NN+ + + S+ ++K        N+ LED KFHQCV
Sbjct: 249 KLGINDKGIFSKH------MDDDSLNNEGASVASSTTDK-----KKNNIELEDLKFHQCV 297

Query: 302 SLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIALKSLF 361
            L KF+ E+II F+PPDG  ELM Y +  ++  P     +     +   ++     K+  
Sbjct: 298 RLSKFETEKIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNIQVHSQSRIEIHCRAKAQI 356

Query: 362 PGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENTLSA-VT 420
             + +A  V + IPVP          S+G+ K+VP +N ++WK   + G  E ++SA + 
Sbjct: 357 KKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQ 416

Query: 421 VPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKYVSKSG 480
           +PS        +  A+ P+ + F+I  F+ SG+ V+Y  I+E    YK+  W++Y+++SG
Sbjct: 417 LPSI---GNIEEHKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSG 473

Query: 481 -SYEVRF 486
             Y +R 
Sbjct: 474 DDYTIRL 480

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  189 bits (479), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 145/506 (28%), Positives = 250/506 (49%), Gaps = 51/506 (10%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M + +      G+ ++S+ ++  +  S  D F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFST-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSSKDSDNLWLVA-ATRNNANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELL 114
           I+     ++L+LVA  T   AN+AAI+ FL+KL  +L +Y    +EE +++ F+I++ELL
Sbjct: 60  IQH----NDLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELL 115

Query: 115 DVMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXX 174
           D ++   GIP  TE   +   ++ K  KL  +            K  N    P  L    
Sbjct: 116 DEVM-DYGIPQITETKMLKQYITQKSFKLVKS----------AKKKRNATRPPVAL---- 160

Query: 175 XXXXXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTR 234
                          WRP+ I HKKNE  L + E IN+L+ + G +L++ + G + + ++
Sbjct: 161 ----------TNSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSK 210

Query: 235 LSGTPVCQFGLNDSLTLG---SNDSEYSS--RNGRTGNNKSSMLDSNLSNKVLSKASVGN 289
           LSG P  + G+ND         NDS   S      + NN  +    ++++   +     N
Sbjct: 211 LSGMPDLKLGINDKGIFSKYLDNDSNIPSAVSAATSDNNTDTDKKPSITSSSTTSKRKVN 270

Query: 290 VILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGD 349
           + LED KFHQCV L KF+ E+II F+PPDG  +LM Y +   +  P     +     +  
Sbjct: 271 IELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSNS 329

Query: 350 ALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYN 409
            ++     K+    + +A  V + IPVP          S+G+ K+VP ++A++WK   + 
Sbjct: 330 RIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFP 389

Query: 410 GLTENTLSA-VTVP----SKEVNQTTLQQWA---RPPMSLDFEILMFSNSGLVVRYFTIS 461
           G  E ++SA + +P    SK+ ++T  +  A   + P+ + F+I  F+ SG+ VRY  I+
Sbjct: 390 GGKEYSMSAELGLPSISTSKDGSRTIPKSNAKLLKGPVQIKFQIPYFTTSGIQVRYLKIN 449

Query: 462 EGHQNYKAVKWIKYVSKSG-SYEVRF 486
           E    YK+  W++Y+++SG  Y +R 
Sbjct: 450 EPKLQYKSYPWVRYITQSGDDYTIRL 475

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  186 bits (473), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 144/498 (28%), Positives = 245/498 (49%), Gaps = 58/498 (11%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFR---IQVINNLDVRSPILTLGSTTFHHI 57
           M++GI      G+ I+++ ++  +  +  D F    +Q+     V  P +      +  I
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 58  RSSKDSDNLWLVAATRN-NANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELLD 115
           + S    ++++VA T +   N A I+ FL++L  +L EY  +  EE +++ F+I++ELLD
Sbjct: 61  KHS----DIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLD 116

Query: 116 VMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXX 175
            M+   GIP  TE +K++ K   +        +  L+      K  N    P  L     
Sbjct: 117 EMM-DFGIPQITE-TKMLKKYITQ-------KSFKLIKTSTSKKKKNAARPPAEL----- 162

Query: 176 XXXXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRL 235
                         WRP+ I +KKNE  L + E IN+LV + G +L++ + G++ +++RL
Sbjct: 163 ---------TNSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRSRL 213

Query: 236 SGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDC 295
           SG P  + G+ND        S Y   N   G++ S+ +   + +K         + LED 
Sbjct: 214 SGMPDLKLGINDRGIF----SNYLEENNVDGSSSSTPIPEGVEDK------KPQIELEDL 263

Query: 296 KFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSV-----TGDA 350
           KFHQCV L KF+ E+II F+PPDG  +LM Y     L  P K  P++   V     +   
Sbjct: 264 KFHQCVRLSKFENEKIITFIPPDGEFDLMNYR----LTTPIK--PLIWCDVNIQVHSKSR 317

Query: 351 LDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNG 410
           ++     K+    +  A  V + IPVP          S+G+ K++P +NA++WK   + G
Sbjct: 318 IEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAG 377

Query: 411 LTENTLSA-VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKA 469
             E ++SA + +PS +  +       R P+ + F+I  F+ SG+ VRY  ++E    YK+
Sbjct: 378 GKEYSMSAQLHLPSVDGVEPPK---VRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKS 434

Query: 470 VKWIKYVSKSGS-YEVRF 486
             W++Y+++SG  Y +R 
Sbjct: 435 YPWVRYITQSGEDYTIRL 452

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  186 bits (472), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 131/440 (29%), Positives = 229/440 (52%), Gaps = 56/440 (12%)

Query: 64  DNLWLVA-ATRNNANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELLDVMLGSC 121
           ++L+L A AT   AN + I+ FL+K+  +L  Y    +EE +++ F+I++ELLD M+   
Sbjct: 63  NDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEMM-DY 121

Query: 122 GIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXXXXXXXX 181
           G+P  TE   +   ++ K  KL   +          ++  N +S                
Sbjct: 122 GLPQITETKMLKKYITTKSFKLEKAHKKKRNAARPPTELTNSVS---------------- 165

Query: 182 XXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGTPVC 241
                   WRP+ IK+KKNE  L + E IN+L+ + G +L++ + G++ +++RLSG P  
Sbjct: 166 --------WRPEGIKYKKNEAFLDIIESINMLITQKGQVLRSEIVGNVRVKSRLSGMPDL 217

Query: 242 QFGLNDSLTLGSNDSEYSSRN----GRTGNNKSSMLDSNLSNKVLSKAS---VGNVILED 294
           + G+ND        ++Y   N     + G+++ +  D+N  + ++S+ S     N+ LED
Sbjct: 218 KLGINDRGIF----TKYLEGNNIGIAKNGDDEDAD-DTNNESSIVSEGSNKRKTNIELED 272

Query: 295 CKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYR 354
            KFHQCV L KF+ E+II F+PPDG  +LM Y +  +      I P++   V+     YR
Sbjct: 273 LKFHQCVRLSKFENEKIISFIPPDGEFDLMNYRLSTS------IKPLIWCDVSIQT--YR 324

Query: 355 IAL----KSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNG 410
           I +    K+    +  A  V + IPVP          S+G  K++P +N ++WK + + G
Sbjct: 325 IEIHCKAKAQIKKKSIATNVEILIPVPEDADSPIFKYSHGKIKYLPEKNLLLWKISSFPG 384

Query: 411 LTENTLSA-VTVPS---KEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQN 466
             E +++A + +PS   ++   T +   ++ P+ + F+I  F+ SG+ VRY  ++E    
Sbjct: 385 GKEYSMAAQMGLPSISGEDDLNTRVSNQSKKPVQVKFKIPYFTTSGIQVRYLKVNEPKLQ 444

Query: 467 YKAVKWIKYVSKSG-SYEVR 485
           YK   W++Y+++SG  Y +R
Sbjct: 445 YKTYPWVRYITQSGDDYTIR 464

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  181 bits (460), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 142/500 (28%), Positives = 240/500 (48%), Gaps = 65/500 (13%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLD---VRSPILTLGSTTFHHI 57
           M++G+      G+ I+S+ ++  +  S  D F   ++ + +   V  P L      +  I
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 58  RSSKDSDNLWLVAATRN-NANSAAIWEFLYKLDSMLIEYGLN-KEEYLKEEFMIVHELLD 115
           + S    ++++VA T +   N A I+ FL++L S+L +Y  + +EE +++ F+I++ELLD
Sbjct: 61  QHS----DIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLD 116

Query: 116 VMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXXX 175
            M+   GIP  TE   +   ++ K  KL                  N +S          
Sbjct: 117 EMM-DYGIPQITETKMLKQYITQKSFKLIKAAKKKRNAARPPVALTNSVS---------- 165

Query: 176 XXXXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRL 235
                         WR + IK+KKNE  L + E IN+L+ + G +L++ + G + +++RL
Sbjct: 166 --------------WRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVKSRL 211

Query: 236 SGTPVCQFGLNDSLTLG---SNDSEYSS-----RNGRTGNNKSSMLDSNLSNKVLSKASV 287
           SG P  + G+ND         N+ ++S       +  T N K S                
Sbjct: 212 SGMPDLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKS---------------- 255

Query: 288 GNVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVT 347
            N+ LED KFHQCV L KF+ E+II F+PPDG  ELM Y +   +  P     I     +
Sbjct: 256 -NIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK-PLIWCDINIQVHS 313

Query: 348 GDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNK 407
              ++     K+    +  A  V + IPVP          S+G+ K++P +NA++WK   
Sbjct: 314 KSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRS 373

Query: 408 YNGLTENTLSA-VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQN 466
           + G  E +++A + +PS  V+     +  R P+ + F+I  F+ SG+ VRY  I+E    
Sbjct: 374 FAGGKEYSMTAQLGLPS--VDGIEPPKVKR-PVQIKFQIPYFTTSGIQVRYLKINEPKLQ 430

Query: 467 YKAVKWIKYVSKSG-SYEVR 485
           YK+  W++Y+++SG  Y +R
Sbjct: 431 YKSFPWVRYITQSGDDYTIR 450

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  181 bits (460), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 145/513 (28%), Positives = 246/513 (47%), Gaps = 65/513 (12%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M + +      G+ ++S+ ++  +  S  D F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSSKDSDNLWLVA-ATRNNANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELL 114
           I+     ++L+LVA  T   AN+AAI+ FL+KL  +L +Y    +EE +++ F+I++ELL
Sbjct: 60  IQH----NDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELL 115

Query: 115 DVMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXX 174
           D ++   GIP   E   +   ++ K  KL  +            K  N    P  L    
Sbjct: 116 DEVM-DYGIPQICETKMLKQYITQKSFKLVKS----------AKKKRNATRPPVAL---- 160

Query: 175 XXXXXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTR 234
                          WRP+ I HKKNE  L + E IN+L+ + G +L++ + G + + ++
Sbjct: 161 ----------TNSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSK 210

Query: 235 LSGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSN----------KVLSK 284
           LSG P  + G+ND        S+Y   +  T    S+    N+++             SK
Sbjct: 211 LSGMPDLKLGINDKGIF----SKYLDDDSNTPPPTSAATSDNITDTDKKPSITSSSTTSK 266

Query: 285 ASVGNVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTN 344
             V N+ LED KFHQCV L KF+ E+II F+PPDG  +LM Y +   +  P     +   
Sbjct: 267 RKV-NIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQ 324

Query: 345 SVTGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWK 404
             +   ++     K+    + +A  V + IPVP          S+G+ K+VP ++A++WK
Sbjct: 325 VHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILWK 384

Query: 405 FNKYNGLTENTLSA-VTVPSKEVNQTTLQQWARP---------PMSLDFEILMFSNSGLV 454
              + G  E ++SA + +PS  ++       A P         P+ + F+I  F+ SG+ 
Sbjct: 385 LRSFPGGKEYSMSAELGLPS--ISNDIEGHRAIPKSNAEILKGPVQIKFQIPYFTTSGIQ 442

Query: 455 VRYFTISEGHQNYKAVKWIKYVSKSG-SYEVRF 486
           VRY  I+E    YK+  W++Y+++SG  Y +R 
Sbjct: 443 VRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  180 bits (457), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 143/499 (28%), Positives = 240/499 (48%), Gaps = 71/499 (14%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M++GI     +G  I+S+ ++  +  S  D F   ++ +L+  S    P L      +  
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRF-APLLADLEEESSVIPPCLNHRGIQYLF 59

Query: 57  IRSSKDSDNLWLVAATRNNA-NSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELL 114
           I    + ++L++VA + + A N+A ++ FL+KL   L +Y    +EE +++ F+I++ELL
Sbjct: 60  I----EHEDLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELL 115

Query: 115 DVMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRXX 174
           D M+   GIP  TE   +   ++ K  KL              +   N +S         
Sbjct: 116 DEMM-DYGIPQITETKMLKQYITQKSFKLIKAVKKVKATARPPTGLTNSVS--------- 165

Query: 175 XXXXXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTR 234
                          WR   I +KKNE  L + E IN+++ + G +L++ + G + +++R
Sbjct: 166 ---------------WRADGITYKKNEAFLDIVESINMVMNQQGQVLRSEIIGQVIVRSR 210

Query: 235 LSGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILED 294
           LSG P  + G+ND   + + D E        G  KSS                    LED
Sbjct: 211 LSGMPDLKLGINDK-GIFTRDPETGESQVTAGKKKSS------------------AELED 251

Query: 295 CKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSV-----TGD 349
            KFHQCV L KF+ E+II F+PPDG  ELM Y     L  P K  P++   V     +  
Sbjct: 252 LKFHQCVRLSKFENEKIITFIPPDGEFELMSYR----LTTPVK--PLIWCDVNVQVHSKS 305

Query: 350 ALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYN 409
            ++     K+    +  A  V + IPVP      +   S+G+ K+VP +NA++WK   + 
Sbjct: 306 RIEIHCRAKAQIKKKSVANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSFY 365

Query: 410 GLTENTLSA-VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYK 468
           G  E +++A + +PS  +N     ++ R P+ + F+I  F+ SG+ VRY  I+E    YK
Sbjct: 366 GGKEYSMAAQMGLPS--INGVEKPKFKR-PVQVKFQIPYFTTSGIQVRYLKINEPKLQYK 422

Query: 469 AVKWIKYVSKSG-SYEVRF 486
           +  W++Y++++G  Y +R 
Sbjct: 423 SYPWVRYITQNGDDYTIRL 441

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 84/353 (23%), Positives = 132/353 (37%), Gaps = 107/353 (30%)

Query: 190 WRPKDIKHKKNEVILHVNEKIN-ILVAKDGSILKAYVDGSIDLQTRLSGTPVCQFGLNDS 248
           WRPK I + KNE  L V EK+  I+  ++G +    ++G+I  ++ LSG P    GLN  
Sbjct: 181 WRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIICRSYLSGMPQLSIGLN-- 238

Query: 249 LTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKFDR 308
                                  ++  N+              ++  KFH+CV L    +
Sbjct: 239 ----------------------KLMQKNVH------------FMKRLKFHECVDLHTLIK 264

Query: 309 ER--IIKFVPPDGSVELMKYHIRNNLNLPFKITPIV------------TNSVTGDALDYR 354
           E   +IKF+PPDG  EL  Y     LN P    P++             N  T D L  +
Sbjct: 265 EESPVIKFIPPDGEFELCNY----KLNRPLLDEPVIKLQSFGLSQKPRKNQETQDKLLLK 320

Query: 355 IALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSN--------GTCKFVPAENAMVWKFN 406
            A+ + F  + SAK +++ IP+   +   NI +          G   F     +++WK N
Sbjct: 321 AAITTHFKAQDSAKELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAGSIIWKIN 380

Query: 407 KYNGLTENTLSAVTVPSK-------EVNQTTLQQWARPP--------------------- 438
              G   N    +    +       E  +  L+    PP                     
Sbjct: 381 NLKGGHGNKNYGLKCMFEIWDRQIHEALEVQLRNSMDPPPLRTGPKLERIWDQYHGKTTE 440

Query: 439 ----------------MSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKY 475
                           +++ FEI  ++ SGL V YF I E   NY++  W++Y
Sbjct: 441 YDGNENQKEDVDKFALIAMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRY 493

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 101/472 (21%), Positives = 188/472 (39%), Gaps = 97/472 (20%)

Query: 64  DNLWLVAATRNNA--NSAAIWEFLYKLDSMLIEY-GLNKEEY--LKEEFMIVHELLDVML 118
           D L+ V+ +      N   I  +L    ++L++Y  +NK +   + + F +++EL D  L
Sbjct: 58  DGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDRTGIIDNFNLIYELFDESL 117

Query: 119 GSCGIPLETEPS------KVIAKMSVKPAKLHHNNTSSLLDGHLGSKGN-NEISMPKFLK 171
              GIP  T+ +      K+ A +   P+    ++        L SK N ++  +  F  
Sbjct: 118 -DYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEILQSKENKDKADIHGFRD 176

Query: 172 RXXXXXXXXXXXXXXXXXWRPKDIKHKKNEVILHVNEKINILVA-KDGSILKAYVDGSID 230
                             WRPK I + KNE+ + + E+ + L+  K+  + + +V G I+
Sbjct: 177 DEQYINSFVLRTTTQAISWRPKGIYYTKNELFVDIIERQSYLMDFKNSQVRQTFVYGKIN 236

Query: 231 LQTRLSGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNV 290
            ++ LSG P+ +  +N  L                        D +L             
Sbjct: 237 CRSYLSGMPIVRVCINKMLK-----------------------DKDL------------- 260

Query: 291 ILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPI---VTNSVT 347
            L   KFHQCVSL+    +  I+F+PPDG  +L +Y ++ ++N    I  I   +     
Sbjct: 261 FLGSSKFHQCVSLESLSSQDYIEFIPPDGDFQLCEYKLKRHINDSPIIKLIDYKINERQK 320

Query: 348 GDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVS--------NGTCKFVPAEN 399
              L   + ++  F  + SA  + +HIP      +  I ++        +G+  F  ++ 
Sbjct: 321 KHRLHLSVTIQPHFKAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHGSVFFNLSDE 380

Query: 400 AMVWKFNKYNGLTENTLSAVTVP----SKEVNQTTLQQWAR----PPM------------ 439
            ++W      G    T  ++ V      +E +   L+Q  +    PP+            
Sbjct: 381 LLLWDAQGIKGGHGETSYSMHVEFALFDEEEHARKLEQIKKSMDPPPLREGAHLEELYAQ 440

Query: 440 ----------------SLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKY 475
                           + +FE+  +++SGL V Y  ISE +  Y++  W++Y
Sbjct: 441 VKSNKEGKGQFQSNAITAEFEVPYYTSSGLRVEYLKISEENLKYQSFSWVRY 492

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 80/342 (23%), Positives = 135/342 (39%), Gaps = 94/342 (27%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVAKDGSILKA-YVDGSIDLQTRLSGTPVCQFGLNDS 248
           WR K I++ KNE  L V EK+   +    +I+K   + G I  ++ LSG P  +  LN  
Sbjct: 225 WRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSLNKI 284

Query: 249 LTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKFDR 308
           +        Y  +                              L  CKFHQCV  D  D 
Sbjct: 285 I--------YQDKQ----------------------------FLSSCKFHQCVMPDSVDE 308

Query: 309 ERIIKFVPPDGSVELMKYHIRNNLN-LPFKITPIVTNSVTGDALDYRIAL----KSLFPG 363
            ++++FVPPDG   L KY ++ ++N LP  +  +++  V      Y++ L    +S F  
Sbjct: 309 GKVLEFVPPDGDFVLCKYELKRHVNDLP--LLKLISYEVKPKLDKYKLKLFVTIESTFKK 366

Query: 364 RLSAKGVVLHIPVPPGVMDCNISVS--------NGTCKFVPAENAMVWK----------- 404
             S   + + IP+   +   +I +S         G   F  +++ ++W+           
Sbjct: 367 TNSTTKLNIKIPLKVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKGGNSQL 426

Query: 405 --------FN--KYNGLTENTLSAVTVPS-----------KEVNQTTLQQWARPPMS--- 440
                   FN  +Y    E   +++  P            K++++     + R   S   
Sbjct: 427 KMGADFALFNEEEYLRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTRKGESSDE 486

Query: 441 -------LDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKY 475
                  +DFEI   ++SGL V Y  I E +  Y+A  W++Y
Sbjct: 487 TKGNLIKMDFEIPYNTSSGLKVEYLKIEEPNLQYQAFPWVRY 528

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score = 75.9 bits (185), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 75/336 (22%), Positives = 129/336 (38%), Gaps = 88/336 (26%)

Query: 190 WRPKDIKHKKNEVILHVNE-KINILVAKDGSILKAYVDGSIDLQTRLSGTPVCQFGLNDS 248
           WRPK I + KNE+ + V E +  ++  K   + K ++ G I  ++ LSG PV +  +N  
Sbjct: 196 WRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFIFGRIICRSYLSGMPVVKICINKM 255

Query: 249 LTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKFDR 308
           L                  ++   L S                    KFHQCVSL+    
Sbjct: 256 L-----------------KDRDQFLSS-------------------AKFHQCVSLESLSS 279

Query: 309 ERIIKFVPPDGSVELMKYHIRNNLNLPFKITPI---VTNSVTGDALDYRIALKSLFPGRL 365
           +  I+F+PPDG  +L +Y I+ +++    I  I   V        L   + ++  F  + 
Sbjct: 280 QDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLIEYKVVEKPKKHKLQISMKIQPHFKAQN 339

Query: 366 SAKGVVLHIPVPPGVMDCNISVSN--------GTCKFVPAENAMVWKFNKYNGLTENTLS 417
           SA  + + +P+        I ++         G+  F  ++  ++WK N   G    T  
Sbjct: 340 SATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSILFNLSDGYLLWKANGMKGGHGETYH 399

Query: 418 AVTVP---------SKEVNQTTLQQWARPP-----------------------------M 439
           ++ V           KE  +  L+    PP                             +
Sbjct: 400 SMQVEFFLFDAEAHRKEAEE--LKNSMDPPPLREGVRMEELYALAHEEKGQINNPVRNMI 457

Query: 440 SLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKY 475
           + +FE+  F++SGL V Y  I E    Y++  W++Y
Sbjct: 458 TAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVRY 493

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 110/495 (22%), Positives = 194/495 (39%), Gaps = 115/495 (23%)

Query: 45  PILTLGSTTFHHIRSSKDSDNLWLVAAT---------RNNANSAAIWEFLYKLDSMLIEY 95
           P+       F +IR     D  + ++A          +++ N  AI  +L    ++L  Y
Sbjct: 44  PVFHYKGIHFVYIRR----DGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRY 99

Query: 96  ----GLNKEEYLKEEFMIVHELLDVMLGSCGIPLETEPSKVIAKMSVKPAKLHHN--NTS 149
                LN+   + + F +++ELLD  L   G+P  T+ + +   + V+   LH    ++S
Sbjct: 100 FNSQKLNRW-LIVDNFHLIYELLDESL-DFGVPQLTDYNIIQDYIKVQ-VNLHDELADSS 156

Query: 150 SLLDGHLGSKG--NNEISMPKFLKRXXXXXXXXXXXXXXXXXWRPKDIKHKKNEVILHVN 207
             +       G  ++E  M  F+ R                 WRPK I + KNE  L V 
Sbjct: 157 KKISKKEDLHGFEDDESYMNSFIARTTTSAIS----------WRPKGIHYTKNEFFLDVI 206

Query: 208 EKINILVAKDGS-ILKAYVDGSIDLQTRLSGTPVCQFGLNDSLTLGSNDSEYSSRNGRTG 266
           E+I   +  + S I K +V G I  ++ LSG P  + GL                     
Sbjct: 207 EEIEYCMDFNKSKIRKNFVHGRIRCRSYLSGMPKLKIGL--------------------- 245

Query: 267 NNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKY 326
               S + S+L  +           + + KFHQCVSL+   +  I+ F+PPDG  +L +Y
Sbjct: 246 ----SKITSSLPKE-------REQFMNNAKFHQCVSLEDLQK-NIVSFIPPDGEFQLCEY 293

Query: 327 HIRNNLNLPFKITPIVTNSVTGDALDYRIALKSL-----FPGRLSAKGVVLHIPVPPGVM 381
            ++ ++  P  +  +V   V  +       L SL     F  + S   + + IP+     
Sbjct: 294 KLKRHVRDP-PVIKLVKFDVKKEEKKRPKILISLTITTDFKSQNSTSVLNIRIPLTKIFS 352

Query: 382 DCNISVS--------NGTCKFVPAENAMVWKFNKYNG---LTENTL-SAVTVPSKEVNQT 429
           +  I ++         G   F   ++ ++W+     G    TE+++     +  +E  + 
Sbjct: 353 EYQIDLAKPPRFKCDQGNVLFNLTDDLLLWEVGSIKGGHAQTEHSMYCEFRLYDEEEYKK 412

Query: 430 TLQQWAR----PPM-------------------------SLDFEILMFSNSGLVVRYFTI 460
            L++       PP+                         S++FEI  ++ SGL V+Y  I
Sbjct: 413 QLEELKNSMDPPPLRQGPKLEELYKQVHENENTNRSRLVSMEFEIPYYTCSGLKVQYLKI 472

Query: 461 SEGHQNYKAVKWIKY 475
            E    Y +  W++Y
Sbjct: 473 EEDQLQYHSFPWVRY 487

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 79/341 (23%), Positives = 130/341 (38%), Gaps = 95/341 (27%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVAKDGSILKA-YVDGSIDLQTRLSGTPVCQFGLNDS 248
           WRPK I + KNE  L V E +  LV      +K+  V G I  ++ LSG P+   GLN  
Sbjct: 189 WRPKGIHYNKNEFYLDVIEHLEYLVDFQCMNIKSNTVYGYIQCRSYLSGMPMLTIGLNKL 248

Query: 249 LTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKFDR 308
               ++++EY  R                                   FHQCV+LD+   
Sbjct: 249 ----NSENEYFMRRA--------------------------------NFHQCVNLDQLTT 272

Query: 309 ERIIKFVPPDGSVELMKYHIRNNLNLP---------FKITPIVTNSVTGDALDYRI---A 356
           +++I F PPDG  +L  Y +  N++ P          K+ P      T D LD  I    
Sbjct: 273 DKLISFTPPDGEFQLCNYKLTRNMSDPPMIKLEDCKVKLKP----RKTKDGLDRLILAVT 328

Query: 357 LKSLFPGRLSAKGVVLHIPVPPGVMDCNISVS--------NGTCKFVPAENAMVWKFNKY 408
           + + F  + S   + + +P+     D ++ +S         G   F   ++ ++W+  K 
Sbjct: 329 ISTYFKLQDSTSLLNIKVPLSKVFRDWDVDLSYQPRFKCEQGKVMFNITDDYLLWEVGKV 388

Query: 409 NG----LTENTLSAVTVPSKEVNQTTLQQWA---------RPP----------------- 438
            G     T    S   + ++E      QQ +         R P                 
Sbjct: 389 KGGHGDKTLKMQSEFHLHNREHEARIKQQLSNSMDPKPIRRGPHLEKLYQQTHELNSPTS 448

Query: 439 ----MSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKY 475
               + ++FEI  ++ SGL V +  I E    +++  W++Y
Sbjct: 449 EAALLKVEFEIPYYTISGLKVEFLKIEEKQLQFQSFPWVRY 489

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 77/337 (22%), Positives = 129/337 (38%), Gaps = 88/337 (26%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVA-KDGSILKAYVDGSIDLQTRLSGTPVCQFGLNDS 248
           WR K I + KNE  L V EK+  L   K+  + K  + G I  ++ LSG P  +  LN  
Sbjct: 238 WRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKIALNKL 297

Query: 249 LTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKFDR 308
           L     D+++ S +                                 KFHQCV+L+  + 
Sbjct: 298 L---QRDAQFMSHS---------------------------------KFHQCVALETLN- 320

Query: 309 ERIIKFVPPDGSVELMKYHIRNNLN-LP-FKITPI-VTNSVTGDALDYRIALKSLFPGRL 365
           E+ ++F+PPDG   L +Y ++ ++N  P  KIT   +   +    L   + +++ F  R 
Sbjct: 321 EKELEFIPPDGEFILCEYELKRHVNDTPILKITSFEIKPQLKKFKLRILLTIETHFKTRN 380

Query: 366 SAKGVVLHIPVPPGVMDCNISVSN--------GTCKFVPAENAMVWKFNKYNGLTENTLS 417
           S   + + IP+     D NI +S         G   F  +++ ++W+  +  G    T  
Sbjct: 381 STSILNVKIPLAKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQF 440

Query: 418 AVTVPSKEVNQ-------TTLQQWARPP-------------------------------- 438
           ++       N+          +    PP                                
Sbjct: 441 SMVAEFSLFNKEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQSQL 500

Query: 439 MSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKY 475
           + +DFEI   + SGL V Y  I E    Y++  W++Y
Sbjct: 501 VGMDFEIPYTTCSGLKVEYLKIEEEQLQYQSFPWVRY 537

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 77/348 (22%), Positives = 133/348 (38%), Gaps = 98/348 (28%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVA-KDGSILKAYVDGSIDLQTRLSGTPVCQFGLNDS 248
           WR K I + KNE  L V EK+  L+    G I K  + G I  +  LSG P  +  LN  
Sbjct: 218 WRTKGIYYAKNEFFLDVIEKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALN-- 275

Query: 249 LTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKFDR 308
             L  ND ++ S                                 + KFHQCVS++   R
Sbjct: 276 -KLIKNDEQFIS---------------------------------NSKFHQCVSINSLKR 301

Query: 309 E------------RIIKFVPPDGSVELMKYHIRNNL-NLP-FKITPI-VTNSVTGDALDY 353
           E            + I+F+PPDG   L KY ++ ++ ++P  K++ I +   +    +  
Sbjct: 302 EINNEEEENTYHGKEIEFIPPDGEFVLCKYELKRHVRDVPVIKLSNIEIKPKLKKYKIQI 361

Query: 354 RIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSN--------GTCKFVPAENAMVWKF 405
            + +++ F  + S   + + IP+        I ++         G   F  +++ ++W+ 
Sbjct: 362 HVTIETHFKKQNSTSVLTIKIPLRMVFSQYKIDLTKQPRFKSDFGEVLFNISDDFLIWEV 421

Query: 406 NKY---NGLTENTLSAVTVPSKEVNQTTLQQWAR----PP-------------------- 438
                 NG ++N + A      +     LQ+  +    PP                    
Sbjct: 422 GSMKGGNGESKNNMVAEFFIFNQEEYDRLQEEMKTSMNPPPLREGPKLEEIYEQTHDNRD 481

Query: 439 -----------MSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKY 475
                      +++ FE+   + SGL V Y  I E   NY++  W++Y
Sbjct: 482 EHDKNGISQQLLTMKFEVPYSTCSGLKVEYLKIEENQVNYQSFPWVRY 529

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 75/348 (21%), Positives = 125/348 (35%), Gaps = 106/348 (30%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVAKDGSILKA-YVDGSIDLQTRLSGTPVCQFGLNDS 248
           WRP+ I + KNE  L V E++  L+  + + ++   V G+I+ ++ LSG P    GLN  
Sbjct: 187 WRPRGIYYSKNEFFLDVVEELEYLMDFERAQVRLNQVHGAINCRSYLSGMPQLTVGLN-- 244

Query: 249 LTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKFDR 308
             + + D +++S+                                   FHQCV L++   
Sbjct: 245 -KMVAQDRDFTSQ---------------------------------VHFHQCVDLERLAT 270

Query: 309 ERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVT------------NSVTGDALDYRIA 356
           +R I FVPPDG  +L  Y +    N      P++                  D L   ++
Sbjct: 271 DRHITFVPPDGEFQLCHYKLARGAN----EQPLIKLEECRAAVKPRRRPADADRLVLTVS 326

Query: 357 LKSLFPGRLSAKGVVLHIPVP--------------PGVMDCNISVSNGTCKFVPAENAMV 402
           + + F  +L     VL + VP              P    C+     G   F   ++ ++
Sbjct: 327 ISTNF--KLQDATSVLKVRVPLARVFEQWKVDLSFPPRFKCDA----GCVMFNITDDYLL 380

Query: 403 WKFNKYNG---------------------------LTENTLSAVTVPSKEVNQTTLQQWA 435
           W   K  G                           L+ +       P +++     Q  A
Sbjct: 381 WDIGKAKGSHGDRRFTMQSQFHLYDEAYYSRRRAQLSTSMDPLPAHPGQQLEALYNQTHA 440

Query: 436 RPP------MSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKYVS 477
             P      + +DFE+   + SGL V +  I E    Y++  WI+Y S
Sbjct: 441 SAPTHASALLRVDFEVPYHTISGLKVEFLKILEPQLQYQSFPWIRYKS 488

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 77/358 (21%), Positives = 130/358 (36%), Gaps = 109/358 (30%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILV-AKDGSILKAYVDGSIDLQTRLSGTPVCQFGLNDS 248
           WR K I + KNE  L V E +  L+  KD  I +  + G I  ++ LSG P  +  LN  
Sbjct: 227 WRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRIALNKI 286

Query: 249 LTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDK--- 305
           L    +D ++                                 L   KFHQCVSL+    
Sbjct: 287 L---QDDKQF---------------------------------LGHAKFHQCVSLNSINI 310

Query: 306 -----------------FDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTG 348
                            F  ++ I+F+PPDG   L +Y +R ++  P  +  + +  +  
Sbjct: 311 KDLEKDLEGPNDISNKNFVNKKEIEFIPPDGEFVLCQYELRRHVKDP-PVINMTSFDIKP 369

Query: 349 DALDYRIA----LKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSN--------GTCKFVP 396
           +   +R+     +++ F  + S   + + IP+     D  I +S         G   F  
Sbjct: 370 NFKKFRVQISLKIETHFKRQNSTSLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNI 429

Query: 397 AENAMVWKFNKY---NGLTENTLSAVTVPSKEVNQTTLQQWAR-----PPMS-------- 440
           +E+ ++W+ +     +G  E  + A      +     LQ+ A+     PP+         
Sbjct: 430 SEDFLIWEIDALKGGHGENEKGMVAEFFLFNQEEYDRLQEEAKISMNPPPLRNGPKLEEL 489

Query: 441 -----------------------LDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKY 475
                                  + FEI   + SGL V Y  I E    Y++  W++Y
Sbjct: 490 YEEMHENEDAEDTALKMKTQYVFMQFEIPYSTCSGLKVEYLKIEEDLLKYQSFPWVRY 547

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 72/335 (21%), Positives = 125/335 (37%), Gaps = 88/335 (26%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVAKDGSILKA-YVDGSIDLQTRLSGTPVCQFGLNDS 248
           WR K I + +NE  L V E++  L+  +  I+K   + G I  ++ LSG P  +   N  
Sbjct: 218 WRAKGIHYARNEFFLDVVEQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFN-- 275

Query: 249 LTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKFDR 308
             L   D ++ S +                                 KFHQCV+      
Sbjct: 276 -KLSQKDEQFISHS---------------------------------KFHQCVTWPS-SN 300

Query: 309 ERIIKFVPPDGSVELMKYHIRNNL-NLPFKITPIVTNSVTGDALDYRIAL----KSLFPG 363
           E+ I+F+PPDG   L +Y ++ ++ + P  +  +V+  V      Y+I +    ++ F  
Sbjct: 301 EKEIEFIPPDGDFVLCQYELKRHVKDQP--MLKLVSFGVKPKLKKYKIQMSCTIETHFKA 358

Query: 364 RLSAKGVVLHIPVPPGVMDCNISV--------SNGTCKFVPAENAMVWKFNKYNGLTENT 415
           R S   + L IP+     +  I +         +G   F  +++ ++W      G   +T
Sbjct: 359 RNSTSTLNLKIPLARLFQEYQIDLKKPARFKSDSGKVLFNISDDFLLWDIEVMKGGHGDT 418

Query: 416 LSAVTVPSKEVNQ-------TTLQQWARPP----------------------------MS 440
             ++       N+         L+    PP                            +S
Sbjct: 419 QLSMAAEFSLFNKKEFEEEQEELKNSMNPPPLRDGPKLEELYDQVHNEKGPSKMASRLLS 478

Query: 441 LDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKY 475
           + FEI   + SGL V Y  I E    Y++  W++Y
Sbjct: 479 MKFEIPYSTCSGLQVEYLKIDEEQLQYQSFPWVRY 513

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 73/324 (22%), Positives = 121/324 (37%), Gaps = 93/324 (28%)

Query: 130 SKVIAKMSVKPAKLHHNNTSSLLDGHLGS--KGNNEISMPKFLKRXXXXXXXXXXXXXXX 187
            KV+    ++    +  +T +  D  LG+  +GNN+I M  ++ +               
Sbjct: 245 DKVLDGTRLRIGGGNRQDTDTDTDIELGTLGEGNNDIYMNSYIAKTTIMPIS-------- 296

Query: 188 XXWRPKDIKHKKNEVILHVNEKINILVA-KDGSILKAYVDGSIDLQTRLSGTPVCQFGLN 246
             WR K I + KNE  L V EK+   +  + G I K  + G I  +  LSG P  +  +N
Sbjct: 297 --WRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN 354

Query: 247 DSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKF 306
             L    NDS++                                 L +  FHQCVSLD  
Sbjct: 355 KIL---QNDSQF---------------------------------LSNAHFHQCVSLDSL 378

Query: 307 -------------------------DRERIIKFVPPDGSVELMKYHIRNNL-NLP----- 335
                                    DR++ I+F+PPDG   L KY ++ ++ +LP     
Sbjct: 379 HLQSAEDDDGDDNANVNENENHDERDRKKEIEFIPPDGDFLLCKYELKRHVKDLPVIKLK 438

Query: 336 -FKITPIVTNSVTGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVS------ 388
            F I P ++       L   + +++ F    +   + L IP+     +  I +S      
Sbjct: 439 LFDIKPKLSKY----KLKIHVIIETHFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFK 494

Query: 389 --NGTCKFVPAENAMVWKFNKYNG 410
              G   F  ++N ++W+     G
Sbjct: 495 CDQGKVLFNLSDNFLIWEIGSMKG 518

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 2/68 (2%)

Query: 410 GLTENTLSAVTVPSKEVNQTTLQQWARPP--MSLDFEILMFSNSGLVVRYFTISEGHQNY 467
           G  E T +      +E     L++  R P  + +DFEI  ++ SGL + Y  I E    Y
Sbjct: 593 GSQEATGTHARKTKEERKDKDLRKRTRSPNLLKIDFEIPYYTCSGLKIEYLKIEEPQLQY 652

Query: 468 KAVKWIKY 475
           ++  W++Y
Sbjct: 653 QSFPWVRY 660

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 81/366 (22%), Positives = 131/366 (35%), Gaps = 121/366 (33%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVA-KDGSILKAYVDGSIDLQTRLSGTPVCQFGLNDS 248
           WR K I + KNE  L V EK+   +  K G I K  + G I  ++ LSG P  +  +N  
Sbjct: 252 WRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISINKI 311

Query: 249 LTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKFDR 308
           L     D ++                                 L + KFHQCVSLD   R
Sbjct: 312 L---KQDVQF---------------------------------LSNVKFHQCVSLDSI-R 334

Query: 309 ERI------------------------IKFVPPDGSVELMKYHIRNNL-NLP------FK 337
            R                         I+F+PPDG   L KY ++ ++ + P      F+
Sbjct: 335 ARSNPPAVEEDGKKKNEEADTLGNKGEIEFIPPDGEFLLCKYELKRHVKDQPMIKLRNFE 394

Query: 338 ITPIVTNSVTGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVS--------N 389
           I P     +    +   + +++ F    S   + L IP+        I +S         
Sbjct: 395 IIP----KLHKFKIKIHVIIETHFKTTNSTSKLNLRIPITNLFQSYRIDLSKQPKFKCEQ 450

Query: 390 GTCKFVPAENAMVWKFNKYN-GLTENTLSAVTV-----------------------PSKE 425
           GT  F  ++  ++W+    N G  ENTLS +                         P +E
Sbjct: 451 GTVLFNLSDKFLLWEVGTMNGGHGENTLSMMAEFALFNEEEYKKMEEERKTSMNPPPLRE 510

Query: 426 ----------------VNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKA 469
                            ++ + ++     +++DFE+   + SGL + Y  I E    Y++
Sbjct: 511 GPKLEELYKKIHEEGDSDEVSTRKKNESLLTMDFEVPYCTCSGLKIEYLKIEEDQLQYQS 570

Query: 470 VKWIKY 475
             W++Y
Sbjct: 571 FPWVRY 576

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 81/372 (21%), Positives = 133/372 (35%), Gaps = 128/372 (34%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVA-KDGSILKAYVDGSIDLQTRLSGTPVCQFGLNDS 248
           WR K I + KNE  L V E++  L+  + G I K  + G I  ++ LSG P  +  +N  
Sbjct: 255 WRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISINKI 314

Query: 249 LTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKFDR 308
           L   + D ++ S +                                  FHQCVSLD  + 
Sbjct: 315 L---NRDPQFMSNSN---------------------------------FHQCVSLDSINT 338

Query: 309 -------------------ERIIKFVPPDGSVELMKYHIRNNL-NLP------FKITPIV 342
                               R I+FVPPDG   L +Y ++ ++ + P      F+I P +
Sbjct: 339 IEKGQEKEQNTGDSQAAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKPKL 398

Query: 343 TNSVTGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVS--------NGTCKF 394
             S     +     +++ F    S   + + IP+     D  I +S        NG   F
Sbjct: 399 KKS----KIQILTKIQTNFKPTNSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVF 454

Query: 395 VPAENAMVWKFNKYNGLTENTLSAVTVPSKEVNQTT------------------LQQWAR 436
             +++ ++W+     G  E   +A   P  + + +T                  LQ+  +
Sbjct: 455 NLSDDFLLWEIQTMKGHRER--NASNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQEEMK 512

Query: 437 -----PPM----------------------------SLDFEILMFSNSGLVVRYFTISEG 463
                PP+                            S+DFEI   + SGL V Y  + E 
Sbjct: 513 TSMNPPPLRTGPKLEELYNQVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKVEEP 572

Query: 464 HQNYKAVKWIKY 475
              Y++  W++Y
Sbjct: 573 QLQYQSFPWVRY 584

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/259 (23%), Positives = 98/259 (37%), Gaps = 78/259 (30%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILV-AKDGSILKAYVDGSIDLQTRLSGTPVCQFGLNDS 248
           WR K I + KNE  L V EK+  LV  + G + ++ + G I  ++ LSG P  +  LN  
Sbjct: 251 WRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN-- 308

Query: 249 LTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKFDR 308
             L  ND ++ S+                                  +FHQCVSLD  ++
Sbjct: 309 -KLLQNDKQFISQ---------------------------------VQFHQCVSLDSIEK 334

Query: 309 ----------------------ERIIKFVPPDGSVELMKYHIRNNLNLP-------FKIT 339
                                 E  I+F+PPDG   L  Y ++ ++  P       F+IT
Sbjct: 335 VIKYAEEHSDELKTLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFEIT 394

Query: 340 PIVTNSVTGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISV--------SNGT 391
           P          L    A+++ F    S   + + IP+     D  I +        SNG 
Sbjct: 395 P----KWKKYKLKISAAVETHFKPTNSTSKLDVKIPISKVFKDYQIDLKKPIKFKTSNGR 450

Query: 392 CKFVPAENAMVWKFNKYNG 410
             +  +++ ++W+     G
Sbjct: 451 VVYNISDDFLLWEIGVIKG 469

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%)

Query: 439 MSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKY 475
           +S+DFEI   + SGL V Y  I E    Y++  W++Y
Sbjct: 550 LSMDFEIPYCTCSGLKVEYLKIDEDQLQYQSFPWVRY 586

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 97/248 (39%), Gaps = 57/248 (22%)

Query: 190 WRPKDIKHKKNEVILHVNEKIN-ILVAKDGSILKAYVDGSIDLQTRLSGTPVCQFGLNDS 248
           WR K I + KNE  L V EK   I+  K+  I K  + G I  +  LSG P  +  LN  
Sbjct: 289 WRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN-- 346

Query: 249 LTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKFDR 308
                                          K+L K       L   +FHQCVSL+   +
Sbjct: 347 -------------------------------KLLQK---DQQFLSQLRFHQCVSLETI-Q 371

Query: 309 ERIIKFVPPDGSVELMKYHIRNNLNLP-------FKITPIVTNSVTGDALDYRIALKSLF 361
            + I+F+PPDG   L +Y ++ ++  P       F+I P     +    +   +++ + F
Sbjct: 372 NKEIEFIPPDGEFILCEYELKRHVKDPPNIKLISFEIKP----KLKKFKIQINLSITTFF 427

Query: 362 PGRLSAKGVVLHIPVPPGVMDCNISVSN--------GTCKFVPAENAMVWKFNKYNGLTE 413
             + S   + L IP+     D  I +          G  KF  +++ ++W+     G   
Sbjct: 428 KVQNSTSILNLKIPLEKLFNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKGGHG 487

Query: 414 NTLSAVTV 421
             + A+T 
Sbjct: 488 ENIKAMTA 495

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 23/37 (62%)

Query: 439 MSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKY 475
           +++DFEI  ++ SGL V Y  I E    Y++  W++Y
Sbjct: 609 LTVDFEIPYYACSGLKVEYLKIEEEQLLYQSFPWVRY 645

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 87/370 (23%), Positives = 139/370 (37%), Gaps = 123/370 (33%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVA-KDGSILKAYVDGSIDLQTRLSGTPVCQFGLNDS 248
           WR K I + KNE  L V E++  L+  + G I K  + G I  +  LSG P  +  +N  
Sbjct: 254 WRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN-- 311

Query: 249 LTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKFD- 307
             L + D ++ S                                 + KFHQCVSLD  + 
Sbjct: 312 -KLLNRDPQFMS---------------------------------NSKFHQCVSLDSINI 337

Query: 308 -----------------RERIIKFVPPDGSVELMKYHIRNNL-NLP------FKITPIV- 342
                              + I+F+PPDG   L +Y ++ ++ + P      F+I P + 
Sbjct: 338 IEEEGRDTDDAGSQTATDTKEIEFIPPDGEFVLCQYELKRHVKDAPMIKLQGFEIKPKLK 397

Query: 343 ----------------TNS---------VTGDALDYRIALKSLFPGRLSAKGVVLHIPV- 376
                           TNS         +T    DY+I L      + +   VV ++   
Sbjct: 398 KFKIQIITKIQTNFKPTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANLGKVVFNLSDD 457

Query: 377 ----PPGVMDCNISVSNGTCKFVPAEN------AMVWKF-----NKYNGLTENTLSAVTV 421
                 G M  +   + GT   VP E+      +MV +F      +Y+ L E   +++  
Sbjct: 458 FLLWEIGTMKGHRERNTGT---VPQEDDASTLASMVAEFPLFNQEEYDRLQEELKTSMNP 514

Query: 422 PS-----------KEVNQT-TLQQWARPP----MSLDFEILMFSNSGLVVRYFTISEGHQ 465
           P            K+V++   L      P    +S+DFEI   + SGL V Y  + E   
Sbjct: 515 PPLRTGPKLEELYKQVHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYLKVEEPQL 574

Query: 466 NYKAVKWIKY 475
            Y++  W++Y
Sbjct: 575 QYQSFPWVRY 584

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 76/318 (23%), Positives = 127/318 (39%), Gaps = 71/318 (22%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVAKD---GSI--LKAYVDGSIDLQTRLSGTPVCQFG 244
           WR   +K+  NE+ + V E +++++ K+   G +  ++  +DG +D ++ LSG PV    
Sbjct: 188 WRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDFRSHLSGNPVIALN 247

Query: 245 LNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLD 304
           L                                    L    +G   L     HQC  LD
Sbjct: 248 LR-----------------------------------LRGHDLGMPAL-----HQCC-LD 266

Query: 305 KFD-RERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIALKSL--- 360
            +  R   ++FVPPDG  +LM Y I  +L+     + + +N +   + DYR  L  L   
Sbjct: 267 SYQGRPDQLRFVPPDGKFQLMHYSI--DLDSLQSKSKLFSN-IGLVSPDYRTELGDLGDE 323

Query: 361 ------FPGRLSAKGV---VLHIPVPPGVMDCNISV---SNGTCKFVPAENAMVWKFNKY 408
                   G   AK V   V+ +   P   +C I V   ++G  +   + N   W F+K 
Sbjct: 324 FEVNLNIAGSQHAKVVDDLVITLSFGPLPSECKIKVLRSTHGHFENCASNNIGKWVFDK- 382

Query: 409 NGLTENTLSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEG-HQNY 467
               E     + V    +   T +Q     +S+ +       SG+ V    I  G  +N 
Sbjct: 383 ----ETPTGTLPVLRGCLENATREQVRALQLSVSYTNRGELPSGIKVDSVDILSGLSKNI 438

Query: 468 KAVKWIKYVSKSGSYEVR 485
           K  K +KY++K+G + +R
Sbjct: 439 KPFKGVKYIAKTGDFHLR 456

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 63/146 (43%), Gaps = 39/146 (26%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVAKDGSILKA-YVDGSIDLQTRLSGTPVCQFGLNDS 248
           WR K I + KNE  L+V EK+   +    +++K   + G I  +  LSG P  +  +N  
Sbjct: 255 WRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSIN-- 312

Query: 249 LTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKFDR 308
             + + D ++                                 L +CKFHQCVSL   + 
Sbjct: 313 -KIVNEDKQF---------------------------------LANCKFHQCVSLASLES 338

Query: 309 --ERIIKFVPPDGSVELMKYHIRNNL 332
              + ++FVPPDG   L +Y ++ ++
Sbjct: 339 SDHKDVEFVPPDGEFTLCRYELKRHV 364

 Score = 37.4 bits (85), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 26/43 (60%)

Query: 439 MSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKYVSKSGS 481
           +++DFE+   ++SGL V Y  I E    Y++  W++Y + S +
Sbjct: 533 LTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFPWVRYTTLSDA 575

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 86/372 (23%), Positives = 136/372 (36%), Gaps = 116/372 (31%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVA-KDGSILKAYVDGSIDLQTRLSGTPVCQFGLNDS 248
           WR K I + KNE  L V E++  L+  + G I K  + G I  +  LSG P  +  +N  
Sbjct: 262 WRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISINKI 321

Query: 249 LTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKF-- 306
           L                  N+ +   SN S                  FHQCVSLD    
Sbjct: 322 L------------------NRDAQFLSNSS------------------FHQCVSLDSIKT 345

Query: 307 --DRE---------------RIIKFVPPDGSVELMKYHIRNNL-NLP------FKITPIV 342
              RE               + ++FVPPDG   L +Y ++ ++ + P      F+I P +
Sbjct: 346 IEKREEKEDDDTGLQAAADAKELEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKPKL 405

Query: 343 -----------------TNS---------VTGDALDYRIALKSLFPGR---------LSA 367
                            TNS         +T    +YRI L      +         LS 
Sbjct: 406 KKFKIQIETKIQTNFKPTNSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSD 465

Query: 368 KGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKF-----NKYNGLTENTLSAVTVP 422
             ++  I    G  + N + ++       A  +MV +F      +Y+ L E   +++  P
Sbjct: 466 DFLLWEIQAMKGHREHNTNKTSQDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPP 525

Query: 423 --------SKEVNQTTLQQWARPP-----MSLDFEILMFSNSGLVVRYFTISEGHQNYKA 469
                    +   Q   QQ A        +++DFEI   + SGL + Y  + E    Y++
Sbjct: 526 PLRTGPRLEELYRQVHDQQIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQS 585

Query: 470 VKWIKYVSKSGS 481
             W++Y + S  
Sbjct: 586 FPWVRYKTTSDD 597

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 89/377 (23%), Positives = 137/377 (36%), Gaps = 122/377 (32%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVA-KDGSILKAYVDGSIDLQTRLSGTPVCQFGLNDS 248
           WR K I + KNE  L V E++  L+  + G I K  + G I  +  LSG P  +  +N  
Sbjct: 260 WRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISINKI 319

Query: 249 LTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKF-- 306
           L                  N+     SN S                  FHQCVSLD    
Sbjct: 320 L------------------NRDPQFMSNSS------------------FHQCVSLDSINT 343

Query: 307 ---DRE---------------RIIKFVPPDGSVELMKYHIRNNL-NLP------FKITP- 340
              D E               R I+F+PPDG   L +Y ++ ++ + P      F+I P 
Sbjct: 344 IEKDEEKNSDDDAGLQAATDAREIEFIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKPK 403

Query: 341 -------IVTNSVTG-------DALDYRIALKSLFPG--------------------RLS 366
                  IVT   T          L+ RI L  +F                       LS
Sbjct: 404 LKKFKIQIVTKIQTNFKPTNSTSKLNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLS 463

Query: 367 AKGVVLHIPVPPGVMDCNISVSN---------GTCKFVPAENAMVWKFNKYNGLTENTLS 417
              ++  I    G  + + + S+          TC  + AE  + +   +Y+ L E   +
Sbjct: 464 DDFLLWEIQTMKGHREHSTNKSSQYNSDEDDPNTCASMVAEFPL-FNQEEYDRLQEEMKT 522

Query: 418 AVTVPS-----------KEV-NQTTLQQWARPPM-SLDFEILMFSNSGLVVRYFTISEGH 464
           ++  P            ++V +Q T     R  + ++DFEI   + SGL V Y  + E  
Sbjct: 523 SMNPPPLRTGPRLEELYRQVHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVEYLKVEEPQ 582

Query: 465 QNYKAVKWIKYVSKSGS 481
             Y++  W++Y + S  
Sbjct: 583 LQYQSFPWVRYKTVSDE 599

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 61/149 (40%), Gaps = 52/149 (34%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVAKDG------SILKAYVDGSIDLQTRLSGTPVCQF 243
           WR K+IK  +NE+ + V E + + + K         +L  Y++GS+ + + + G P+ + 
Sbjct: 175 WRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSIGGVPMLE- 233

Query: 244 GLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDC--KFHQCV 301
                                                     S G    +D   KFH CV
Sbjct: 234 -----------------------------------------VSFGGCDFKDIIPKFHDCV 252

Query: 302 SLDKF--DRERIIKFVPPDGSVELMKYHI 328
            +++F  +   IIKF+PPDG  +LM+Y +
Sbjct: 253 EVNEFLTNDGNIIKFIPPDGKFQLMEYSM 281

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 59/145 (40%), Gaps = 47/145 (32%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGTPVCQFGLNDSL 249
           WR   I +  NE+ + ++E+IN +V K G +L  ++ G IDL   LSG P+ +  L    
Sbjct: 212 WRMSGINYANNEIFIDMSEEINAIVEK-GKLLTGHIKGCIDLNNHLSGQPLVEMKL---- 266

Query: 250 TLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKFD-- 307
                                 +LD  LS+              +  FH+C+  DK +  
Sbjct: 267 ---------------------GLLDHKLSHL-------------NTTFHRCILEDKANSI 292

Query: 308 ------RERIIKFVPPDGSVELMKY 326
                 +   + FVPPDG   L +Y
Sbjct: 293 NDLIAGKFTKLTFVPPDGRTRLCQY 317

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 71/317 (22%), Positives = 121/317 (38%), Gaps = 69/317 (21%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILV---AKDGSIL--KAYVDGSIDLQTRLSGTPVCQFG 244
           WR   +K+  NE+ + V E I++++    K G ++  +  +DG +D ++ L+G PV    
Sbjct: 188 WRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVALK 247

Query: 245 LNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLD 304
           LN    L  +D                                    L     H C    
Sbjct: 248 LN----LHGHD------------------------------------LGVPALHPCCQAQ 267

Query: 305 KFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIALKSL---F 361
                  ++FVPPDG   LM+Y I  +L      + + +N +   +LDY + L  L   F
Sbjct: 268 YTGSPENLQFVPPDGKFRLMQYTI--DLEALQTKSKLFSN-MGLVSLDYFVGLGDLRDEF 324

Query: 362 PGRLSAKG---------VVLHIPVPPGVMDCNISV---SNGTCKFVPAENAMVWKFNKYN 409
             +++  G         +V+ I       DC I     ++G  +     N   W F+K  
Sbjct: 325 EIKVNIAGSQHVKLIDDLVVTIKFGKLTSDCRIKALRSTHGHFENGFENNIGKWSFDK-- 382

Query: 410 GLTENTLSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEG-HQNYK 468
              E     V V    +   T +Q     +++ +       SG+ V    I  G  +N K
Sbjct: 383 ---ETPTGTVPVFRGCLENATPEQIKTLSLAISYSNKGSLPSGIKVGAVDIISGLPKNTK 439

Query: 469 AVKWIKYVSKSGSYEVR 485
             K +KYV+++G + +R
Sbjct: 440 PFKGVKYVARTGQFNLR 456

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 76/330 (23%), Positives = 120/330 (36%), Gaps = 95/330 (28%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVAKDGS---ILKAYVDGSIDLQTRLSGTPVCQFGLN 246
           WR  D ++  NE+ + + E +N  + + GS   ++   + G ID++  LSG P  Q  L 
Sbjct: 142 WRTADCRYVNNEIYVDLVETVNATLRQKGSSLTLINGSLSGKIDVKCYLSGNPTVQLKL- 200

Query: 247 DSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLDKF 306
                            RT  +                       L++   H+CV L + 
Sbjct: 201 -----------------RTSGHP----------------------LDNSALHRCVELGEA 221

Query: 307 DRERIIKFVPPDGSVELMKYHIR-----------NNLNL--------------PFKITPI 341
                + FVPPDG   L +Y I             NL L               F+I  I
Sbjct: 222 GVA-TMNFVPPDGRFTLAEYAIDLSAISQAARRLTNLGLVTVSLASGLGQHRDEFEIKVI 280

Query: 342 VTNSVTGDAL-DYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENA 400
           + NS    A+ D RI +   FP  +S    +  +    G  + ++S   G          
Sbjct: 281 IGNSTQVAAIEDLRITV--YFPD-ISDAAKIKILRTTHGGWESDLSRVRG---------- 327

Query: 401 MVWKFNKYNGLTENTLSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSN-----SGLVV 455
            VW F+K     +  + +V V    V        A PP+      + +S+     SG+ V
Sbjct: 328 -VWAFDK-----QTAVGSVPVLRGCVENPESTPHA-PPVFPSHLAVSYSHVGQLPSGIRV 380

Query: 456 RYFTISEGHQNYKAVKWIKYVSKSGSYEVR 485
               +S+     K  K +KY S++G Y VR
Sbjct: 381 DTIALSDLPPGSKPFKGVKYTSRAGDYIVR 410

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 76/162 (46%), Gaps = 48/162 (29%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVAKDGS------------------ILKAYVDGSIDL 231
           WR  ++K+  NE+ + V E+I+++  +  S                  +++A + G +++
Sbjct: 258 WRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADIIGELNV 317

Query: 232 QTRLSGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVI 291
           ++ LS  P+ +  L D          YS +  +TG ++         N +  + ++G  +
Sbjct: 318 RSYLSDNPMVEVTLVDR--------NYSDQ--KTGWSE---------NDLFKQLNLGLPM 358

Query: 292 LEDCKFHQCVSLDKFDRE-----RIIKFVPPDGSVELMKYHI 328
                FH CV +D +++      R IKF+PPDG   LMKY+I
Sbjct: 359 -----FHDCVEID-YEKGINQDFRHIKFIPPDGKFSLMKYNI 394

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 61/159 (38%), Gaps = 60/159 (37%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVAKD--------------GSILKAYVDGSIDLQTRL 235
           WR +++KH  NE+ + + E ++++                    I+  Y+ G+  +Q+ L
Sbjct: 203 WRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYVQSFL 262

Query: 236 SGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDC 295
           +G P+ +      L L  ND  + S                                   
Sbjct: 263 NGNPLVEL----QLELSGNDIGHPS----------------------------------- 283

Query: 296 KFHQCVSLDKF----DRERI--IKFVPPDGSVELMKYHI 328
            FH+CV +D++    D   I  +KF+PPDG   LM Y I
Sbjct: 284 -FHECVDIDEYLKNIDNSSISSLKFIPPDGKFTLMDYTI 321

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 56/145 (38%), Gaps = 46/145 (31%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVAKDGSI-----LKAYVDGSIDLQTRLSGTPVCQFG 244
           WR   +K+  NE+ + + E +NI++AK  +      +   +DG +  +  LS  P+ +  
Sbjct: 206 WRSAGVKYTNNELYVDMAETVNIILAKTRNSTSLVPISGSIDGEVGFKCYLSENPLVELD 265

Query: 245 LNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLD 304
           LN               NG                            L    FH+CV  +
Sbjct: 266 LN--------------TNGHD--------------------------LGIPAFHRCVRTE 285

Query: 305 KFD-RERIIKFVPPDGSVELMKYHI 328
             D     ++F+PPDG   LM+Y+I
Sbjct: 286 GSDFHPGTLRFIPPDGDFCLMEYNI 310

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 58/158 (36%), Gaps = 54/158 (34%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVAKDG----------SILKAYVDGSIDLQTRLSGTP 239
           WR   +K+  NE+ + + E I+++  K G           ++   ++G   ++  LSG P
Sbjct: 213 WRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSGNP 272

Query: 240 VCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQ 299
                L+    L  ND                                    L    FH+
Sbjct: 273 TVDLQLD----LAGND------------------------------------LGVPAFHE 292

Query: 300 CVSLDKFDRER--IIKFVPPDGSVELMKYHIRNNLNLP 335
           CV LD         ++F+PPDG   LM+Y I  +L+ P
Sbjct: 293 CVELDNHQNPSNCDLRFIPPDGRFNLMQYSI--DLDTP 328

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 66/155 (42%), Gaps = 48/155 (30%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVAKDG----------SILKAYVDGSIDLQTRLSGTP 239
           WR +++ H  NE+ L + E I++++               I+   + G   +++ L+G P
Sbjct: 204 WRMRNVDHVNNELYLDLVESIHVVLETKKRKSSYANSTMKIVTGNIIGKALVKSVLNGNP 263

Query: 240 VCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQ 299
           + +  ++    +  ND E                               ++ L +C   +
Sbjct: 264 IVEMKID----MAGNDLE-------------------------------SIFLHECVKSK 288

Query: 300 CVSLDK-FDRERIIKFVPPDGSVELMKYHIRNNLN 333
            V  D+ F+  ++IKF+PPDGS +L  Y+I  NLN
Sbjct: 289 DVDKDQEFENTKLIKFLPPDGSFKLFDYNI--NLN 321

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 29/155 (18%), Positives = 65/155 (41%), Gaps = 46/155 (29%)

Query: 190 WRPKDIKHKKNEVILHVNEKINILVA---KDGSI--LKAYVDGSIDLQTRLSGTPVCQFG 244
           WR   +K+  +E+ + + E ++++     ++ S+  +   ++G +++++ LSG P  +  
Sbjct: 194 WRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVE-- 251

Query: 245 LNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCVSLD 304
                                       +D +L+   +   S+          HQCV + 
Sbjct: 252 ----------------------------MDMDLAGNEMYAPSM----------HQCVEMP 273

Query: 305 KFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKIT 339
           +     +  F+PPDG+  L+ Y I  ++N   K+T
Sbjct: 274 QGSPSSLC-FIPPDGNCNLLNYTIDLDMNPKVKVT 307

>KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.44
           YNL207W
          Length = 428

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 8/60 (13%)

Query: 29  ADIFRIQVINNLDVRSPILTLGSTTFHHIRSSKDSDNLWLVAATRNNANSAAIWEFLYKL 88
           +DI+++   N ++    I  LG T+FH +R+++D    +L   ++N AN    W FL KL
Sbjct: 107 SDIYKVSDKNGVEKVMKIHRLGRTSFHTVRNNRD----YLRKNSKNGAN----WMFLSKL 158

>Skud_65.1 Chr65 complement(2..967) [966 bp, 322 aa] {ON}  YPL060C-A
           (REPEAT)
          Length = 322

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 63/135 (46%), Gaps = 30/135 (22%)

Query: 226 DGSI--DLQTRLSGTPVCQFGLNDSLTLGSNDSEYSSRNGRTG-------NNKSS--MLD 274
           DG+I   +Q ++SG  +    L+D      ++S+YSS +  T        NNK+   +++
Sbjct: 193 DGNIASRMQRKISGNEINYKELSD------DESDYSSHHPTTDSVTVTRKNNKTDSVIIE 246

Query: 275 SNLSNKVLSKASVGNVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNL 334
           S     V  + SV +V       H  V L+K   ER +KF  P+  V+L      N++NL
Sbjct: 247 SQQERSV--EPSVESV-------HDTVPLEKGSIERNVKFRSPENEVDLKT----NDMNL 293

Query: 335 PFKITPIVTNSVTGD 349
           P K    V N  T D
Sbjct: 294 PIKTVERVNNYHTDD 308

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 34.3 bits (77), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 59/162 (36%), Gaps = 63/162 (38%)

Query: 190 WR-PKDIKHKKNEVILHVNEKINILVAKDGS-------------------ILKAYVDGSI 229
           WR  K+I + +NE+   V E I ++  K  S                    ++  + GS+
Sbjct: 227 WRNGKNIHNDRNELYADVREVIQVVYQKKYSSKKNDSRRKIFGRRSGHLEYVRGNISGSV 286

Query: 230 DLQTRLSGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGN 289
           D++  L+G P+ +  L                       K   LD  +            
Sbjct: 287 DMRCFLTGNPLVEIAL-----------------------KQGGLDIGIPG---------- 313

Query: 290 VILEDCKFHQCV---SLDKFDRERIIKFVPPDGSVELMKYHI 328
                  FH CV   SL K ++   + F+PPDG   LM+Y+I
Sbjct: 314 -------FHDCVDKTSLLKQEKISKLSFIPPDGRFTLMQYNI 348

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 4/36 (11%)

Query: 297 FHQCVSLDKFDR----ERIIKFVPPDGSVELMKYHI 328
            H CV LD           +KF+PPDG   LM+Y +
Sbjct: 287 LHDCVELDGVPEGPADHTTLKFIPPDGKFRLMEYSV 322

>Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {ON}
           complement(61425..62993) [1569 nt, 523 aa]
          Length = 522

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 48/105 (45%), Gaps = 6/105 (5%)

Query: 6   LIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSSKDSDN 65
           L++SP GE IVS +  G L+    D   + V+N    RSPI+T        +  S D+DN
Sbjct: 226 LVWSPDGEQIVSGVENGELRVWTKDGRLLNVLNFH--RSPIITAKWNKTGTLILSSDADN 283

Query: 66  LWLVAATRNNANSAAIWEFLYKLDSMLIE-YGLNKEEYLKEEFMI 109
              V    N     A+  F  K  S   E  G++ E    E+F+I
Sbjct: 284 ---VTILWNAETGTALHHFELKEQSSSTESLGVDLEWVDNEKFVI 325

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 65/174 (37%), Gaps = 70/174 (40%)

Query: 190 WRPKDIKHKKNEVILHVNEKINI-----LVAKDG-------------------SILKAYV 225
           WR  +IK+ KNE+ + + E I++     +  + G                    ++  Y+
Sbjct: 261 WRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNGYI 320

Query: 226 DGSIDLQTRLSGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKA 285
            G ID+++ L+G P+ +  LN   T G ND    S                         
Sbjct: 321 TGVIDVRSYLNGNPIVEMKLN---TCG-NDMGTPS------------------------- 351

Query: 286 SVGNVILEDCKFHQCVSLD---KFDRERI---IKFVPPDGSVELMKYHIRNNLN 333
                       H CV L+     D +++   +KF+PPDG   L +Y +  N N
Sbjct: 352 -----------LHPCVELEGDMNGDDDKVMDSLKFIPPDGKFCLARYCVDLNKN 394

>Suva_10.319 Chr10 complement(560044..561270) [1227 bp, 408 aa] {ON}
           YLR225C (REAL)
          Length = 408

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 72/182 (39%), Gaps = 34/182 (18%)

Query: 312 IKFVPPDGS-----VELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIALKSLFPGRLS 366
           IK   P GS     ++ +K  +  NL   F I P  +N      LD  I+L+ L     S
Sbjct: 161 IKIDIPKGSASNCPLKDLKVDMVVNLQEGFVINPDGSNYY----LDKSISLEDLAKRGSS 216

Query: 367 A--KGVVLHIPVPPGVMDCNISVS---NGTCKF-----------------VPAENAMVWK 404
           A  K ++ H+ VP G   CN ++S   NG   +                 +P + A  W 
Sbjct: 217 ATSKRMIRHVFVPRGF--CNGTISYKKNGQPVYLSLKDTPMLYLDAVQGLIPNKAASKWN 274

Query: 405 FNKYNGLTENTLSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGH 464
           F  +NG   +T+      +KE   TT+  WA        E+    N    V++ T  E  
Sbjct: 275 FLCFNGKKLSTMCIEFTTTKEYGSTTVTIWAVSDKDKILEVGSSVNDH-AVKFPTTQEDE 333

Query: 465 QN 466
           QN
Sbjct: 334 QN 335

>Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON}
           (49309..50910) [1602 nt, 534 aa]
          Length = 533

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/61 (22%), Positives = 34/61 (55%)

Query: 191 RPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGTPVCQFGLNDSLT 250
            P++IK + N +++ + E IN  +++DG++    + G ++L+         +  L+DS+ 
Sbjct: 268 EPEEIKPENNGILISIKETINAEISRDGAVRSTELKGVMELRINDESLAHSKVTLSDSVN 327

Query: 251 L 251
           +
Sbjct: 328 V 328

>KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa]
           {ON} Anc_2.44 YNL207W
          Length = 425

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 39/88 (44%), Gaps = 17/88 (19%)

Query: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60
           M+N   +YS  G + V K          +DI+R+   N  +    I  LG T+FH +++ 
Sbjct: 88  MLNRETVYSVGGTIGVGKE---------SDIYRVSDRNGTEKVMKIHRLGRTSFHTVKNK 138

Query: 61  KDSDNLWLVAATRNNANSAAIWEFLYKL 88
           +D          + NA +   W +L K+
Sbjct: 139 RD--------YIKKNAKNGVNWMYLSKI 158

>Smik_15.251 Chr15 (425070..426845) [1776 bp, 591 aa] {ON} YOR073W
           (REAL)
          Length = 591

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 194 DIKHKKNEVILHVNEKINILVAKDGSILKAYVDG 227
           D++ KK E+I     K N L+AKD S+LK  V+G
Sbjct: 34  DLESKKAEIIRQSYSKQNSLLAKDNSVLKIKVNG 67

>AGL332W Chr7 (88378..90321) [1944 bp, 647 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YGR276C (RNH70)
          Length = 647

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 4/52 (7%)

Query: 381 MDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENTLSAVTVPSKEVNQTTLQ 432
            DCN+       KFV  +  +V    KY+G+TE  L  VT   ++V Q  L+
Sbjct: 361 FDCNLVYD----KFVKPDEPIVDYLTKYSGITEEKLVGVTTTLQDVQQDLLR 408

>KAFR0B01780 Chr2 (348976..349548) [573 bp, 190 aa] {ON} Anc_8.76
           YPL010W
          Length = 190

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 107 FMIVHELLDVMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKG 160
           ++++ E++D      G+ LET+P+ + ++++ +P     N T  L  G LG+ G
Sbjct: 128 YLLIDEIID-----NGVILETDPASIASRVTKQPTSDTLNQTLDLDKGLLGAWG 176

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,329,778
Number of extensions: 2309906
Number of successful extensions: 8546
Number of sequences better than 10.0: 98
Number of HSP's gapped: 8595
Number of HSP's successfully gapped: 144
Length of query: 486
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 372
Effective length of database: 40,409,475
Effective search space: 15032324700
Effective search space used: 15032324700
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)