Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G028703.159ON99199146190.0
NCAS0C035303.159ON97794336830.0
YDL031W (DBP10)3.159ON99594836080.0
Smik_4.2043.159ON99895235960.0
Suva_4.2183.159ON100787935480.0
Skud_4.2203.159ON100195535390.0
CAGL0K01551g3.159ON96994234850.0
KAFR0C010603.159ON97394534700.0
Kpol_1032.113.159ON97794433820.0
KNAG0K011103.159ON100195433560.0
SAKL0C08778g3.159ON100396733360.0
KLLA0F24684g3.159ON97394533260.0
KLTH0C08866g3.159ON97294333050.0
TPHA0M003303.159ON98194833000.0
Kwal_56.228043.159ON97394332510.0
AEL086W3.159ON96099732340.0
ZYRO0B04972g3.159ON97994431970.0
TDEL0D046303.159ON96894331450.0
TBLA0B015903.159ON92996224020.0
CAGL0D03124g5.208ON7254156004e-65
YLL008W (DRS1)5.208ON7524145971e-64
Smik_12.555.208ON7354145943e-64
ZYRO0B10318g5.208ON7504205882e-63
Kpol_534.535.208ON7524045848e-63
KNAG0H025205.208ON7544165849e-63
KLLA0F15752g5.208ON7484155839e-63
Skud_12.595.208ON7584115803e-62
Suva_10.675.208ON7444065793e-62
SAKL0G12760g5.208ON7374035784e-62
TBLA0C061605.208ON7574145785e-62
KLTH0B03278g5.208ON7394155741e-61
Kwal_33.151655.208ON7314165713e-61
TPHA0N007005.208ON7554155714e-61
AAL164C5.208ON7344055704e-61
Kwal_14.16536.148ON6884075412e-57
NDAI0F020106.148ON8884085455e-57
CAGL0H03377g6.204ON5404045083e-54
CAGL0L03846g2.164ON5444045065e-54
Kpol_534.316.148ON8724105198e-54
TDEL0B040606.148ON8473885171e-53
Suva_7.1926.204ON5184035011e-53
ZYRO0B09856g2.164ON5404085021e-53
TDEL0F011902.164ON5494045022e-53
AFL027C6.148ON8164055142e-53
YGL078C (DBP3)6.204ON5234035002e-53
Smik_7.2056.204ON5224034993e-53
KLTH0H05852g6.148ON8114075133e-53
Skud_7.2046.204ON5164034984e-53
KAFR0B045602.164ON5434044985e-53
Ecym_22696.148ON8773895136e-53
KLTH0D09328g2.164ON5514044988e-53
NDAI0F027402.164ON5614044989e-53
NCAS0G025602.164ON5564044971e-52
ZYRO0G14960g6.148ON8314075054e-52
YBR237W (PRP5)6.148ON8494085038e-52
AFL080W6.204ON5354074899e-52
Skud_2.3696.148ON8484094984e-51
Ecym_54222.164ON5604044845e-51
YHR169W (DBP8)5.69ON4314114712e-50
KAFR0G034806.148ON8524084886e-50
KLLA0A09669g5.40ON4974104718e-50
KLTH0H00638g5.69ON4334114678e-50
TPHA0N011306.148ON8774084843e-49
Ecym_13958.469ON5654024713e-49
CAGL0M13519g5.40ON4944004655e-49
KAFR0B015205.40ON4964084646e-49
NCAS0H012806.148ON8874084809e-49
SAKL0H01430g5.40ON5004084612e-48
CAGL0K07029g6.148ON8163894752e-48
KLLA0A05203g5.69ON4354114562e-48
Kpol_1062.55.69ON4314114544e-48
TPHA0L021605.40ON4984064576e-48
TBLA0C006408.124ON5794974617e-48
Kwal_56.247605.69ON4334124528e-48
Suva_4.4946.148ON8504074701e-47
KNAG0M006606.148ON8843974701e-47
TDEL0G006505.40ON4854074513e-47
KLTH0B08998g5.40ON4924104504e-47
TDEL0G009305.69ON4364174465e-47
AGR333C5.40ON5044074498e-47
Kpol_513.155.40ON5014084489e-47
CAGL0K11198g8.469ON5824064521e-46
Kwal_23.42885.40ON4924204471e-46
NDAI0C036005.40ON5194064481e-46
AER301C5.69ON4354304421e-46
NCAS0F022005.40ON5084074472e-46
TBLA0C067805.40ON4964084426e-46
Skud_7.1008.124ON5584834458e-46
YMR290C (HAS1)5.40ON5054204418e-46
ZYRO0D07546g5.40ON4944164401e-45
Suva_13.4805.40ON5054084392e-45
Smik_13.5065.40ON5054204392e-45
KNAG0D027805.40ON4764074362e-45
Skud_13.4635.40ON5054074382e-45
TDEL0E042105.208ON7402474464e-45
NCAS0A015505.208ON7482444431e-44
Skud_15.2105.643ON4824094311e-44
SAKL0A06204g6.148ON8432454442e-44
KAFR0E011603.249ON4054104242e-44
KAFR0C064205.208ON7392464402e-44
Suva_8.985.643ON4824094283e-44
NCAS0A014005.241ON7624164395e-44
Smik_15.2245.643ON4774094256e-44
YOR046C (DBP5)5.643ON4824094256e-44
KLLA0F10505g6.148ON8122234388e-44
NDAI0C024905.208ON7712484351e-43
KAFR0C060905.643ON4744104222e-43
Kpol_1058.438.87ON6074054264e-43
KLTH0A02244g8.87ON5984104255e-43
TBLA0D035206.148ON8892464328e-43
TDEL0B016708.469ON5794034229e-43
Ecym_83588.124ON5694194173e-42
CAGL0L08976g8.87ON6174154169e-42
Kpol_165.12.164ON4413634061e-41
Kwal_26.84702.164ON4253654041e-41
Skud_6.728.87ON6064194132e-41
Smik_2.3806.148ON8502424193e-41
ZYRO0E02530g8.124ON5564104084e-41
ZYRO0F04312g8.87ON6023974079e-41
TBLA0H032408.402ON7674254121e-40
TPHA0D019905.337ON4982413992e-40
CAGL0F05577g8.402ON6664204036e-40
KAFR0D046305.337ON4872393921e-39
ADL024C8.124ON5694033962e-39
KNAG0B046605.337ON4942223912e-39
TPHA0D009408.124ON5704143952e-39
ZYRO0C14234g5.337ON4942413912e-39
KLTH0H15686g2.384ON4394103873e-39
NDAI0C042505.337ON5042413913e-39
Suva_6.598.87ON6064193963e-39
SAKL0H13574g8.402ON6684173956e-39
ZYRO0C04378g8.402ON6814173956e-39
KLLA0C14608g5.337ON4872223851e-38
Ecym_32175.337ON4862223851e-38
TPHA0G020502.384ON4384103821e-38
SAKL0G09328g5.337ON5052413852e-38
Ecym_60492.384ON4384103812e-38
TPHA0G025852.384ON4384103802e-38
KNAG0A058502.384ON4494123812e-38
NCAS0F027905.337ON5022413842e-38
YGL171W (ROK1)8.124ON5643963872e-38
Kpol_1005.115.337ON5062413842e-38
CAGL0K02387g8.124ON5653953872e-38
AGL112C8.402ON6584033893e-38
YHR065C (RRP3)5.337ON5012413823e-38
NCAS0A039502.384ON4464103784e-38
Smik_8.1365.337ON5012413815e-38
KLTH0F08382g8.402ON6574043876e-38
TDEL0E028905.337ON5012223806e-38
ADR260C2.384ON4384103776e-38
Smik_7.1008.124ON5573963837e-38
CAGL0J10912g5.337ON4932413799e-38
KLLA0E21935g2.384ON4374323759e-38
Skud_8.1225.337ON5032413781e-37
Suva_4.1632.384ON4464103751e-37
TBLA0C035005.337ON5062413781e-37
Suva_7.928.124ON5583973802e-37
Kpol_1058.532.384ON4424233732e-37
Kpol_2001.677.336ON4842083753e-37
YDL084W (SUB2)2.384ON4464103723e-37
NCAS0A140607.336ON5102083763e-37
TDEL0F052608.402ON6554183823e-37
Smik_4.1522.384ON4464103723e-37
Skud_4.1712.384ON4464103723e-37
Suva_15.2545.337ON5032223753e-37
CAGL0L06908g2.384ON4394103714e-37
Kwal_33.143255.337ON5002413735e-37
KNAG0C038207.336ON5132133745e-37
Kpol_1041.332.384ON4414103705e-37
Ecym_46467.336ON4902093727e-37
SAKL0F11088g7.336ON4972083727e-37
KAFR0B009107.336ON5122113728e-37
KLTH0F07106g5.337ON5252413738e-37
TDEL0G031402.384ON4444103689e-37
CAGL0L10021g5.643ON5044083729e-37
ACR197W7.336ON4842093701e-36
KLTH0H08646g8.124ON5664013722e-36
AAL041C5.337ON4872423682e-36
SAKL0E05148g2.384ON4684103672e-36
ZYRO0A08272g2.384ON4434103634e-36
TDEL0C011608.87ON6033973705e-36
TPHA0N009405.241ON7712013746e-36
Ecym_82615.241ON7752093736e-36
Kpol_1060.581.211ON3964123588e-36
NDAI0E017502.384ON4503923618e-36
KAFR0F029402.384ON4434103619e-36
NDAI0A019607.336ON5342083659e-36
TDEL0C021007.336ON4792113621e-35
Smik_4.777.336ON5062113631e-35
Suva_16.1918.614ON6182513671e-35
KLLA0F01034g8.614ON6272513681e-35
TPHA0B029302.164ON4272453581e-35
KAFR0G006501.211ON3953973552e-35
SAKL0H20218g8.124ON5743973652e-35
Smik_6.3188.614ON6132513662e-35
TDEL0F010908.124ON5514013632e-35
KNAG0H015208.614ON6212533662e-35
TPHA0D045207.336ON5022083612e-35
KLLA0C16599g7.336ON5142043612e-35
TBLA0F023607.336ON5852113643e-35
NDAI0B02410singletonON5714023623e-35
SAKL0G01496g5.643ON4803893583e-35
CAGL0I03476g7.336ON5072113584e-35
Suva_4.867.336ON5082113584e-35
Skud_4.967.336ON5072113585e-35
Skud_16.1618.614ON6192513635e-35
YDL160C (DHH1)7.336ON5062113585e-35
Ecym_47755.40ON5002443585e-35
Smik_4.4428.402ON6654153645e-35
ZYRO0F11440g7.336ON5232113586e-35
YDR194C (MSS116)8.402ON6644083637e-35
KNAG0I020502.164ON4232263528e-35
TBLA0C055802.164ON5402453589e-35
YPL119C (DBP1)8.614ON6172513609e-35
Kpol_274.78.124ON5703983581e-34
Skud_14.2192.164ON4352453521e-34
Kwal_27.117348.469ON5712283581e-34
KAFR0E016405.241ON7602013621e-34
ZYRO0G08580g6.204ON5392173561e-34
TPHA0B028508.614ON6282513582e-34
NCAS0B081301.211ON3963973472e-34
KLTH0H01562g7.336ON4912063523e-34
NCAS0E039205.69ON4372533493e-34
KAFR0H028208.614ON6112513563e-34
KLTH0D09746g8.614ON6212513563e-34
SAKL0H08162g8.614ON6242513564e-34
Suva_14.2262.164ON5432453534e-34
Smik_15.3908.614ON6092513554e-34
ADL273C8.614ON6232503554e-34
KLLA0F23716g2.164ON5542453534e-34
SAKL0G11748g5.241ON7632023585e-34
NCAS0B046308.124ON5633983525e-34
NCAS0C017208.614ON6402463555e-34
KLTH0H04466g6.204ON5532163526e-34
KLLA0C17424g8.124ON5794023536e-34
Kwal_56.240056.204ON5332163516e-34
Suva_8.2578.614ON6182513546e-34
Smik_14.2152.164ON5472263517e-34
Skud_15.3708.614ON6092513537e-34
Skud_4.4588.402ON6644073548e-34
YOR204W (DED1)8.614ON6042513528e-34
AFL221C2.164ON5572083509e-34
TDEL0A055908.614ON5972513529e-34
YNL112W (DBP2)2.164ON5462263491e-33
Kwal_56.245887.336ON5132063481e-33
Kpol_1072.508.614ON6502513531e-33
KLLA0C15499g6.204ON5041973471e-33
NCAS0B017308.614ON6182533511e-33
NDAI0B009005.69ON4362533431e-33
NDAI0C023205.241ON7642013542e-33
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G02870
         (991 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G02870 Chr7 (664526..667501) [2976 bp, 991 aa] {ON}             1783   0.0  
NCAS0C03530 Chr3 (703955..706888) [2934 bp, 977 aa] {ON} Anc_3.159   1423   0.0  
YDL031W Chr4 (394217..397204) [2988 bp, 995 aa] {ON}  DBP10Putat...  1394   0.0  
Smik_4.204 Chr4 (374339..377335) [2997 bp, 998 aa] {ON} YDL031W ...  1389   0.0  
Suva_4.218 Chr4 (384623..387646) [3024 bp, 1007 aa] {ON} YDL031W...  1371   0.0  
Skud_4.220 Chr4 (389016..392021) [3006 bp, 1001 aa] {ON} YDL031W...  1367   0.0  
CAGL0K01551g Chr11 (136421..139330) [2910 bp, 969 aa] {ON} highl...  1347   0.0  
KAFR0C01060 Chr3 complement(215822..218743) [2922 bp, 973 aa] {O...  1341   0.0  
Kpol_1032.11 s1032 complement(27093..30026) [2934 bp, 977 aa] {O...  1307   0.0  
KNAG0K01110 Chr11 (215540..218545) [3006 bp, 1001 aa] {ON} Anc_3...  1297   0.0  
SAKL0C08778g Chr3 (804617..807628) [3012 bp, 1003 aa] {ON} simil...  1289   0.0  
KLLA0F24684g Chr6 complement(2294708..2297629) [2922 bp, 973 aa]...  1285   0.0  
KLTH0C08866g Chr3 (742559..745477) [2919 bp, 972 aa] {ON} highly...  1277   0.0  
TPHA0M00330 Chr13 complement(61976..64921) [2946 bp, 981 aa] {ON}    1275   0.0  
Kwal_56.22804 s56 complement(286570..289491) [2922 bp, 973 aa] {...  1256   0.0  
AEL086W Chr5 (464521..467403) [2883 bp, 960 aa] {ON} Syntenic ho...  1250   0.0  
ZYRO0B04972g Chr2 complement(401735..404674) [2940 bp, 979 aa] {...  1236   0.0  
TDEL0D04630 Chr4 complement(849268..852174) [2907 bp, 968 aa] {O...  1216   0.0  
TBLA0B01590 Chr2 (349441..352230) [2790 bp, 929 aa] {ON} Anc_3.1...   929   0.0  
CAGL0D03124g Chr4 complement(321029..323206) [2178 bp, 725 aa] {...   235   4e-65
YLL008W Chr12 (131729..133987) [2259 bp, 752 aa] {ON}  DRS1Nucle...   234   1e-64
Smik_12.55 Chr12 (118743..120950) [2208 bp, 735 aa] {ON} YLL008W...   233   3e-64
ZYRO0B10318g Chr2 complement(808717..810969) [2253 bp, 750 aa] {...   231   2e-63
Kpol_534.53 s534 (137204..139462) [2259 bp, 752 aa] {ON} (137204...   229   8e-63
KNAG0H02520 Chr8 complement(463527..465791) [2265 bp, 754 aa] {O...   229   9e-63
KLLA0F15752g Chr6 (1454735..1456981) [2247 bp, 748 aa] {ON} simi...   229   9e-63
Skud_12.59 Chr12 (122973..125249) [2277 bp, 758 aa] {ON} YLL008W...   228   3e-62
Suva_10.67 Chr10 (136688..138922) [2235 bp, 744 aa] {ON} YLL008W...   227   3e-62
SAKL0G12760g Chr7 complement(1088344..1090557) [2214 bp, 737 aa]...   227   4e-62
TBLA0C06160 Chr3 (1494579..1496852) [2274 bp, 757 aa] {ON} Anc_5...   227   5e-62
KLTH0B03278g Chr2 complement(257395..259614) [2220 bp, 739 aa] {...   225   1e-61
Kwal_33.15165 s33 (987878..990073) [2196 bp, 731 aa] {ON} YLL008...   224   3e-61
TPHA0N00700 Chr14 (157186..159453) [2268 bp, 755 aa] {ON} Anc_5....   224   4e-61
AAL164C Chr1 complement(55223..57427) [2205 bp, 734 aa] {ON} Syn...   224   4e-61
Kwal_14.1653 s14 complement(406891..408957) [2067 bp, 688 aa] {O...   213   2e-57
NDAI0F02010 Chr6 (492540..495206) [2667 bp, 888 aa] {ON} Anc_6.148    214   5e-57
CAGL0H03377g Chr8 complement(313755..315377) [1623 bp, 540 aa] {...   200   3e-54
CAGL0L03846g Chr12 complement(443677..444047,445148..446411) [16...   199   5e-54
Kpol_534.31 s534 complement(73551..76169) [2619 bp, 872 aa] {ON}...   204   8e-54
TDEL0B04060 Chr2 complement(724075..726618) [2544 bp, 847 aa] {O...   203   1e-53
Suva_7.192 Chr7 complement(353138..354694) [1557 bp, 518 aa] {ON...   197   1e-53
ZYRO0B09856g Chr2 complement(769104..769462,770138..771401) [162...   197   1e-53
TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 a...   197   2e-53
AFL027C Chr6 complement(386001..388451) [2451 bp, 816 aa] {ON} S...   202   2e-53
YGL078C Chr7 complement(360288..361859) [1572 bp, 523 aa] {ON}  ...   197   2e-53
Smik_7.205 Chr7 complement(354693..356261) [1569 bp, 522 aa] {ON...   196   3e-53
KLTH0H05852g Chr8 complement(514352..516787) [2436 bp, 811 aa] {...   202   3e-53
Skud_7.204 Chr7 complement(363553..365103) [1551 bp, 516 aa] {ON...   196   4e-53
KAFR0B04560 Chr2 complement(947248..947615,948264..949527) [1632...   196   5e-53
Ecym_2269 Chr2 complement(527849..530482) [2634 bp, 877 aa] {ON}...   202   6e-53
KLTH0D09328g Chr4 complement(773449..773837,774557..775823) [165...   196   8e-53
NDAI0F02740 Chr6 complement(670654..671051,672039..673326) [1686...   196   9e-53
NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 a...   196   1e-52
ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} simi...   199   4e-52
YBR237W Chr2 (691969..694518) [2550 bp, 849 aa] {ON}  PRP5RNA he...   198   8e-52
AFL080W Chr6 (288205..289812) [1608 bp, 535 aa] {ON} Syntenic ho...   192   9e-52
Skud_2.369 Chr2 (660665..663211) [2547 bp, 848 aa] {ON} YBR237W ...   196   4e-51
Ecym_5422 Chr5 complement(868686..869065,869897..871199) [1683 b...   191   5e-51
YHR169W Chr8 (442181..443476) [1296 bp, 431 aa] {ON}  DBP8ATPase...   186   2e-50
KAFR0G03480 Chr7 (718012..720570) [2559 bp, 852 aa] {ON} Anc_6.1...   192   6e-50
KLLA0A09669g Chr1 complement(847036..848529) [1494 bp, 497 aa] {...   186   8e-50
KLTH0H00638g Chr8 complement(64621..65922) [1302 bp, 433 aa] {ON...   184   8e-50
TPHA0N01130 Chr14 complement(237020..239653) [2634 bp, 877 aa] {...   191   3e-49
Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}...   186   3e-49
CAGL0M13519g Chr13 complement(1330802..1332286) [1485 bp, 494 aa...   183   5e-49
KAFR0B01520 Chr2 (286962..288452) [1491 bp, 496 aa] {ON} Anc_5.4...   183   6e-49
NCAS0H01280 Chr8 complement(243749..246412) [2664 bp, 887 aa] {O...   189   9e-49
SAKL0H01430g Chr8 (149724..151226) [1503 bp, 500 aa] {ON} highly...   182   2e-48
CAGL0K07029g Chr11 complement(690501..692951) [2451 bp, 816 aa] ...   187   2e-48
KLLA0A05203g Chr1 complement(462167..463474) [1308 bp, 435 aa] {...   180   2e-48
Kpol_1062.5 s1062 complement(10370..11665) [1296 bp, 431 aa] {ON...   179   4e-48
TPHA0L02160 Chr12 complement(448305..449801) [1497 bp, 498 aa] {...   180   6e-48
TBLA0C00640 Chr3 (129301..131040) [1740 bp, 579 aa] {ON} Anc_8.1...   182   7e-48
Kwal_56.24760 s56 (1136947..1138248) [1302 bp, 433 aa] {ON} YHR1...   178   8e-48
Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W ...   185   1e-47
KNAG0M00660 Chr13 complement(107772..110426) [2655 bp, 884 aa] {...   185   1e-47
TDEL0G00650 Chr7 (132659..134116) [1458 bp, 485 aa] {ON} Anc_5.4...   178   3e-47
KLTH0B08998g Chr2 complement(731722..733200) [1479 bp, 492 aa] {...   177   4e-47
TDEL0G00930 Chr7 complement(186836..188146) [1311 bp, 436 aa] {O...   176   5e-47
AGR333C Chr7 complement(1353154..1354668) [1515 bp, 504 aa] {ON}...   177   8e-47
Kpol_513.15 s513 complement(41334..42839) [1506 bp, 501 aa] {ON}...   177   9e-47
CAGL0K11198g Chr11 complement(1087381..1089129) [1749 bp, 582 aa...   178   1e-46
Kwal_23.4288 s23 (654900..656378) [1479 bp, 492 aa] {ON} YMR290C...   176   1e-46
NDAI0C03600 Chr3 complement(826718..828277) [1560 bp, 519 aa] {O...   177   1e-46
AER301C Chr5 complement(1188485..1189792) [1308 bp, 435 aa] {ON}...   174   1e-46
NCAS0F02200 Chr6 (438960..440486) [1527 bp, 508 aa] {ON} Anc_5.40     176   2e-46
TBLA0C06780 Chr3 complement(1636223..1637713) [1491 bp, 496 aa] ...   174   6e-46
Skud_7.100 Chr7 (187842..189518) [1677 bp, 558 aa] {ON} YGL171W ...   176   8e-46
YMR290C Chr13 complement(850074..851591) [1518 bp, 505 aa] {ON} ...   174   8e-46
ZYRO0D07546g Chr4 (657145..658629) [1485 bp, 494 aa] {ON} highly...   174   1e-45
Suva_13.480 Chr13 complement(832037..833554) [1518 bp, 505 aa] {...   173   2e-45
Smik_13.506 Chr13 complement(832760..834277) [1518 bp, 505 aa] {...   173   2e-45
KNAG0D02780 Chr4 complement(504774..506204) [1431 bp, 476 aa] {O...   172   2e-45
Skud_13.463 Chr13 complement(823646..825163) [1518 bp, 505 aa] {...   173   2e-45
TDEL0E04210 Chr5 complement(786151..788373) [2223 bp, 740 aa] {O...   176   4e-45
NCAS0A01550 Chr1 complement(302857..305103) [2247 bp, 748 aa] {O...   175   1e-44
Skud_15.210 Chr15 complement(374410..375858) [1449 bp, 482 aa] {...   170   1e-44
SAKL0A06204g Chr1 complement(560276..562807) [2532 bp, 843 aa] {...   175   2e-44
KAFR0E01160 Chr5 (232985..234202) [1218 bp, 405 aa] {ON} Anc_3.2...   167   2e-44
KAFR0C06420 Chr3 complement(1286002..1288221) [2220 bp, 739 aa] ...   174   2e-44
Suva_8.98 Chr8 complement(177272..178720) [1449 bp, 482 aa] {ON}...   169   3e-44
NCAS0A01400 Chr1 (274080..276368) [2289 bp, 762 aa] {ON} Anc_5.241    173   5e-44
Smik_15.224 Chr15 complement(380539..381972) [1434 bp, 477 aa] {...   168   6e-44
YOR046C Chr15 complement(414459..415907) [1449 bp, 482 aa] {ON} ...   168   6e-44
KLLA0F10505g Chr6 complement(966736..969174) [2439 bp, 812 aa] {...   173   8e-44
NDAI0C02490 Chr3 complement(570276..572591) [2316 bp, 771 aa] {O...   172   1e-43
KAFR0C06090 Chr3 complement(1208993..1210417) [1425 bp, 474 aa] ...   167   2e-43
Kpol_1058.43 s1058 complement(121252..123075) [1824 bp, 607 aa] ...   168   4e-43
KLTH0A02244g Chr1 (190077..191873) [1797 bp, 598 aa] {ON} simila...   168   5e-43
TBLA0D03520 Chr4 (873710..876379) [2670 bp, 889 aa] {ON} Anc_6.1...   171   8e-43
TDEL0B01670 Chr2 (297786..299525) [1740 bp, 579 aa] {ON}              167   9e-43
Ecym_8358 Chr8 (719978..721687) [1710 bp, 569 aa] {ON} similar t...   165   3e-42
CAGL0L08976g Chr12 complement(981008..982861) [1854 bp, 617 aa] ...   164   9e-42
Kpol_165.1 s165 complement(441..1766) [1326 bp, 441 aa] {ON} com...   160   1e-41
Kwal_26.8470 s26 complement(798445..799722) [1278 bp, 425 aa] {O...   160   1e-41
Skud_6.72 Chr6 complement(140844..142664) [1821 bp, 606 aa] {ON}...   163   2e-41
Smik_2.380 Chr2 (678057..680609) [2553 bp, 850 aa] {ON} YBR237W ...   166   3e-41
ZYRO0E02530g Chr5 (197126..198796) [1671 bp, 556 aa] {ON} highly...   161   4e-41
ZYRO0F04312g Chr6 complement(366863..368671) [1809 bp, 602 aa] {...   161   9e-41
TBLA0H03240 Chr8 complement(787863..790166) [2304 bp, 767 aa] {O...   163   1e-40
TPHA0D01990 Chr4 complement(411607..413103) [1497 bp, 498 aa] {O...   158   2e-40
CAGL0F05577g Chr6 (559705..561705) [2001 bp, 666 aa] {ON} simila...   159   6e-40
KAFR0D04630 Chr4 complement(909161..910624) [1464 bp, 487 aa] {O...   155   1e-39
ADL024C Chr4 complement(657270..658979) [1710 bp, 569 aa] {ON} S...   157   2e-39
KNAG0B04660 Chr2 complement(900857..902341) [1485 bp, 494 aa] {O...   155   2e-39
TPHA0D00940 Chr4 complement(186966..188678) [1713 bp, 570 aa] {O...   156   2e-39
ZYRO0C14234g Chr3 complement(1116350..1117834) [1485 bp, 494 aa]...   155   2e-39
KLTH0H15686g Chr8 complement(1353647..1354725,1354841..1355081) ...   153   3e-39
NDAI0C04250 Chr3 (968216..969730) [1515 bp, 504 aa] {ON} Anc_5.337    155   3e-39
Suva_6.59 Chr6 complement(110278..112098) [1821 bp, 606 aa] {ON}...   157   3e-39
SAKL0H13574g Chr8 (1161196..1163202) [2007 bp, 668 aa] {ON} simi...   156   6e-39
ZYRO0C04378g Chr3 complement(342717..344762) [2046 bp, 681 aa] {...   156   6e-39
KLLA0C14608g Chr3 (1276354..1277817) [1464 bp, 487 aa] {ON} high...   152   1e-38
Ecym_3217 Chr3 complement(411925..413385) [1461 bp, 486 aa] {ON}...   152   1e-38
TPHA0G02050 Chr7 (420332..421648) [1317 bp, 438 aa] {ON} Anc_2.3...   151   1e-38
SAKL0G09328g Chr7 (797795..799312) [1518 bp, 505 aa] {ON} highly...   152   2e-38
Ecym_6049 Chr6 (94618..95934) [1317 bp, 438 aa] {ON} similar to ...   151   2e-38
TPHA0G02585 Chr7 (535997..537313) [1317 bp, 438 aa] {ON}              150   2e-38
KNAG0A05850 Chr1 (873957..875306) [1350 bp, 449 aa] {ON} Anc_2.3...   151   2e-38
NCAS0F02790 Chr6 (561303..562811) [1509 bp, 502 aa] {ON} Anc_5.337    152   2e-38
YGL171W Chr7 (182390..184084) [1695 bp, 564 aa] {ON}  ROK1RNA-de...   153   2e-38
Kpol_1005.11 s1005 complement(18157..19677) [1521 bp, 506 aa] {O...   152   2e-38
CAGL0K02387g Chr11 (216795..218492) [1698 bp, 565 aa] {ON} highl...   153   2e-38
AGL112C Chr7 complement(495879..497855) [1977 bp, 658 aa] {ON} S...   154   3e-38
YHR065C Chr8 complement(227532..229037) [1506 bp, 501 aa] {ON}  ...   151   3e-38
NCAS0A03950 Chr1 (799925..801265) [1341 bp, 446 aa] {ON} Anc_2.384    150   4e-38
Smik_8.136 Chr8 complement(202825..204330) [1506 bp, 501 aa] {ON...   151   5e-38
KLTH0F08382g Chr6 (724794..726767) [1974 bp, 657 aa] {ON} simila...   153   6e-38
TDEL0E02890 Chr5 (550708..552213) [1506 bp, 501 aa] {ON} Anc_5.3...   150   6e-38
ADR260C Chr4 complement(1152257..1153573) [1317 bp, 438 aa] {ON}...   149   6e-38
Smik_7.100 Chr7 (177395..179068) [1674 bp, 557 aa] {ON} YGL171W ...   152   7e-38
CAGL0J10912g Chr10 (1063600..1065081) [1482 bp, 493 aa] {ON} hig...   150   9e-38
KLLA0E21935g Chr5 (1959770..1961083) [1314 bp, 437 aa] {ON} high...   149   9e-38
Skud_8.122 Chr8 complement(200848..202359) [1512 bp, 503 aa] {ON...   150   1e-37
Suva_4.163 Chr4 (294691..296031) [1341 bp, 446 aa] {ON} YDL084W ...   149   1e-37
TBLA0C03500 Chr3 complement(835236..836756) [1521 bp, 506 aa] {O...   150   1e-37
Suva_7.92 Chr7 (178376..180052) [1677 bp, 558 aa] {ON} YGL171W (...   150   2e-37
Kpol_1058.53 s1058 complement(136863..138191) [1329 bp, 442 aa] ...   148   2e-37
Kpol_2001.67 s2001 (185153..186607) [1455 bp, 484 aa] {ON} (1851...   149   3e-37
YDL084W Chr4 (305237..306577) [1341 bp, 446 aa] {ON}  SUB2Compon...   147   3e-37
NCAS0A14060 Chr1 (2765451..2766983) [1533 bp, 510 aa] {ON} Anc_7...   149   3e-37
TDEL0F05260 Chr6 complement(983324..985291) [1968 bp, 655 aa] {O...   151   3e-37
Smik_4.152 Chr4 (281728..283068) [1341 bp, 446 aa] {ON} YDL084W ...   147   3e-37
Skud_4.171 Chr4 (300716..302056) [1341 bp, 446 aa] {ON} YDL084W ...   147   3e-37
Suva_15.254 Chr15 complement(429201..430712) [1512 bp, 503 aa] {...   149   3e-37
CAGL0L06908g Chr12 complement(779554..780873) [1320 bp, 439 aa] ...   147   4e-37
Kwal_33.14325 s33 (619599..621101) [1503 bp, 500 aa] {ON} YHR065...   148   5e-37
KNAG0C03820 Chr3 complement(748934..750475) [1542 bp, 513 aa] {O...   148   5e-37
Kpol_1041.33 s1041 complement(82855..84180) [1326 bp, 441 aa] {O...   147   5e-37
Ecym_4646 Chr4 complement(1259564..1261036) [1473 bp, 490 aa] {O...   147   7e-37
SAKL0F11088g Chr6 complement(866571..868064) [1494 bp, 497 aa] {...   147   7e-37
KAFR0B00910 Chr2 complement(168186..169724) [1539 bp, 512 aa] {O...   147   8e-37
KLTH0F07106g Chr6 (618637..620214) [1578 bp, 525 aa] {ON} highly...   148   8e-37
TDEL0G03140 Chr7 (587922..589256) [1335 bp, 444 aa] {ON} Anc_2.3...   146   9e-37
CAGL0L10021g Chr12 complement(1076197..1077711) [1515 bp, 504 aa...   147   9e-37
ACR197W Chr3 (695405..696859) [1455 bp, 484 aa] {ON} Syntenic ho...   147   1e-36
KLTH0H08646g Chr8 (750413..752113) [1701 bp, 566 aa] {ON} highly...   147   2e-36
AAL041C Chr1 complement(270739..272202) [1464 bp, 487 aa] {ON} S...   146   2e-36
SAKL0E05148g Chr5 complement(419901..420979,421045..421372) [140...   145   2e-36
ZYRO0A08272g Chr1 (665522..666853) [1332 bp, 443 aa] {ON} highly...   144   4e-36
TDEL0C01160 Chr3 complement(198802..200613) [1812 bp, 603 aa] {O...   147   5e-36
TPHA0N00940 Chr14 (202770..205085) [2316 bp, 771 aa] {ON} Anc_5....   148   6e-36
Ecym_8261 Chr8 complement(528229..530556) [2328 bp, 775 aa] {ON}...   148   6e-36
Kpol_1060.58 s1060 complement(135570..136760) [1191 bp, 396 aa] ...   142   8e-36
NDAI0E01750 Chr5 complement(346153..347505) [1353 bp, 450 aa] {O...   143   8e-36
KAFR0F02940 Chr6 (582057..583388) [1332 bp, 443 aa] {ON} Anc_2.3...   143   9e-36
NDAI0A01960 Chr1 complement(436462..438066) [1605 bp, 534 aa] {O...   145   9e-36
TDEL0C02100 Chr3 complement(362760..364199) [1440 bp, 479 aa] {O...   144   1e-35
Smik_4.77 Chr4 complement(147172..148692) [1521 bp, 506 aa] {ON}...   144   1e-35
Suva_16.191 Chr16 complement(333913..335769) [1857 bp, 618 aa] {...   145   1e-35
KLLA0F01034g Chr6 (93422..95305) [1884 bp, 627 aa] {ON} similar ...   146   1e-35
TPHA0B02930 Chr2 (666924..668207) [1284 bp, 427 aa] {ON} Anc_6.1...   142   1e-35
KAFR0G00650 Chr7 complement(164087..165274) [1188 bp, 395 aa] {O...   141   2e-35
SAKL0H20218g Chr8 (1770946..1772670) [1725 bp, 574 aa] {ON} simi...   145   2e-35
Smik_6.318 Chr6 (498013..499854) [1842 bp, 613 aa] {ON} YPL119C ...   145   2e-35
TDEL0F01090 Chr6 (196968..198623) [1656 bp, 551 aa] {ON} Anc_8.1...   144   2e-35
KNAG0H01520 Chr8 complement(267709..269574) [1866 bp, 621 aa] {O...   145   2e-35
TPHA0D04520 Chr4 (985683..987191) [1509 bp, 502 aa] {ON} Anc_7.3...   143   2e-35
KLLA0C16599g Chr3 (1453655..1455199) [1545 bp, 514 aa] {ON} simi...   143   2e-35
TBLA0F02360 Chr6 (582109..583866) [1758 bp, 585 aa] {ON} Anc_7.3...   144   3e-35
NDAI0B02410 Chr2 complement(602541..604256) [1716 bp, 571 aa] {O...   144   3e-35
SAKL0G01496g Chr7 (125044..125050,125133..126568) [1443 bp, 480 ...   142   3e-35
CAGL0I03476g Chr9 complement(294849..296372) [1524 bp, 507 aa] {...   142   4e-35
Suva_4.86 Chr4 complement(158173..159699) [1527 bp, 508 aa] {ON}...   142   4e-35
Skud_4.96 Chr4 complement(166027..167550) [1524 bp, 507 aa] {ON}...   142   5e-35
Skud_16.161 Chr16 complement(295968..297827) [1860 bp, 619 aa] {...   144   5e-35
YDL160C Chr4 complement(170410..171930) [1521 bp, 506 aa] {ON}  ...   142   5e-35
Ecym_4775 Chr4 (1507889..1509391) [1503 bp, 500 aa] {ON} similar...   142   5e-35
Smik_4.442 Chr4 complement(801552..803549) [1998 bp, 665 aa] {ON...   144   5e-35
ZYRO0F11440g Chr6 (939613..941184) [1572 bp, 523 aa] {ON} highly...   142   6e-35
YDR194C Chr4 complement(845952..847946) [1995 bp, 664 aa] {ON}  ...   144   7e-35
KNAG0I02050 Chr9 complement(399547..399554,399758..401021) [1272...   140   8e-35
TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 5...   142   9e-35
YPL119C Chr16 complement(324411..326264) [1854 bp, 617 aa] {ON} ...   143   9e-35
Kpol_274.7 s274 complement(11790..13502) [1713 bp, 570 aa] {ON} ...   142   1e-34
Skud_14.219 Chr14 (403781..405088) [1308 bp, 435 aa] {ON} YNL112...   140   1e-34
Kwal_27.11734 s27 complement(923899..925614) [1716 bp, 571 aa] {...   142   1e-34
KAFR0E01640 Chr5 complement(335123..337405) [2283 bp, 760 aa] {O...   144   1e-34
ZYRO0G08580g Chr7 complement(695127..696746) [1620 bp, 539 aa] {...   141   1e-34
TPHA0B02850 Chr2 complement(650888..652774) [1887 bp, 628 aa] {O...   142   2e-34
NCAS0B08130 Chr2 (1551641..1552831) [1191 bp, 396 aa] {ON} Anc_1...   138   2e-34
KLTH0H01562g Chr8 complement(140915..142390) [1476 bp, 491 aa] {...   140   3e-34
NCAS0E03920 Chr5 complement(769305..770618) [1314 bp, 437 aa] {O...   139   3e-34
KAFR0H02820 Chr8 (537121..538956) [1836 bp, 611 aa] {ON} Anc_8.6...   141   3e-34
KLTH0D09746g Chr4 (805863..807728) [1866 bp, 621 aa] {ON} simila...   141   3e-34
SAKL0H08162g Chr8 complement(702292..704166) [1875 bp, 624 aa] {...   141   4e-34
Suva_14.226 Chr14 (410416..411691,412742..413097) [1632 bp, 543 ...   140   4e-34
Smik_15.390 Chr15 (672576..674405) [1830 bp, 609 aa] {ON} YOR204...   141   4e-34
ADL273C Chr4 complement(225068..226939) [1872 bp, 623 aa] {ON} S...   141   4e-34
KLLA0F23716g Chr6 complement(2215454..2215845,2216857..2218129) ...   140   4e-34
SAKL0G11748g Chr7 complement(998525..1000816) [2292 bp, 763 aa] ...   142   5e-34
NCAS0B04630 Chr2 (845866..847557) [1692 bp, 563 aa] {ON} Anc_8.124    140   5e-34
NCAS0C01720 Chr3 complement(317951..319873) [1923 bp, 640 aa] {O...   141   5e-34
KLTH0H04466g Chr8 (399689..401350) [1662 bp, 553 aa] {ON} simila...   140   6e-34
KLLA0C17424g Chr3 (1529941..1531680) [1740 bp, 579 aa] {ON} simi...   140   6e-34
Kwal_56.24005 s56 complement(809954..811555) [1602 bp, 533 aa] {...   139   6e-34
Suva_8.257 Chr8 (461776..463632) [1857 bp, 618 aa] {ON} YOR204W ...   140   6e-34
Smik_14.215 Chr14 (393283..394555,395537..395907) [1644 bp, 547 ...   139   7e-34
Skud_15.370 Chr15 (661915..663744) [1830 bp, 609 aa] {ON} YOR204...   140   7e-34
Skud_4.458 Chr4 complement(812448..814442) [1995 bp, 664 aa] {ON...   140   8e-34
YOR204W Chr15 (722911..724725) [1815 bp, 604 aa] {ON}  DED1ATP-d...   140   8e-34
AFL221C Chr6 complement(22711..23108,23775..25050) [1674 bp, 557...   139   9e-34
TDEL0A05590 Chr1 (980392..982185) [1794 bp, 597 aa] {ON} Anc_8.6...   140   9e-34
YNL112W Chr14 (413639..414911,415914..416281) [1641 bp, 546 aa] ...   139   1e-33
Kwal_56.24588 s56 (1065225..1066766) [1542 bp, 513 aa] {ON} YDL1...   138   1e-33
Kpol_1072.50 s1072 complement(115009..116961) [1953 bp, 650 aa] ...   140   1e-33
KLLA0C15499g Chr3 complement(1345201..1346715) [1515 bp, 504 aa]...   138   1e-33
NCAS0B01730 Chr2 complement(286249..288105) [1857 bp, 618 aa] {O...   139   1e-33
NDAI0B00900 Chr2 complement(209012..210322) [1311 bp, 436 aa] {O...   136   1e-33
NDAI0C02320 Chr3 (527244..529538) [2295 bp, 764 aa] {ON} Anc_5.241    140   2e-33
Ecym_8298 Chr8 (605258..607174) [1917 bp, 638 aa] {ON} similar t...   139   2e-33
TBLA0E04100 Chr5 (1032727..1035327) [2601 bp, 866 aa] {ON} Anc_8...   140   2e-33
KNAG0F02050 Chr6 (392126..393727) [1602 bp, 533 aa] {ON} Anc_6.2...   137   2e-33
KLLA0D09504g Chr4 complement(801783..804095) [2313 bp, 770 aa] {...   140   2e-33
NDAI0E01590 Chr5 complement(315658..317484) [1827 bp, 608 aa] {O...   139   3e-33
CAGL0J06908g Chr10 complement(662041..663855) [1815 bp, 604 aa] ...   138   3e-33
TDEL0G01420 Chr7 (287165..288703) [1539 bp, 512 aa] {ON} Anc_6.2...   137   3e-33
CAGL0L02915g Chr12 complement(342831..344684) [1854 bp, 617 aa] ...   138   3e-33
Suva_2.362 Chr2 complement(636909..638903) [1995 bp, 664 aa] {ON...   138   4e-33
KAFR0C02220 Chr3 complement(439704..441239) [1536 bp, 511 aa] {O...   136   5e-33
ZYRO0F10934g Chr6 (890412..892223) [1812 bp, 603 aa] {ON} simila...   137   5e-33
KNAG0F02610 Chr6 complement(488956..491244) [2289 bp, 762 aa] {O...   139   5e-33
CAGL0I02354g Chr9 (209279..210592) [1314 bp, 437 aa] {ON} highly...   134   6e-33
TBLA0B04200 Chr2 complement(970057..971952) [1896 bp, 631 aa] {O...   137   6e-33
CAGL0J01045g Chr10 (101282..103579) [2298 bp, 765 aa] {ON} highl...   138   7e-33
SAKL0A04752g Chr1 (434100..435749) [1650 bp, 549 aa] {ON} simila...   136   8e-33
TDEL0E03850 Chr5 complement(723551..725836) [2286 bp, 761 aa] {O...   138   8e-33
KAFR0B02030 Chr2 complement(397276..398991) [1716 bp, 571 aa] {O...   136   8e-33
Kpol_1004.13 s1004 (25289..27595) [2307 bp, 768 aa] {ON} (25289....   138   8e-33
Skud_8.233 Chr8 (413556..414869) [1314 bp, 437 aa] {ON} YHR169W ...   134   9e-33
Kwal_23.2883 s23 complement(58087..60381) [2295 bp, 764 aa] {ON}...   137   1e-32
KLTH0E10890g Chr5 complement(976948..978717) [1770 bp, 589 aa] {...   136   1e-32
ZYRO0A10802g Chr1 complement(869465..871780) [2316 bp, 771 aa] {...   137   2e-32
Ecym_2213 Chr2 (419873..421537) [1665 bp, 554 aa] {ON} similar t...   134   3e-32
ACR040W Chr3 (431343..433634) [2292 bp, 763 aa] {ON} Syntenic ho...   136   3e-32
TBLA0D03400 Chr4 (844529..846856) [2328 bp, 775 aa] {ON} Anc_5.2...   136   3e-32
KLTH0G07766g Chr7 complement(626094..628388) [2295 bp, 764 aa] {...   136   4e-32
NCAS0D03740 Chr4 complement(694809..696368) [1560 bp, 519 aa] {O...   133   5e-32
KAFR0G02030 Chr7 complement(428516..430336) [1821 bp, 606 aa] {O...   134   5e-32
SAKL0E10670g Chr5 complement(888829..889205,889934..891281) [172...   134   6e-32
NDAI0E02430 Chr5 complement(503901..505886) [1986 bp, 661 aa] {O...   135   6e-32
KLLA0C15433g Chr3 complement(1339439..1341058) [1620 bp, 539 aa]...   133   6e-32
Kpol_1033.40 s1033 complement(104203..105795) [1593 bp, 530 aa] ...   133   7e-32
Smik_8.253 Chr8 (419155..420468) [1314 bp, 437 aa] {ON} YHR169W ...   131   8e-32
KNAG0D02250 Chr4 (387478..389160) [1683 bp, 560 aa] {ON} Anc_8.1...   133   9e-32
NDAI0I01150 Chr9 (278832..280403) [1572 bp, 523 aa] {ON} Anc_6.204    132   1e-31
SAKL0H02178g Chr8 complement(211451..212758) [1308 bp, 435 aa] {...   130   2e-31
Suva_15.369 Chr15 (648232..649545) [1314 bp, 437 aa] {ON} YHR169...   130   2e-31
KAFR0B04480 Chr2 complement(929008..930315) [1308 bp, 435 aa] {O...   130   2e-31
TPHA0E02410 Chr5 (512919..514490) [1572 bp, 523 aa] {ON} Anc_6.2...   131   2e-31
KAFR0E02810 Chr5 complement(567875..569581) [1707 bp, 568 aa] {O...   132   2e-31
Suva_12.48 Chr12 (66743..69055) [2313 bp, 770 aa] {ON} YJL033W (...   133   3e-31
TPHA0H01160 Chr8 (257728..259029) [1302 bp, 433 aa] {ON} Anc_5.6...   129   4e-31
TBLA0B05050 Chr2 (1191456..1192997) [1542 bp, 513 aa] {ON} Anc_6...   130   4e-31
KAFR0D01120 Chr4 complement(222704..224536) [1833 bp, 610 aa] {O...   132   4e-31
TBLA0B07950 Chr2 complement(1884315..1885496) [1182 bp, 393 aa] ...   128   4e-31
ZYRO0A02948g Chr1 (240353..242026) [1674 bp, 557 aa] {ON} simila...   131   5e-31
Smik_10.239 Chr10 (380101..382413) [2313 bp, 770 aa] {ON} YJL033...   132   5e-31
YJL033W Chr10 (383837..386149) [2313 bp, 770 aa] {ON}  HCA4Putat...   132   6e-31
NCAS0B02570 Chr2 (429423..431195) [1773 bp, 590 aa] {ON} Anc_8.469    130   8e-31
NDAI0C06300 Chr3 complement(1459510..1461354) [1845 bp, 614 aa] ...   130   1e-30
YDR243C Chr4 complement(948518..950284) [1767 bp, 588 aa] {ON}  ...   130   2e-30
Skud_10.189 Chr10 (351797..354109) [2313 bp, 770 aa] {ON} YJL033...   130   2e-30
Smik_6.81 Chr6 complement(152467..154287) [1821 bp, 606 aa] {ON}...   129   3e-30
KNAG0A03280 Chr1 complement(416099..417922) [1824 bp, 607 aa] {O...   129   4e-30
Kwal_23.5125 s23 complement(1024642..1026438) [1797 bp, 598 aa] ...   129   4e-30
KLLA0A05731g Chr1 (536243..537433) [1191 bp, 396 aa] {ON} highly...   125   4e-30
SAKL0H11968g Chr8 (1022452..1024152) [1701 bp, 566 aa] {ON} simi...   128   4e-30
KLLA0E14367g Chr5 (1268901..1270691) [1791 bp, 596 aa] {ON} simi...   128   5e-30
Ecym_7324 Chr7 complement(689228..691021) [1794 bp, 597 aa] {ON}...   128   6e-30
TBLA0D02800 Chr4 (686898..688661) [1764 bp, 587 aa] {ON} Anc_8.4...   127   9e-30
Smik_10.94 Chr10 complement(151257..152444) [1188 bp, 395 aa] {O...   124   9e-30
Smik_11.321 Chr11 (544869..546056) [1188 bp, 395 aa] {ON} YKR059...   124   9e-30
Ecym_5095 Chr5 (213368..214684) [1317 bp, 438 aa] {ON} similar t...   124   1e-29
AGL004C Chr7 complement(715482..717410) [1929 bp, 642 aa] {ON} S...   127   2e-29
Skud_10.76 Chr10 complement(128551..129738) [1188 bp, 395 aa] {O...   123   2e-29
Suva_11.294 Chr11 (539139..540329) [1191 bp, 396 aa] {ON} YKR059...   123   2e-29
KNAG0H01370 Chr8 complement(243799..244995) [1197 bp, 398 aa] {O...   123   2e-29
YJL138C Chr10 complement(153504..154691) [1188 bp, 395 aa] {ON} ...   123   2e-29
YKR059W Chr11 (554987..556174) [1188 bp, 395 aa] {ON}  TIF1Trans...   123   2e-29
Suva_2.409 Chr2 complement(727948..729717) [1770 bp, 589 aa] {ON...   126   3e-29
Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON...   125   3e-29
Suva_6.218 Chr6 (395411..396601) [1191 bp, 396 aa] {ON} YJL138C ...   122   3e-29
Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON...   125   3e-29
KNAG0L00410 Chr12 complement(57484..59325) [1842 bp, 613 aa] {ON...   126   3e-29
YFL002C Chr6 complement(145114..146934) [1821 bp, 606 aa] {ON}  ...   126   3e-29
Skud_11.295 Chr11 (536422..537711) [1290 bp, 429 aa] {ON} YKR059...   123   4e-29
TBLA0I01860 Chr9 (418583..419746) [1164 bp, 387 aa] {ON} Anc_3.2...   121   8e-29
ZYRO0C11660g Chr3 (912287..913594) [1308 bp, 435 aa] {ON} highly...   122   1e-28
TPHA0B03040 Chr2 complement(690810..692000) [1191 bp, 396 aa] {O...   121   1e-28
NCAS0J00580 Chr10 (87108..88943) [1836 bp, 611 aa] {ON} Anc_8.87      124   2e-28
TPHA0D00770 Chr4 (155185..157002) [1818 bp, 605 aa] {ON} Anc_8.8...   123   3e-28
Suva_10.374 Chr10 complement(655832..657616) [1785 bp, 594 aa] {...   122   5e-28
NDAI0C05120 Chr3 complement(1191160..1193046) [1887 bp, 628 aa] ...   122   6e-28
Kpol_1007.10 s1007 complement(17289..19106) [1818 bp, 605 aa] {O...   122   6e-28
NCAS0A10430 Chr1 (2073293..2074492) [1200 bp, 399 aa] {ON} Anc_3...   119   6e-28
Skud_12.359 Chr12 complement(636149..637930) [1782 bp, 593 aa] {...   121   9e-28
TBLA0C00690 Chr3 complement(136694..138508) [1815 bp, 604 aa] {O...   121   1e-27
TPHA0C01860 Chr3 (425216..427039) [1824 bp, 607 aa] {ON} Anc_8.4...   121   1e-27
KLLA0A10659g Chr1 complement(927059..928255) [1197 bp, 398 aa] {...   117   2e-27
Kpol_1036.3 s1036 complement(10496..11695) [1200 bp, 399 aa] {ON...   117   2e-27
SAKL0B02794g Chr2 complement(266645..268441) [1797 bp, 598 aa] {...   120   2e-27
YLR276C Chr12 complement(695046..696830) [1785 bp, 594 aa] {ON} ...   120   2e-27
Ecym_4755 Chr4 complement(1469426..1470622) [1197 bp, 398 aa] {O...   117   3e-27
ZYRO0D03058g Chr4 complement(237526..238713) [1188 bp, 395 aa] {...   117   3e-27
TPHA0M00900 Chr13 (175733..176935) [1203 bp, 400 aa] {ON} Anc_3....   117   3e-27
SAKL0D03960g Chr4 complement(321960..323156) [1197 bp, 398 aa] {...   117   3e-27
CAGL0I04356g Chr9 (389225..390415) [1191 bp, 396 aa] {ON} highly...   116   4e-27
NDAI0A05860 Chr1 complement(1331381..1332580) [1200 bp, 399 aa] ...   116   4e-27
Smik_12.355 Chr12 complement(633462..635246) [1785 bp, 594 aa] {...   119   5e-27
YDR021W Chr4 (486804..488003) [1200 bp, 399 aa] {ON}  FAL1Nucleo...   116   6e-27
KNAG0A04130 Chr1 (559075..560904) [1830 bp, 609 aa] {ON} Anc_8.4...   119   6e-27
ZYRO0A03476g Chr1 complement(277585..278784) [1200 bp, 399 aa] {...   115   7e-27
CAGL0M06567g Chr13 complement(679126..680325) [1200 bp, 399 aa] ...   115   9e-27
Suva_2.171 Chr2 (297542..298741) [1200 bp, 399 aa] {ON} YDR021W ...   115   1e-26
ACR253C Chr3 complement(802236..803426) [1191 bp, 396 aa] {ON} S...   114   2e-26
Ecym_5196 Chr5 complement(405570..406760) [1191 bp, 396 aa] {ON}...   114   2e-26
Smik_4.255 Chr4 (467483..468682) [1200 bp, 399 aa] {ON} YDR021W ...   114   2e-26
NDAI0B05440 Chr2 (1333810..1335000) [1191 bp, 396 aa] {ON} Anc_1...   114   3e-26
Skud_4.273 Chr4 (477488..478687) [1200 bp, 399 aa] {ON} YDR021W ...   114   3e-26
SAKL0A08118g Chr1 (718720..720564) [1845 bp, 614 aa] {ON} highly...   115   6e-26
NCAS0D02940 Chr4 complement(558088..559923) [1836 bp, 611 aa] {O...   115   6e-26
KLTH0C07964g Chr3 complement(679877..681073) [1197 bp, 398 aa] {...   113   7e-26
ZYRO0B05852g Chr2 (468295..470550) [2256 bp, 751 aa] {ON} simila...   116   7e-26
KNAG0K00400 Chr11 (69795..71093) [1299 bp, 432 aa] {ON} Anc_5.69...   113   9e-26
KNAG0B03010 Chr2 (582008..583489) [1482 bp, 493 aa] {ON} Anc_5.6...   113   1e-25
Kwal_56.23291 s56 complement(479073..480842) [1770 bp, 589 aa] {...   114   2e-25
NCAS0I02320 Chr9 (437124..439319) [2196 bp, 731 aa] {ON} Anc_3.1...   114   2e-25
KAFR0A04960 Chr1 (981797..983572) [1776 bp, 591 aa] {ON} Anc_6.7...   113   3e-25
TDEL0D03760 Chr4 complement(689455..690651) [1197 bp, 398 aa] {O...   110   4e-25
KLTH0F05610g Chr6 complement(483243..484433) [1191 bp, 396 aa] {...   110   6e-25
TBLA0B08880 Chr2 complement(2108994..2110322) [1329 bp, 442 aa] ...   110   7e-25
TDEL0G03990 Chr7 (726319..728085) [1767 bp, 588 aa] {ON} Anc_6.7...   112   9e-25
AER408W Chr5 (1418694..1419890) [1197 bp, 398 aa] {ON} Syntenic ...   109   1e-24
KLTH0G15224g Chr7 (1332767..1334557) [1791 bp, 596 aa] {ON} high...   112   1e-24
Suva_4.392 Chr4 (697442..699823) [2382 bp, 793 aa] {ON} YBR142W ...   112   1e-24
Kpol_473.7 s473 complement(21177..22613) [1437 bp, 478 aa] {ON} ...   110   1e-24
CAGL0A03652g Chr1 complement(373100..375301) [2202 bp, 733 aa] {...   112   1e-24
KLLA0C04576g Chr3 complement(417217..419001) [1785 bp, 594 aa] {...   111   2e-24
Kwal_33.14000 s33 complement(477253..478443) [1191 bp, 396 aa] {...   108   2e-24
NCAS0G00610 Chr7 (105992..107407) [1416 bp, 471 aa] {ON} Anc_5.643    109   2e-24
Smik_2.282 Chr2 (512869..515271) [2403 bp, 800 aa] {ON} YBR142W ...   112   2e-24
SAKL0C06336g Chr3 complement(584406..585599) [1194 bp, 397 aa] {...   108   2e-24
KAFR0G01440 Chr7 complement(319146..321305) [2160 bp, 719 aa] {O...   111   2e-24
TBLA0E03420 Chr5 (846796..849024) [2229 bp, 742 aa] {ON} Anc_3.1...   111   2e-24
Kwal_23.3235 s23 (209691..211721) [2031 bp, 676 aa] {ON} YDR194C...   111   2e-24
Kpol_1016.14 s1016 complement(36309..38507) [2199 bp, 732 aa] {O...   111   3e-24
Kwal_34.15835 s34 (79657..80592) [936 bp, 311 aa] {ON} YOR204W (...   106   3e-24
TDEL0H00930 Chr8 complement(152864..154051) [1188 bp, 395 aa] {O...   107   3e-24
TPHA0B01270 Chr2 complement(283532..285754) [2223 bp, 740 aa] {O...   110   5e-24
AGR278C Chr7 complement(1261914..1263701) [1788 bp, 595 aa] {ON}...   109   5e-24
NDAI0I01960 Chr9 (457199..459025) [1827 bp, 608 aa] {ON} Anc_6.73     109   7e-24
TPHA0K01120 Chr11 (235339..237153) [1815 bp, 604 aa] {ON} Anc_6....   109   7e-24
Kpol_1036.17 s1036 (45392..47683) [2292 bp, 763 aa] {ON} (45392....   109   8e-24
TDEL0D05010 Chr4 (911771..914023) [2253 bp, 750 aa] {ON} Anc_3.1...   109   9e-24
KNAG0F03020 Chr6 complement(572005..573801) [1797 bp, 598 aa] {O...   108   9e-24
TBLA0B09205 Chr2 (2175882..2177243) [1362 bp, 453 aa] {ON}            107   1e-23
TDEL0B02800 Chr2 (504332..505726) [1395 bp, 464 aa] {ON} Anc_5.6...   106   2e-23
KNAG0K01980 Chr11 (405216..407381) [2166 bp, 721 aa] {ON} Anc_3....   108   2e-23
NDAI0A06900 Chr1 (1578643..1580622) [1980 bp, 659 aa] {ON} Anc_3...   108   2e-23
TBLA0D05750 Chr4 (1420975..1422180) [1206 bp, 401 aa] {ON} Anc_1...   105   2e-23
Kpol_340.2 s340 complement(3233..5245) [2013 bp, 670 aa] {ON} co...   108   2e-23
Skud_2.270 Chr2 (496096..498402) [2307 bp, 768 aa] {ON} YBR142W ...   108   3e-23
KLLA0F15950g Chr6 (1477113..1478522) [1410 bp, 469 aa] {ON} simi...   105   4e-23
SAKL0C10296g Chr3 complement(927939..930377) [2439 bp, 812 aa] {...   107   5e-23
YBR142W Chr2 (528317..530638) [2322 bp, 773 aa] {ON}  MAK5Essent...   107   5e-23
ZYRO0B15576g Chr2 complement(1265375..1266850) [1476 bp, 491 aa]...   105   5e-23
Skud_11.257 Chr11 complement(465439..467658) [2220 bp, 739 aa] {...   107   6e-23
Ecym_4165 Chr4 (350595..352571) [1977 bp, 658 aa] {ON} similar t...   106   6e-23
TPHA0J01230 Chr10 complement(289735..291210) [1476 bp, 491 aa] {...   105   6e-23
CAGL0F04983g Chr6 complement(507217..509004) [1788 bp, 595 aa] {...   106   7e-23
Ecym_5488 Chr5 (998651..1000099) [1449 bp, 482 aa] {ON} similar ...   105   8e-23
KLLA0F13926g Chr6 complement(1290006..1292228) [2223 bp, 740 aa]...   106   8e-23
TBLA0J00890 Chr10 complement(199404..200900) [1497 bp, 498 aa] {...   105   8e-23
KAFR0B06170 Chr2 complement(1271195..1273066) [1872 bp, 623 aa] ...   106   9e-23
KNAG0C01220 Chr3 complement(237478..238671) [1194 bp, 397 aa] {O...   103   1e-22
TBLA0D05490 Chr4 (1352976..1355243) [2268 bp, 755 aa] {ON}            105   2e-22
KLLA0C11253g Chr3 complement(967067..969457) [2391 bp, 796 aa] {...   105   2e-22
KNAG0A04660 Chr1 (663566..665707) [2142 bp, 713 aa] {ON} Anc_8.4...   105   2e-22
KLTH0F17050g Chr6 complement(1380459..1381888,1381971..1381977) ...   103   2e-22
TPHA0L00960 Chr12 complement(194538..196568) [2031 bp, 676 aa] {...   105   2e-22
NDAI0F00700 Chr6 (170569..171699) [1131 bp, 376 aa] {ON} Anc_5.643    102   3e-22
ACR078W Chr3 (501241..502644) [1404 bp, 467 aa] {ON} Syntenic ho...   102   3e-22
TBLA0A09740 Chr1 complement(2393212..2395065) [1854 bp, 617 aa] ...   104   3e-22
ZYRO0D14388g Chr4 complement(1218001..1219752) [1752 bp, 583 aa]...   103   5e-22
Smik_11.281 Chr11 complement(472555..474783) [2229 bp, 742 aa] {...   103   7e-22
YKR024C Chr11 complement(485144..487372) [2229 bp, 742 aa] {ON} ...   103   8e-22
Kwal_56.23164 s56 (430116..432539) [2424 bp, 807 aa] {ON} YBR142...   103   9e-22
Ecym_6354 Chr6 (686603..688819) [2217 bp, 738 aa] {ON} similar t...   103   9e-22
NDAI0C04680 Chr3 complement(1077391..1079541) [2151 bp, 716 aa] ...   103   1e-21
Kwal_56.22971 s56 (351639..352331) [693 bp, 230 aa] {ON} YDR021W...    97   1e-21
Suva_11.256 Chr11 complement(469196..471424) [2229 bp, 742 aa] {...   102   2e-21
NCAS0B07760 Chr2 (1469599..1471845) [2247 bp, 748 aa] {ON} Anc_1...   102   2e-21
CAGL0L03047g Chr12 (352032..354179) [2148 bp, 715 aa] {ON} simil...   101   3e-21
AFR082C Chr6 complement(576175..578307) [2133 bp, 710 aa] {ON} S...   100   6e-21
KLLA0F06941g Chr6 complement(665970..667862) [1893 bp, 630 aa] {...   100   6e-21
KLTH0D03190g Chr4 complement(306459..308609) [2151 bp, 716 aa] {...   100   6e-21
ZYRO0F01826g Chr6 complement(149490..151799) [2310 bp, 769 aa] {...   100   9e-21
KLLA0D18667g Chr4 complement(1574160..1576217) [2058 bp, 685 aa]...   100   1e-20
SAKL0D05258g Chr4 complement(416100..418247) [2148 bp, 715 aa] {...   100   1e-20
NDAI0B05110 Chr2 (1249929..1252217) [2289 bp, 762 aa] {ON} Anc_1...    99   2e-20
AER027W Chr5 (685709..687967) [2259 bp, 752 aa] {ON} Syntenic ho...    99   3e-20
TPHA0M00750 Chr13 complement(141794..144082) [2289 bp, 762 aa] {...    99   3e-20
Ecym_5326 Chr5 (663464..665737) [2274 bp, 757 aa] {ON} similar t...    98   5e-20
KNAG0C01480 Chr3 complement(294677..296947) [2271 bp, 756 aa] {O...    98   5e-20
Kwal_26.7302 s26 complement(304411..306555) [2145 bp, 714 aa] {O...    97   7e-20
Kwal_55.21609 s55 complement(912148..913269) [1122 bp, 373 aa] {...    94   1e-19
NCAS0B03030 Chr2 (522163..524217) [2055 bp, 684 aa] {ON} Anc_8.402     96   1e-19
KLTH0G15840g Chr7 complement(1381355..1383748) [2394 bp, 797 aa]...    95   5e-19
Kpol_1028.29 s1028 complement(76405..78318) [1914 bp, 637 aa] {O...    94   7e-19
KAFR0A03450 Chr1 complement(708114..710348) [2235 bp, 744 aa] {O...    94   9e-19
TDEL0H01300 Chr8 (221815..223962) [2148 bp, 715 aa] {ON} Anc_1.2...    93   1e-18
SAKL0A00924g Chr1 complement(98231..100150) [1920 bp, 639 aa] {O...    93   1e-18
KNAG0D00300 Chr4 complement(40830..42743) [1914 bp, 637 aa] {ON}...    92   3e-18
TPHA0M01940 Chr13 (401463..403469) [2007 bp, 668 aa] {ON} Anc_6....    92   3e-18
NCAS0A05470 Chr1 (1077464..1079413) [1950 bp, 649 aa] {ON} Anc_6...    92   3e-18
NDAI0K02300 Chr11 (514779..516908) [2130 bp, 709 aa] {ON} Anc_6....    92   4e-18
KAFR0C04690 Chr3 (934039..935928) [1890 bp, 629 aa] {ON} Anc_6.3...    91   5e-18
Ecym_2514 Chr2 (1000911..1002773) [1863 bp, 620 aa] {ON} similar...    89   2e-17
Smik_14.369 Chr14 (653538..655427) [1890 bp, 629 aa] {ON} YNR038...    87   7e-17
TDEL0A07700 Chr1 (1338381..1340264) [1884 bp, 627 aa] {ON} Anc_6...    87   8e-17
YNR038W Chr14 (695595..697484) [1890 bp, 629 aa] {ON}  DBP6Essen...    87   1e-16
Suva_14.394 Chr14 (676747..678666) [1920 bp, 639 aa] {ON} YNR038...    87   1e-16
TBLA0F04210 Chr6 (1034478..1036397) [1920 bp, 639 aa] {ON} Anc_6...    87   1e-16
AGL225C Chr7 complement(275826..277649) [1824 bp, 607 aa] {ON} S...    86   2e-16
CAGL0G07975g Chr7 (752176..754131) [1956 bp, 651 aa] {ON} simila...    85   3e-16
Kwal_23.6387 s23 (1558522..1560468) [1947 bp, 648 aa] {ON} YNR03...    84   6e-16
ZYRO0C12012g Chr3 (936848..938722) [1875 bp, 624 aa] {ON} simila...    83   1e-15
Skud_14.371 Chr14 (663742..665631) [1890 bp, 629 aa] {ON} YNR038...    83   1e-15
KLTH0A07084g Chr1 (587692..589578) [1887 bp, 628 aa] {ON} simila...    82   3e-15
AFR452C Chr6 complement(1250342..1251203) [862 bp, 287.333333333...    74   1e-13
Agos_YGOB_AFR452C Chr6 complement(1250310..1251203) [894 bp, 298...    74   1e-13
NCAS0D04130 Chr4 (779645..781408) [1764 bp, 587 aa] {ON} Anc_6.223     73   2e-12
Suva_114.1 Chr114 complement(3..506) [504 bp, 168 aa] {ON} YKR05...    66   1e-11
Kwal_56.22974 s56 (352370..352837) [468 bp, 155 aa] {OFF} YPL119...    64   6e-11
Kpol_1002.46 s1002 (135310..136929) [1620 bp, 539 aa] {ON} (1353...    68   7e-11
AFL102W Chr6 (247419..249083) [1665 bp, 554 aa] {ON} Syntenic ho...    67   9e-11
Smik_7.216 Chr7 complement(376052..377737) [1686 bp, 561 aa] {ON...    67   1e-10
SAKL0A04224g Chr1 (394175..395896) [1722 bp, 573 aa] {ON} simila...    67   2e-10
NDAI0I00790 Chr9 complement(175765..177567) [1803 bp, 600 aa] {O...    67   2e-10
KLTH0H03960g Chr8 (361653..363323) [1671 bp, 556 aa] {ON} simila...    65   4e-10
YGL064C Chr7 complement(381523..383208) [1686 bp, 561 aa] {ON}  ...    64   9e-10
Ecym_2193 Chr2 (379905..381545) [1641 bp, 546 aa] {ON} similar t...    64   1e-09
Suva_7.205 Chr7 complement(374687..376435) [1749 bp, 582 aa] {ON...    64   1e-09
Skud_7.216 Chr7 complement(384838..386586) [1749 bp, 582 aa] {ON...    64   2e-09
CAGL0M05753g Chr13 complement(610837..612543) [1707 bp, 568 aa] ...    63   2e-09
TDEL0E05320 Chr5 complement(973951..975570) [1620 bp, 539 aa] {O...    63   2e-09
KLLA0B02310g Chr2 (205046..206800) [1755 bp, 584 aa] {ON} simila...    61   9e-09
Kwal_56.24094 s56 complement(846901..848571) [1671 bp, 556 aa] {...    61   9e-09
TPHA0J02440 Chr10 complement(537553..539259) [1707 bp, 568 aa] {...    61   1e-08
KAFR0K02330 Chr11 complement(477370..478992) [1623 bp, 540 aa] {...    61   1e-08
TBLA0A06180 Chr1 (1518694..1520301) [1608 bp, 535 aa] {ON} Anc_6...    60   1e-08
ZYRO0E07040g Chr5 complement(532475..534094) [1620 bp, 539 aa] {...    60   2e-08
Kpol_1009.3 s1009 complement(4730..6169) [1440 bp, 479 aa] {ON} ...    59   5e-08
KNAG0F01930 Chr6 (371697..373379) [1683 bp, 560 aa] {ON} Anc_6.2...    52   7e-06
Suva_2.502 Chr2 (888423..890483) [2061 bp, 686 aa] {ON} YDR332W ...    47   2e-04
Kwal_14.2171 s14 (643215..643973) [759 bp, 252 aa] {ON} YOR204W ...    45   3e-04
Skud_4.599 Chr4 (1067036..1069102) [2067 bp, 688 aa] {ON} YDR332...    46   6e-04
YDR332W Chr4 (1131001..1133070) [2070 bp, 689 aa] {ON}  IRC3Puta...    45   7e-04
Kpol_1029.1 s1029 (145..148,407..774) [372 bp, 123 aa] {OFF} (14...    42   0.001
TPHA0H01510 Chr8 (340988..343018) [2031 bp, 676 aa] {ON} Anc_5.3...    44   0.002
Kpol_365.4 s365 (7095..9170) [2076 bp, 691 aa] {ON} (7095..9170)...    44   0.002
KNAG0C05350 Chr3 complement(1044926..1047028) [2103 bp, 700 aa] ...    43   0.005
TBLA0H01810 Chr8 complement(426223..428346) [2124 bp, 707 aa] {O...    43   0.005
KLLA0D12694g Chr4 (1079740..1083843) [4104 bp, 1367 aa] {ON} sim...    42   0.007
Kpol_1018.31 s1018 (87697..91695) [3999 bp, 1332 aa] {ON} (87697...    42   0.009
NDAI0C04460 Chr3 (1012182..1014188) [2007 bp, 668 aa] {ON} Anc_5...    42   0.010
TDEL0E02500 Chr5 complement(483905..485878) [1974 bp, 657 aa] {O...    41   0.012
Kwal_47.19313 s47 complement(1186091..1189306) [3216 bp, 1071 aa...    41   0.014
Smik_4.592 Chr4 (1057406..1059475) [2070 bp, 689 aa] {ON} YDR332...    41   0.016
Smik_9.201 Chr9 complement(333404..336379) [2976 bp, 991 aa] {ON...    41   0.021
Suva_9.211 Chr9 complement(344361..347336) [2976 bp, 991 aa] {ON...    41   0.022
Skud_9.179 Chr9 complement(328238..331216) [2979 bp, 992 aa] {ON...    40   0.023
YIR002C Chr9 complement(357415..360396) [2982 bp, 993 aa] {ON}  ...    40   0.023
CAGL0J01980g Chr10 (196812..199970) [3159 bp, 1052 aa] {ON} simi...    40   0.031
AFL159W Chr6 (134254..137706) [3453 bp, 1150 aa] {ON} Syntenic h...    40   0.034
KLLA0D13552g Chr4 (1167629..1170655) [3027 bp, 1008 aa] {ON} sim...    40   0.037
KLLA0E17095g Chr5 (1519323..1521395) [2073 bp, 690 aa] {ON} simi...    40   0.040
YGL251C Chr7 complement(27921..31426,31579..31636) [3564 bp, 118...    40   0.049
Kwal_55.20938 s55 complement(617612..618622) [1011 bp, 336 aa] {...    39   0.050
TPHA0I02220 Chr9 (496020..499136) [3117 bp, 1038 aa] {ON} Anc_7....    39   0.052
NCAS0F03010 Chr6 (598773..600782) [2010 bp, 669 aa] {ON} Anc_5.3...    39   0.058
KLTH0E03630g Chr5 complement(327367..329385) [2019 bp, 672 aa] {...    39   0.072
KAFR0A07190 Chr1 complement(1453748..1457704) [3957 bp, 1318 aa]...    39   0.084
NDAI0B01020 Chr2 (236444..239377) [2934 bp, 977 aa] {ON} Anc_7.1...    39   0.098
NCAS0A13190 Chr1 complement(2593419..2596559) [3141 bp, 1046 aa]...    38   0.12 
Kwal_55.20185 s55 complement(286058..288073) [2016 bp, 671 aa] {...    38   0.13 
NCAS0E00200 Chr5 complement(26080..29448) [3369 bp, 1122 aa] {ON...    38   0.14 
Kpol_328.1 s328 complement(673..3711) [3039 bp, 1012 aa] {ON} co...    38   0.15 
KLTH0F13310g Chr6 complement(1090990..1094076) [3087 bp, 1028 aa...    38   0.15 
SAKL0A02904g Chr1 (263239..267465) [4227 bp, 1408 aa] {ON} simil...    38   0.18 
TBLA0E00120 Chr5 complement(11340..15049,15149..15332) [3894 bp,...    38   0.18 
YMR190C Chr13 complement(640915..645258) [4344 bp, 1447 aa] {ON}...    38   0.20 
TBLA0A02320 Chr1 complement(559955..564205) [4251 bp, 1416 aa] {...    37   0.21 
Ecym_2138 Chr2 (256787..260971) [4185 bp, 1394 aa] {ON} similar ...    37   0.23 
CAGL0L00407g Chr12 (42659..46774) [4116 bp, 1371 aa] {ON} simila...    37   0.27 
Kwal_56.24359 s56 complement(966614..970789) [4176 bp, 1391 aa] ...    37   0.27 
Suva_7.10 Chr7 complement(22345..22614,22645..25886,26044..26101...    37   0.28 
TPHA0G03720 Chr7 (787108..790563) [3456 bp, 1151 aa] {ON} Anc_3....    37   0.31 
Ecym_8005 Chr8 (9383..11551) [2169 bp, 722 aa] {ON} similar to A...    37   0.32 
Kwal_23.4187 s23 (607525..611301) [3777 bp, 1258 aa] {ON} YLR398...    37   0.37 
KNAG0F01640 Chr6 (294524..298645) [4122 bp, 1373 aa] {ON} Anc_6....    37   0.38 
NDAI0I03300 Chr9 (771772..771820,771929..775467) [3588 bp, 1195 ...    37   0.41 
SAKL0G08228g Chr7 complement(700095..702248) [2154 bp, 717 aa] {...    36   0.46 
TDEL0H03170 Chr8 complement(522372..525392) [3021 bp, 1006 aa] {...    36   0.54 
KAFR0K01070 Chr11 (221301..224285) [2985 bp, 994 aa] {ON} Anc_7....    36   0.56 
KAFR0D04360 Chr4 complement(858295..860295) [2001 bp, 666 aa] {O...    36   0.60 
Smik_7.10 Chr7 complement(22625..26133,26293..26350) [3567 bp, 1...    36   0.63 
ZYRO0B12650g Chr2 complement(1017101..1020862) [3762 bp, 1253 aa...    36   0.63 
TBLA0J01920 Chr10 (455227..458469) [3243 bp, 1080 aa] {ON} Anc_7...    36   0.67 
ZYRO0B11858g Chr2 complement(943407..949874) [6468 bp, 2155 aa] ...    36   0.69 
Smik_13.395 Chr13 complement(625338..629669) [4332 bp, 1443 aa] ...    36   0.70 
NCAS0G01110 Chr7 (196418..199387) [2970 bp, 989 aa] {ON} Anc_6.278     36   0.72 
Ecym_4473 Chr4 (962193..965228) [3036 bp, 1011 aa] {ON} similar ...    35   0.80 
SAKL0F00528g Chr6 complement(46584..50141) [3558 bp, 1185 aa] {O...    35   0.86 
KAFR0A05880 Chr1 (1191511..1195341) [3831 bp, 1276 aa] {ON} Anc_...    35   1.0  
KNAG0E03530 Chr5 (705077..708016) [2940 bp, 979 aa] {ON} Anc_7.1...    35   1.1  
KNAG0D00680 Chr4 complement(102336..104981) [2646 bp, 881 aa] {O...    35   1.2  
ZYRO0G03938g Chr7 (318186..321206) [3021 bp, 1006 aa] {ON} simil...    35   1.2  
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    35   1.3  
NDAI0J02330 Chr10 complement(564963..568895) [3933 bp, 1310 aa] ...    35   1.4  
KLTH0G14278g Chr7 (1236981..1243502) [6522 bp, 2173 aa] {ON} sim...    35   1.4  
SAKL0F04532g Chr6 (365436..368558) [3123 bp, 1040 aa] {ON} simil...    35   1.4  
KAFR0F01050 Chr6 (198407..201028) [2622 bp, 873 aa] {ON} Anc_6.2...    35   1.5  
Ecym_3516 Chr3 (965847..972317) [6471 bp, 2156 aa] {ON} similar ...    35   1.8  
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    34   1.8  
TBLA0A06360 Chr1 (1561496..1565389) [3894 bp, 1297 aa] {ON} Anc_...    34   1.9  
NCAS0J01560 Chr10 complement(276723..280619) [3897 bp, 1298 aa] ...    34   1.9  
Kpol_1055.74 s1055 (201332..205156) [3825 bp, 1274 aa] {ON} (201...    34   2.0  
TPHA0B02170 Chr2 (503118..506930) [3813 bp, 1270 aa] {ON} Anc_4....    34   2.0  
Skud_7.16 Chr7 complement(32020..35516,35674..35731) [3555 bp, 1...    34   2.0  
KLTH0D14630g Chr4 complement(1193537..1197340) [3804 bp, 1267 aa...    34   2.3  
TDEL0E01090 Chr5 (222389..226162) [3774 bp, 1257 aa] {ON} Anc_4....    34   2.7  
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    33   2.8  
NDAI0B02280 Chr2 complement(567453..574025) [6573 bp, 2190 aa] {...    34   3.0  
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    33   3.1  
Ecym_2529 Chr2 complement(1029384..1031567) [2184 bp, 727 aa] {O...    33   3.2  
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    33   3.4  
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    33   3.4  
KLLA0B03179g Chr2 (289199..292204) [3006 bp, 1001 aa] {ON} simil...    33   4.1  
YLR398C Chr12 complement(915156..919019) [3864 bp, 1287 aa] {ON}...    33   4.8  
AER067C Chr5 complement(757163..761011) [3849 bp, 1282 aa] {ON} ...    33   4.9  
Suva_10.515 Chr10 complement(880776..884624) [3849 bp, 1282 aa] ...    33   4.9  
Skud_12.483 Chr12 complement(855363..859226) [3864 bp, 1287 aa] ...    33   5.9  
Smik_12.485 Chr12 complement(853862..857722) [3861 bp, 1286 aa] ...    33   6.2  
NCAS0B04870 Chr2 complement(888985..894936) [5952 bp, 1983 aa] {...    33   6.5  
ADR302W Chr4 (1227985..1230060) [2076 bp, 691 aa] {ON} Syntenic ...    32   7.4  
KNAG0A02330 Chr1 (219856..222081) [2226 bp, 741 aa] {ON} Anc_8.4...    32   7.8  
Kwal_23.4010 s23 complement(525504..528128) [2625 bp, 874 aa] {O...    32   8.4  
ZYRO0D10802g Chr4 (911004..912956) [1953 bp, 650 aa] {ON} simila...    32   8.8  
CAGL0M01276g Chr13 complement(144593..146641) [2049 bp, 682 aa] ...    32   8.9  
Ecym_6004 Chr6 complement(9579..12797) [3219 bp, 1072 aa] {ON} s...    32   9.3  

>NDAI0G02870 Chr7 (664526..667501) [2976 bp, 991 aa] {ON} 
          Length = 991

 Score = 1783 bits (4619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 887/991 (89%), Positives = 887/991 (89%)

Query: 1   MALKEKRTRDTAVDSSDSENXXXXXXXXXXXXLNXXXXXXXXXXXXNEDVQDVIDYSDSE 60
           MALKEKRTRDTAVDSSDSEN            LN            NEDVQDVIDYSDSE
Sbjct: 1   MALKEKRTRDTAVDSSDSENDAADFDIATDIALNASDSDDASSDSDNEDVQDVIDYSDSE 60

Query: 61  HQQEDNKIARKEKQKKQDIDKSFPILELXXXXXXXXXXXXXXXXXXXXXXXXINAYFSTT 120
           HQQEDNKIARKEKQKKQDIDKSFPILEL                        INAYFSTT
Sbjct: 61  HQQEDNKIARKEKQKKQDIDKSFPILELSDDEDTKKKSNSKNNGSDNDDDDDINAYFSTT 120

Query: 121 NLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGK 180
           NLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGK
Sbjct: 121 NLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGK 180

Query: 181 TAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSL 240
           TAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSL
Sbjct: 181 TAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSL 240

Query: 241 EDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLA 300
           EDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLA
Sbjct: 241 EDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLA 300

Query: 301 SLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREAN 360
           SLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREAN
Sbjct: 301 SLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREAN 360

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
           LLYLLQDVIKIPLATKEQQRKFNDQ                            ERLPPAN
Sbjct: 361 LLYLLQDVIKIPLATKEQQRKFNDQNKKDNESDSDADDNNNNNKNKKKRKFKKERLPPAN 420

Query: 421 QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480
           QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV
Sbjct: 421 QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480

Query: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXX 540
           VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS          
Sbjct: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSESELPYLLDL 540

Query: 541 XXXXGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPKIAYTDRLILGSAPRLEVEGLG 600
               GKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPKIAYTDRLILGSAPRLEVEGLG
Sbjct: 541 ELFLGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPKIAYTDRLILGSAPRLEVEGLG 600

Query: 601 DLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESLKRSKEIIASGWDEQNVLFGKN 660
           DLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESLKRSKEIIASGWDEQNVLFGKN
Sbjct: 601 DLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESLKRSKEIIASGWDEQNVLFGKN 660

Query: 661 QEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQLAPIQRKARERKELLQME 720
           QEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQLAPIQRKARERKELLQME
Sbjct: 661 QEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQLAPIQRKARERKELLQME 720

Query: 721 KMAGLTHSVEDEILKGDDNEAGYSVSEDTLKQQFQDADELLADQENXXXXXXXXXXXXXX 780
           KMAGLTHSVEDEILKGDDNEAGYSVSEDTLKQQFQDADELLADQEN              
Sbjct: 721 KMAGLTHSVEDEILKGDDNEAGYSVSEDTLKQQFQDADELLADQENKSKKDKKSKKSFKD 780

Query: 781 PNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQVHKQTAMVKWDKKRKKY 840
           PNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQVHKQTAMVKWDKKRKKY
Sbjct: 781 PNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQVHKQTAMVKWDKKRKKY 840

Query: 841 VNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKPLKVGARETTIPSNILANPTN 900
           VNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKPLKVGARETTIPSNILANPTN
Sbjct: 841 VNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKPLKVGARETTIPSNILANPTN 900

Query: 901 GSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKALANGIQVRGYGNAPGMSN 960
           GSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKALANGIQVRGYGNAPGMSN
Sbjct: 901 GSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKALANGIQVRGYGNAPGMSN 960

Query: 961 ELKSTEQIMKDRNVKENKRAKNARPSKRRKF 991
           ELKSTEQIMKDRNVKENKRAKNARPSKRRKF
Sbjct: 961 ELKSTEQIMKDRNVKENKRAKNARPSKRRKF 991

>NCAS0C03530 Chr3 (703955..706888) [2934 bp, 977 aa] {ON} Anc_3.159
          Length = 977

 Score = 1423 bits (3683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 715/943 (75%), Positives = 793/943 (84%), Gaps = 20/943 (2%)

Query: 50  VQDVIDYSDSEHQQEDNKIARKEKQKKQDIDKSFPILELXXXXXXXXXXXXXXXXXXXXX 109
           VQDVI+YSD E + +     +K   K ++  KSFP LEL                     
Sbjct: 54  VQDVIEYSDDETETKKKNDKKKNNNKTKED-KSFPSLELSDDEADRRNNEDEDDD----- 107

Query: 110 XXXINAYFSTTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRD 169
              +NAYFSTTNL+KSKHKKGSFPSFGLSK I++NIT++GFRQPTPIQRKTIPLILQNRD
Sbjct: 108 ---VNAYFSTTNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRD 164

Query: 170 IVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQL 229
           IVGMARTGSGKTAAFILPMI K+KTHS KIGARAVILSPSRELAMQTHNVFK+FSKGTQL
Sbjct: 165 IVGMARTGSGKTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQL 224

Query: 230 RSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEM 289
           RSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEM+LDLKSIEYAVFDEADRLFEM
Sbjct: 225 RSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEM 284

Query: 290 GFQDQLNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLF 349
           GFQ+QLNELLASLPS+RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAE+KISENLEMLF
Sbjct: 285 GFQEQLNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLF 344

Query: 350 LSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXX 409
           LSTKNDEREANLLYLLQ+VIKIPLA+++Q  KFN Q                        
Sbjct: 345 LSTKNDEREANLLYLLQEVIKIPLASRDQLAKFNAQ-NIKDNASDSDSDGDDKRQKGKRK 403

Query: 410 XXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLY 469
               ERLPPANQLPSEK+TILFVPTRHHVEYIS LL++SGYLISYIYGTLDQHARKRQLY
Sbjct: 404 KFKKERLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLY 463

Query: 470 NFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           NFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIF+HRVGRTARAGNRGWAYSIV
Sbjct: 464 NFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIV 523

Query: 530 SXXXXXXXXXXXXXXGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPKIAYTDRLILG 589
           S              GKKI++TPMYDS+ +IM  KWIAEG+DE +F  PK++YT+R+ILG
Sbjct: 524 SESELPYLLDLEIFLGKKILMTPMYDSMSDIMLKKWIAEGHDEINFKPPKVSYTNRMILG 583

Query: 590 SAPRLEVEGLGDLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESLKRSKEIIASG 649
           SAPRLE+EGLGDLY+N+M++NFE++L+K VAMKAEKLYFRTR +ASPESLKRSKEIIASG
Sbjct: 584 SAPRLELEGLGDLYQNVMKSNFEIQLLKGVAMKAEKLYFRTRPAASPESLKRSKEIIASG 643

Query: 650 WDEQNVLFGKNQEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQLAPIQRK 709
           WDEQN++FGKN EKEKLDFLAKLQNRRNKETVFEF+ NPDDEMSVFMKRRRRQLAPIQRK
Sbjct: 644 WDEQNIMFGKNAEKEKLDFLAKLQNRRNKETVFEFASNPDDEMSVFMKRRRRQLAPIQRK 703

Query: 710 ARERKELLQMEKMAGLTHSVEDEILKGDDNE-AGYSVSEDTLKQQFQDADELLADQENXX 768
           A+ER ELLQ EK+AGLTH++EDE+LKGD+ E   Y++SEDTLK QF+D DELLA QEN  
Sbjct: 704 AKERHELLQKEKLAGLTHTMEDEVLKGDNAEDNSYTISEDTLK-QFEDGDELLAGQEN-- 760

Query: 769 XXXXXXXXXXXXPNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQVHKQT 828
                       P FFLSHYAPA DIQDKQL++  GF N+AA+ AYDLNNDDKVQVHKQT
Sbjct: 761 ---KKKKKTFKDPTFFLSHYAPASDIQDKQLQVANGFANEAAQAAYDLNNDDKVQVHKQT 817

Query: 829 AMVKWDKKRKKYVNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKPLKVGARET 888
           A VKWDKKRKKYVN QGLDNKKYIIGE GQKIAASFRSGKFDEW K RK+KPLKVGARE+
Sbjct: 818 ATVKWDKKRKKYVNVQGLDNKKYIIGESGQKIAASFRSGKFDEWTKARKLKPLKVGARES 877

Query: 889 TIPSNILANPTNGSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKALANGIQ 948
           +IPSN+L++PT G  G+Q N++RGKFKHKQ+KAPK+PDKHRDDY  QKKKV KAL NG+Q
Sbjct: 878 SIPSNLLSDPTQGP-GAQ-NSVRGKFKHKQLKAPKLPDKHRDDYQTQKKKVAKALENGVQ 935

Query: 949 VRGYGNAPGMSNELKSTEQIMKDRNVKENKRAKNARPSKRRKF 991
           VRG+   PGM +ELKSTE+I K R   E KRAKNARP+KRRK+
Sbjct: 936 VRGF-RGPGMKSELKSTEEIRKQRAFMEKKRAKNARPAKRRKY 977

>YDL031W Chr4 (394217..397204) [2988 bp, 995 aa] {ON}  DBP10Putative
           ATP-dependent RNA helicase of the DEAD-box protein
           family, constituent of 66S pre-ribosomal particles;
           essential protein involved in ribosome biogenesis
          Length = 995

 Score = 1394 bits (3608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 678/948 (71%), Positives = 777/948 (81%), Gaps = 13/948 (1%)

Query: 49  DVQDVIDYSDSEHQQEDNK-----IARKEKQKKQDIDKSFPILELXXXXXXXXXXXXXXX 103
           DVQDVI+YS  E +  +NK        K+K+  +    +FP+LE+               
Sbjct: 56  DVQDVIEYSSDEEEGVNNKKKAENKDIKKKKNSKKEIAAFPMLEMSDDENNASGKTQTGD 115

Query: 104 XXXXXXXXXINAYFSTTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPL 163
                    +N YFST NLEK+KHKKGSFPSFGLSKI++ NI ++GFRQPTPIQRKTIPL
Sbjct: 116 DEDD-----VNEYFSTNNLEKTKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPL 170

Query: 164 ILQNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEF 223
           ILQ+RDIVGMARTGSGKTAAFILPM+ K+K+HS KIGARAVILSPSRELAMQT NVFK+F
Sbjct: 171 ILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDF 230

Query: 224 SKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEA 283
           ++GT+LRSVLLTGGDSLE+QFGMMM NPDVIIATPGRFLHLKVEM+LDLKS+EY VFDEA
Sbjct: 231 ARGTELRSVLLTGGDSLEEQFGMMMTNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEA 290

Query: 284 DRLFEMGFQDQLNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISE 343
           DRLFEMGFQ+QLNELLASLP+ RQTLLFSATLP+SLVDF KAGL NPVLVRLDAE+K+SE
Sbjct: 291 DRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSE 350

Query: 344 NLEMLFLSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXX 403
           NLEMLFLS+KN +REANLLY+LQ++IKIPLAT EQ +K  +                   
Sbjct: 351 NLEMLFLSSKNADREANLLYILQEIIKIPLATSEQLQKLQNSNNEADSDSDDENDRQKKR 410

Query: 404 XXXXXXXXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHA 463
                     +++P AN+LPSEKATILFVPTRHHVEYISQLL+D GYLISYIYGTLDQHA
Sbjct: 411 RNFKKEKFRKQKMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHA 470

Query: 464 RKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRG 523
           RKRQLYNFR GLTSILVVTDVAARGVDIPMLANVIN++LP SSKIF+HRVGRTARAGN+G
Sbjct: 471 RKRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKG 530

Query: 524 WAYSIVSXXXXXXXXXXXXXXGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPKIAYT 583
           WAYSIV+              GKKI+LTPMYDSL ++MK +WI EG  E  F  PK++YT
Sbjct: 531 WAYSIVAENELPYLLDLELFLGKKILLTPMYDSLVDVMKKRWIDEGKPEYQFQPPKLSYT 590

Query: 584 DRLILGSAPRLEVEGLGDLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESLKRSK 643
            RL+LGS PRL+VEGLGDLYKN+M +NF+L+L K  AMKAEKLY+RTRTSASPESLKRSK
Sbjct: 591 KRLVLGSCPRLDVEGLGDLYKNLMSSNFDLQLAKKTAMKAEKLYYRTRTSASPESLKRSK 650

Query: 644 EIIASGWDEQNVLFGKNQEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQL 703
           EII+SGWD QN  FGKN+EKEKLDFLAKLQNRRNKETVFEF+RNPDDEM+VFMKRRR+QL
Sbjct: 651 EIISSGWDAQNAFFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVFMKRRRKQL 710

Query: 704 APIQRKARERKELLQMEKMAGLTHSVEDEILKGDDNEAGYSVSEDTLKQQFQDADELLAD 763
           APIQRKA ER+ELL+ E+MAGL+HS+EDEILKGDD E GY+VSED LK +F+DAD+LL  
Sbjct: 711 APIQRKATERRELLEKERMAGLSHSIEDEILKGDDGETGYTVSEDALK-EFEDADQLLEA 769

Query: 764 QENXXXXXXXXXXXXXXPNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQ 823
           QEN              P FFLSHYAPAGDIQDKQL++T GF NDAA+ AYDLN+DDKVQ
Sbjct: 770 QEN-ENKKKKKPKSFKDPTFFLSHYAPAGDIQDKQLQITNGFANDAAQAAYDLNSDDKVQ 828

Query: 824 VHKQTAMVKWDKKRKKYVNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKPLKV 883
           VHKQTA VKWDKKRKKYVNTQG+DNKKYIIGE GQKIAASFRSG+FD+W+K R +KPLKV
Sbjct: 829 VHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKV 888

Query: 884 GARETTIPSNILANPTNGSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKAL 943
           G+RET+IPSN+L +P+ G   + G T+RGKFKHKQMKAPKMPDKHRD+Y+ QKKKVEKAL
Sbjct: 889 GSRETSIPSNLLEDPSQGP-AANGRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVEKAL 947

Query: 944 ANGIQVRGYGNAPGMSNELKSTEQIMKDRNVKENKRAKNARPSKRRKF 991
            +GI V+GY NAPG+ +ELKSTEQI KDR + E KRAKNARPSK+RKF
Sbjct: 948 QSGISVKGYNNAPGLRSELKSTEQIRKDRIIAEKKRAKNARPSKKRKF 995

>Smik_4.204 Chr4 (374339..377335) [2997 bp, 998 aa] {ON} YDL031W
           (REAL)
          Length = 998

 Score = 1389 bits (3596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 676/952 (71%), Positives = 776/952 (81%), Gaps = 18/952 (1%)

Query: 49  DVQDVIDYSDSEHQQEDNKIAR---------KEKQKKQDIDKSFPILELXXXXXXXXXXX 99
           DVQD+I+YS  + ++      +         K K  K+++  +FPILEL           
Sbjct: 56  DVQDIIEYSSDDEEEGKKSNKKKKTNDKKPGKNKHNKKEV-AAFPILELSDDENNISGQT 114

Query: 100 XXXXXXXXXXXXXINAYFSTTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRK 159
                        +N YFST NLEK KHKKGSFPSFGLSKI++ NI ++GFRQPTPIQRK
Sbjct: 115 QAGEEEDD-----VNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRK 169

Query: 160 TIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNV 219
           TIPLILQ+RDIVGMARTGSGKTAAFILPM+ K+K+HS KIGARAVILSPSRELAMQT NV
Sbjct: 170 TIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNV 229

Query: 220 FKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAV 279
           FK+F++GT+LRSVLLTGGDSLE+QF MMM+NPDVIIATPGRFLHLKVEM+LDLKS+EY V
Sbjct: 230 FKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVV 289

Query: 280 FDEADRLFEMGFQDQLNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAES 339
           FDEADRLFEMGFQ+QLNELLASLP+ RQTLLFSATLP+SLVDF KAGL NPVLVRLDAE+
Sbjct: 290 FDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAET 349

Query: 340 KISENLEMLFLSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXX 399
           K+SENLEMLFLS+KN +REANLLY+LQ+VI+IPLAT EQ  K                  
Sbjct: 350 KVSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQKSTNEADSDSDDENDR 409

Query: 400 XXXXXXXXXXXXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTL 459
                         +++P AN+LPSEKATILFVPTRHHVEYISQLL+D GYLISYIYGTL
Sbjct: 410 QKKKINFKKEKFRKQKMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTL 469

Query: 460 DQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARA 519
           DQHARK QLYNFR GLTSILVVTDVAARGVDIPMLANVIN++LP SSKIF+HRVGRTARA
Sbjct: 470 DQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARA 529

Query: 520 GNRGWAYSIVSXXXXXXXXXXXXXXGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPK 579
           GN+GWAYSIV+              GKKI+LTPMYDSL ++MK +W+ EGN   +F  PK
Sbjct: 530 GNKGWAYSIVAENELPYLLDLELFLGKKILLTPMYDSLVDVMKKRWVEEGNSAYNFQLPK 589

Query: 580 IAYTDRLILGSAPRLEVEGLGDLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESL 639
           ++YT RL+LGS PRL+VEGLGDLYKN+M +NF+L+L K  AMKAEKLY+RTRTSASPESL
Sbjct: 590 LSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKAEKLYYRTRTSASPESL 649

Query: 640 KRSKEIIASGWDEQNVLFGKNQEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRR 699
           KRSKEIIASGWD QN  FGKN+EKEKLDFLAKLQNRRNKETVFEF+RNPDDEM+VFMKRR
Sbjct: 650 KRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVFMKRR 709

Query: 700 RRQLAPIQRKARERKELLQMEKMAGLTHSVEDEILKGDDNEAGYSVSEDTLKQQFQDADE 759
           R+QLAPIQRKA ER+ELL+ E+MAGL+HS+EDEILKGDD E GY+VSED LK  F+DAD+
Sbjct: 710 RKQLAPIQRKATERRELLEKERMAGLSHSIEDEILKGDDGETGYTVSEDALK-NFEDADQ 768

Query: 760 LLADQENXXXXXXXXXXXXXXPNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNND 819
           LL  QEN              P FFLSHYAPAG+IQDKQL++T GF NDAA+ AYDLN+D
Sbjct: 769 LLEAQEN-ESKKKKKPKTFKDPTFFLSHYAPAGEIQDKQLQITNGFANDAAQAAYDLNSD 827

Query: 820 DKVQVHKQTAMVKWDKKRKKYVNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMK 879
           DKVQVHKQTA VKWDKKRKKYVNTQG+DNKKYIIGE GQKIAASFRSG+FD+W+K R +K
Sbjct: 828 DKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLK 887

Query: 880 PLKVGARETTIPSNILANPTNGSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKV 939
           PLKVG+RE++IPSN+L +P+ G+ GS G T+RGKFKHKQMKAPKMPDKHRD+Y+ QKKKV
Sbjct: 888 PLKVGSRESSIPSNLLQDPSQGT-GSNGRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKV 946

Query: 940 EKALANGIQVRGYGNAPGMSNELKSTEQIMKDRNVKENKRAKNARPSKRRKF 991
           +KAL +GI V+GY NAPG+ NELKSTEQI KDRN+ E KRAKNARPSK+RKF
Sbjct: 947 DKALQSGISVKGYNNAPGLRNELKSTEQIRKDRNMAEKKRAKNARPSKKRKF 998

>Suva_4.218 Chr4 (384623..387646) [3024 bp, 1007 aa] {ON} YDL031W
            (REAL)
          Length = 1007

 Score = 1371 bits (3548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 653/879 (74%), Positives = 747/879 (84%), Gaps = 3/879 (0%)

Query: 113  INAYFSTTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVG 172
            +N YFSTTNLEK+KHKKGSFPSFGLSKI++ NI ++GFRQPTPIQRKTIPLILQ+RDIVG
Sbjct: 132  VNEYFSTTNLEKTKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVG 191

Query: 173  MARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSV 232
            MARTGSGKTAAFILPM+ K+K+HS KIGARAVILSPSRELAMQT NVFKEF++GT LRSV
Sbjct: 192  MARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKEFARGTALRSV 251

Query: 233  LLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQ 292
            LLTGGDSLE+QF MMM+NPDVIIATPGRFLHLKVEM+LDLKS+EY VFDEADRLFEMGFQ
Sbjct: 252  LLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQ 311

Query: 293  DQLNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLST 352
            +QLNELLASLP+ RQTLLFSATLP+SLVDF KAGL NPVLVRLD E+K+SENLEMLF+ST
Sbjct: 312  EQLNELLASLPTARQTLLFSATLPNSLVDFVKAGLVNPVLVRLDTETKVSENLEMLFVST 371

Query: 353  KNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXX 412
            KND+REANLLY+LQ+VIKIPLAT EQ +K                               
Sbjct: 372  KNDDREANLLYILQEVIKIPLATSEQLQKLQKSNNEADSESDDDNDRQKKRKNFKKEKFR 431

Query: 413  XERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFR 472
             +R+P  N+LPSEKATILFVPTRHHVEYISQLL+D G+LISYIYGTLDQHARKRQLYNFR
Sbjct: 432  KQRMPGGNELPSEKATILFVPTRHHVEYISQLLRDCGFLISYIYGTLDQHARKRQLYNFR 491

Query: 473  TGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXX 532
             GLTSILVVTDVAARGVDIPMLANVIN++LP SSKIF+HRVGRTARAGN+GWAYSIV+  
Sbjct: 492  AGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAEN 551

Query: 533  XXXXXXXXXXXXGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPKIAYTDRLILGSAP 592
                        GKKI+L PMYDSL  +MK +W+ EG  E +F  P ++YT RL+LGS P
Sbjct: 552  ELPYLLDLELFLGKKILLAPMYDSLAGLMKKRWVDEGKPEYTFQPPTLSYTKRLVLGSCP 611

Query: 593  RLEVEGLGDLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESLKRSKEIIASGWDE 652
            RL+VEGLGDLYKN+M +NF+L+L K  A+KAE+LY+RTRT+ASPESLKRSKEIIASGWD 
Sbjct: 612  RLDVEGLGDLYKNLMTSNFDLQLAKKTALKAEQLYYRTRTAASPESLKRSKEIIASGWDA 671

Query: 653  QNVLFGKNQEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQLAPIQRKARE 712
            QN  FGKN+EKEKLDFLAKLQNRRNKETVFEF+RNPDDEMSV MKRRR+QLAPIQRK+RE
Sbjct: 672  QNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMSVLMKRRRKQLAPIQRKSRE 731

Query: 713  RKELLQMEKMAGLTHSVEDEILKGDDNEAGYSVSEDTLKQQFQDADELLADQENXXXXXX 772
            R+ELL+ E+MAGL+HS+EDEILKG+D E GY++SED LK +F+DAD+LL  QEN      
Sbjct: 732  RRELLEKERMAGLSHSIEDEILKGNDGETGYTISEDALK-EFEDADQLLEAQEN-DSKKK 789

Query: 773  XXXXXXXXPNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQVHKQTAMVK 832
                    P+FFLSHYAPAG+IQDKQLE+T GF NDAA  AYDLN DDKVQVHKQTA VK
Sbjct: 790  KKPKTFKDPSFFLSHYAPAGEIQDKQLEITGGFANDAAHAAYDLNGDDKVQVHKQTATVK 849

Query: 833  WDKKRKKYVNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKPLKVGARETTIPS 892
            WDKKRKKYVNTQGLDNKKYIIGE GQKIAASFRSG+FD+W+K R +KPLKVG+RE++IPS
Sbjct: 850  WDKKRKKYVNTQGLDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSRESSIPS 909

Query: 893  NILANPTNGSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKALANGIQVRGY 952
            N+LA+P+ G  G++G  +RGKFKHKQMKAPKMPDKHRD+Y+ QKKKVEKAL +G+ VRGY
Sbjct: 910  NLLADPSQGP-GARGGAVRGKFKHKQMKAPKMPDKHRDNYYTQKKKVEKALQSGVNVRGY 968

Query: 953  GNAPGMSNELKSTEQIMKDRNVKENKRAKNARPSKRRKF 991
             NAPG+ +ELKST+QI KDR   + KRAKNARP+K+RKF
Sbjct: 969  NNAPGLRSELKSTDQIRKDRAAADKKRAKNARPTKKRKF 1007

>Skud_4.220 Chr4 (389016..392021) [3006 bp, 1001 aa] {ON} YDL031W
            (REAL)
          Length = 1001

 Score = 1367 bits (3539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 670/955 (70%), Positives = 771/955 (80%), Gaps = 21/955 (2%)

Query: 49   DVQDVIDYSDSEHQQEDNKIARKEKQK------------KQDIDKSFPILELXXXXXXXX 96
            DVQDVI YS  E ++ D+K     K              K+++  +FP LEL        
Sbjct: 56   DVQDVIKYSSDEEREGDSKKKANGKNGKKNKSDNKKKSGKKEV-AAFPTLELSDDENDAS 114

Query: 97   XXXXXXXXXXXXXXXXINAYFSTTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPI 156
                            +N YFSTTNLEK+KHKKGSFPSFGLSK+++ NI ++GFRQPTPI
Sbjct: 115  GKTQADDDEDD-----VNEYFSTTNLEKTKHKKGSFPSFGLSKVVLNNIKRKGFRQPTPI 169

Query: 157  QRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQT 216
            QRKTIPLILQ+RDIVGMARTGSGKTAAFILPM+ K+K+HS KIGARAVILSPSRELAMQT
Sbjct: 170  QRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQT 229

Query: 217  HNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIE 276
             NVFK+F+KGT+LRSVLLTGGDSLE+QF MMM+NPDVIIATPGRFLHLKVEM+LDLKS+E
Sbjct: 230  FNVFKDFAKGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVE 289

Query: 277  YAVFDEADRLFEMGFQDQLNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLD 336
            Y VFDEADRLFEMGFQ+QLNELLASLP+ RQTLLFSATLP+SLVDF KAGL NPVLVRLD
Sbjct: 290  YVVFDEADRLFEMGFQEQLNELLASLPARRQTLLFSATLPNSLVDFVKAGLVNPVLVRLD 349

Query: 337  AESKISENLEMLFLSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXX 396
             E+K+SENLEMLFLS+KN +REANLLY+LQ+VIKIPLAT EQ +K               
Sbjct: 350  TETKVSENLEMLFLSSKNADREANLLYILQEVIKIPLATSEQLQKLQKSNNEADSDSDDE 409

Query: 397  XXXXXXXXXXXXXXXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIY 456
                             +++P AN+LPSE+ATILFVPTRHHVEYISQLL+D GYLISYIY
Sbjct: 410  NDRHKKKRNFKKEKFRKQKMPAANELPSERATILFVPTRHHVEYISQLLRDCGYLISYIY 469

Query: 457  GTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRT 516
            GTLDQHARKRQLYNFR GLTSILVVTDVAARGVDIPMLANVIN++LP SSKIF+HRVGRT
Sbjct: 470  GTLDQHARKRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRT 529

Query: 517  ARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFV 576
            ARAGN+GWAYSIVS              GKKI+L PMYD+L + +K +WI EGN E  F 
Sbjct: 530  ARAGNKGWAYSIVSENELPYLLDLELFLGKKILLAPMYDNLVDSIKKRWIDEGNLEFQFQ 589

Query: 577  NPKIAYTDRLILGSAPRLEVEGLGDLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASP 636
             PK++YT RL+LGS PRL+VEGLGDLYKN+M +NF+L+L    +MKAEKLY+RTRTSASP
Sbjct: 590  PPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAMKTSMKAEKLYYRTRTSASP 649

Query: 637  ESLKRSKEIIASGWDEQNVLFGKNQEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFM 696
            ESLKRSKEIIASGWD QN  FGKN+EKEKLDFLAKLQNRRNKETVFEF+RNPDDEM+V M
Sbjct: 650  ESLKRSKEIIASGWDAQNAFFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVLM 709

Query: 697  KRRRRQLAPIQRKARERKELLQMEKMAGLTHSVEDEILKGDDNEAGYSVSEDTLKQQFQD 756
            KRRR+QLAPIQRKA ER++LL+ E+MAGL+HS+E+EILKGDD E GY+VSE+ LK +F+D
Sbjct: 710  KRRRKQLAPIQRKASERRKLLEKERMAGLSHSIENEILKGDDGETGYTVSEEALK-EFED 768

Query: 757  ADELLADQENXXXXXXXXXXXXXXPNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDL 816
            AD+LL  QEN              P FFLSHYAPAG+IQDKQL++ +GF NDAA  AYDL
Sbjct: 769  ADQLLEAQEN-DSKKKKKPKTFKDPTFFLSHYAPAGEIQDKQLQIASGFANDAAHAAYDL 827

Query: 817  NNDDKVQVHKQTAMVKWDKKRKKYVNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKR 876
            N DDKVQVHKQTA VKWDKKRKKYVNTQG+DNKKYIIGE GQKIAASFRSG+FD+W+K R
Sbjct: 828  NTDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKAR 887

Query: 877  KMKPLKVGARETTIPSNILANPTNGSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQK 936
             +KPLK G+RE++IPSN+LA+P+ G  GS G T RGKFKHKQMKAPKMPDKHRD+Y+ QK
Sbjct: 888  NLKPLKAGSRESSIPSNLLADPSQGP-GSNGRTARGKFKHKQMKAPKMPDKHRDNYYSQK 946

Query: 937  KKVEKALANGIQVRGYGNAPGMSNELKSTEQIMKDRNVKENKRAKNARPSKRRKF 991
            KKVEKAL +G+ V+G+ NAPG+S+ELKSTEQI KDR + E KRAKNARPSK+RKF
Sbjct: 947  KKVEKALQSGVNVKGHNNAPGLSSELKSTEQIRKDRVMAEKKRAKNARPSKKRKF 1001

>CAGL0K01551g Chr11 (136421..139330) [2910 bp, 969 aa] {ON} highly
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031w
          Length = 969

 Score = 1347 bits (3485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 667/942 (70%), Positives = 753/942 (79%), Gaps = 19/942 (2%)

Query: 50  VQDVIDYSDSEHQQEDNKIARKEKQKKQDIDKSFPILELXXXXXXXXXXXXXXXXXXXXX 109
           VQDVI+YS  E +      A K+K +    DKSFP LEL                     
Sbjct: 47  VQDVIEYSSDEEEPAKPAKAVKKKVE----DKSFPSLELSDDEDEKKKVDNDDDDV---- 98

Query: 110 XXXINAYFSTTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRD 169
               NAYFS     KSKHKKGSF SFGLSK+I+ NI+KRGFRQPTPIQRKTIPLILQNRD
Sbjct: 99  ----NAYFSVNTDAKSKHKKGSFASFGLSKLILVNISKRGFRQPTPIQRKTIPLILQNRD 154

Query: 170 IVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQL 229
           IVGMARTGSGKTAAF+LPMI K+KTHSSKIGARA+ILSPSRELAMQTH+VFKEFS+GT L
Sbjct: 155 IVGMARTGSGKTAAFVLPMIEKLKTHSSKIGARAIILSPSRELAMQTHSVFKEFSRGTHL 214

Query: 230 RSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEM 289
           RSVLLTGGDSLEDQFGMMM NPDVIIATPGRFLHLKVEM+LDLKS+EYAVFDEADRLFEM
Sbjct: 215 RSVLLTGGDSLEDQFGMMMTNPDVIIATPGRFLHLKVEMNLDLKSVEYAVFDEADRLFEM 274

Query: 290 GFQDQLNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLF 349
           GFQ+QLNELLA+LPS+RQTLLFSATLP+SLVDFAKAGL NPVLVRLDAESKIS+NLEMLF
Sbjct: 275 GFQEQLNELLAALPSSRQTLLFSATLPTSLVDFAKAGLVNPVLVRLDAESKISDNLEMLF 334

Query: 350 LSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXX 409
           LSTKNDEREANLLY+LQ+VIK+PLAT EQ ++ ND                         
Sbjct: 335 LSTKNDEREANLLYILQEVIKLPLATPEQIKQLNDNKADDSDESAEEDEDKKRRKRKSFN 394

Query: 410 XXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLY 469
                 +P AN+LPSEKAT++FVPTRHHVEY+S LLKD GYL+SYIYG LDQHARK QLY
Sbjct: 395 RKA---MPKANELPSEKATVVFVPTRHHVEYLSNLLKDCGYLVSYIYGALDQHARKSQLY 451

Query: 470 NFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           NFR GLTSILVVTDVAARGVDIPMLANV+N+SLPASSKIFIHRVGRTARAGNRGWAYSIV
Sbjct: 452 NFRIGLTSILVVTDVAARGVDIPMLANVVNYSLPASSKIFIHRVGRTARAGNRGWAYSIV 511

Query: 530 SXXXXXXXXXXXXXXGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPKIAYTDRLILG 589
           S              G+KI+LTPMY++L  + K KW+AEGNDE+ F +PKI+YT R++LG
Sbjct: 512 SENELPYLLDLELFLGRKILLTPMYEALERLSKEKWVAEGNDETLFQSPKISYTSRMVLG 571

Query: 590 SAPRLEVEGLGDLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESLKRSKEIIASG 649
           S PRL++E L +LY N+M++NF+L + K  A+KAEKLYFRTRTSASPESLKRSKEII+SG
Sbjct: 572 SCPRLDIEALSELYNNLMKSNFDLDMAKKTALKAEKLYFRTRTSASPESLKRSKEIISSG 631

Query: 650 WDEQNVLFGKNQEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQLAPIQRK 709
           WDEQNVLFGKN EKEK  FL KLQNRRNKETVFEF+RNP+DEM+  M RRRR +APIQRK
Sbjct: 632 WDEQNVLFGKNLEKEKNAFLEKLQNRRNKETVFEFTRNPEDEMANLMHRRRRAIAPIQRK 691

Query: 710 ARERKELLQMEKMAGLTHSVEDEILKGDDNEAGYSVSEDTLKQQFQDADELLADQENXXX 769
           A+ERKELL+ E+MAGLTH++EDEILKGDD E GY+V+EDTLK  F+DAD +LA+QEN   
Sbjct: 692 AKERKELLEKERMAGLTHALEDEILKGDDAEVGYTVTEDTLK-AFEDADTILAEQEN--- 747

Query: 770 XXXXXXXXXXXPNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQVHKQTA 829
                      PNFFLSHYAPA +IQDKQLEL+ GF+N+AA+ AYDLN+DDKVQVHKQTA
Sbjct: 748 ASKKKKKTFRDPNFFLSHYAPANEIQDKQLELSGGFINEAAQSAYDLNSDDKVQVHKQTA 807

Query: 830 MVKWDKKRKKYVNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKPLKVGARETT 889
            VKWDKKRKKYVN  G+DNKKYIIGE GQKIAASFRSGKFDEW+K RK+ PLK GA E++
Sbjct: 808 TVKWDKKRKKYVNMNGIDNKKYIIGESGQKIAASFRSGKFDEWSKARKLAPLKTGANESS 867

Query: 890 IPSNILANPTNGSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKALANGIQV 949
           IPSN+L +PT G   S      GKFKHK  KAP++PDK RDDYH QKKKVE AL  GI V
Sbjct: 868 IPSNLLVDPTRGPGKSGSKLPNGKFKHKLEKAPRLPDKKRDDYHKQKKKVESALERGIAV 927

Query: 950 RGYGNAPGMSNELKSTEQIMKDRNVKENKRAKNARPSKRRKF 991
           +GY NAP   +ELKS  QI KDR  KEN+ AKNARPSK+RKF
Sbjct: 928 KGYNNAPAFKSELKSVAQIRKDRKTKENRHAKNARPSKKRKF 969

>KAFR0C01060 Chr3 complement(215822..218743) [2922 bp, 973 aa] {ON}
           Anc_3.159 YDL031W
          Length = 973

 Score = 1341 bits (3470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 667/945 (70%), Positives = 762/945 (80%), Gaps = 22/945 (2%)

Query: 49  DVQDVIDYSDSEHQQEDNKIARKEKQKKQDIDKSFPILELXXXXXXXXXXXXXXXXXXXX 108
           +V+D+I YSD E  Q +    + +K+KK   D  FP+LEL                    
Sbjct: 49  EVEDIISYSDDEKSQVEEVPKKSKKEKKVIKD--FPLLELSDDEDSKKQANDNDDD---- 102

Query: 109 XXXXINAYFSTTNLE-KSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQN 167
               +N+YFST NL  K+KHKKGSF SFGLSK+I+TNI+KRGFRQPTPIQRKTIPLILQ+
Sbjct: 103 ----VNSYFSTNNLNTKTKHKKGSFASFGLSKLILTNISKRGFRQPTPIQRKTIPLILQS 158

Query: 168 RDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT 227
           RDIVGMARTGSGKTAAF+LPMI K+KTHSSKIGARA+ILSPSRELAMQTHNVFKEFSKG+
Sbjct: 159 RDIVGMARTGSGKTAAFVLPMIEKLKTHSSKIGARAIILSPSRELAMQTHNVFKEFSKGS 218

Query: 228 QLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF 287
            LRSVLLTGGDSLEDQFGM+M NPDVIIATPGRFLHLKVEM+LDLKS+EY  FDEADRLF
Sbjct: 219 DLRSVLLTGGDSLEDQFGMIMANPDVIIATPGRFLHLKVEMNLDLKSVEYICFDEADRLF 278

Query: 288 EMGFQDQLNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEM 347
           EMGFQ+QLNEL+ SLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLD E+KISENLEM
Sbjct: 279 EMGFQEQLNELIYSLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKISENLEM 338

Query: 348 LFLSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXX 407
           LFLS KN+EREANLLYLLQ+ I IPLAT+EQ +K N++                      
Sbjct: 339 LFLSIKNEEREANLLYLLQEEICIPLATEEQIKKLNNESKIDDDSDSEDDEATRRQKRKS 398

Query: 408 XXXXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQ 467
                 +RLPPANQLPSEKATI+FVPTRHHVEYISQLLKD GYL+SYIYGTLDQ AR RQ
Sbjct: 399 KNFKK-QRLPPANQLPSEKATIIFVPTRHHVEYISQLLKDCGYLVSYIYGTLDQRARNRQ 457

Query: 468 LYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYS 527
           LYNFR GLTSILVVTDVAARGVDIPMLANVINFSLP SSK+F+HRVGRTARAGNRGWAYS
Sbjct: 458 LYNFRLGLTSILVVTDVAARGVDIPMLANVINFSLPVSSKVFVHRVGRTARAGNRGWAYS 517

Query: 528 IVSXXXXXXXXXXXXXXGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPKIAYTDRLI 587
           IVS              GKKI+LT MYD+ C+IMK KW++EG  E +F +PK +YT+R++
Sbjct: 518 IVSENELPYLLDLELFLGKKILLTSMYDATCDIMKKKWVSEGKSELTFQDPKPSYTNRMV 577

Query: 588 LGSAPRLEVEGLGDLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESLKRSKEIIA 647
           LGSAPRL+VE L DLY  ++  +F+LK++K  A+KAEKLYFRTRTSASPES+KRSKEII 
Sbjct: 578 LGSAPRLQVEDLNDLYTGVLSGSFDLKMMKQTALKAEKLYFRTRTSASPESMKRSKEIIL 637

Query: 648 SGWDEQNVLFGKNQEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQLAPIQ 707
           SGWDEQN+ FGKN EKEK  FLAKLQNR NKETVFEF+RNPDDEMSV MKRRRRQLAPIQ
Sbjct: 638 SGWDEQNIRFGKNVEKEKFQFLAKLQNRHNKETVFEFARNPDDEMSVLMKRRRRQLAPIQ 697

Query: 708 RKARERKELLQMEKMAGLTHSVEDEILKGDDNEAGYSVSEDTLKQQFQDADELLADQENX 767
           RKA ER+EL++ E++AGLTH +ED+ILKGDD EAGY+V ED LK +F+DAD++L      
Sbjct: 698 RKAEERRELMEKERLAGLTHRIEDQILKGDDFEAGYTVPEDALK-EFEDADKVL-----E 751

Query: 768 XXXXXXXXXXXXXPNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQVHKQ 827
                         NFFLSHYAP   IQD+Q +L+TGF N AA+ AYDLN+DDKVQVHKQ
Sbjct: 752 ASNKKSEQKTFRDENFFLSHYAPTSAIQDQQYKLSTGFTNAAAEAAYDLNSDDKVQVHKQ 811

Query: 828 TAMVKWDKKRKKYVNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKPLKVGARE 887
           TA VKWDKKRKKYVN QG+DNKKYI+GE GQKIAASFRSGKF+EW+K RK+KPLKVGARE
Sbjct: 812 TATVKWDKKRKKYVNMQGIDNKKYIVGESGQKIAASFRSGKFEEWSKARKLKPLKVGARE 871

Query: 888 TTIPSNILANPT-NGSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKALANG 946
           +T+ +N+L+NPT N S+G +  T+RGKFKHKQMK+PK+PDK RDDY  QKKKV  ALA G
Sbjct: 872 STMQTNLLSNPTENNSNGQK--TVRGKFKHKQMKSPKLPDKFRDDYEKQKKKVASALARG 929

Query: 947 IQVRGYGNAPGMSNELKSTEQIMKDRNVKENKRAKNARPSKRRKF 991
             V+GY + PGM NELKSTEQI K+R  KEN+RAKNARPSK+RKF
Sbjct: 930 AHVKGY-SGPGMKNELKSTEQIRKERMAKENRRAKNARPSKKRKF 973

>Kpol_1032.11 s1032 complement(27093..30026) [2934 bp, 977 aa] {ON}
           complement(27093..30026) [2934 nt, 978 aa]
          Length = 977

 Score = 1307 bits (3382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 638/944 (67%), Positives = 759/944 (80%), Gaps = 19/944 (2%)

Query: 50  VQDVIDYSDSEHQQEDNKIARKEKQKKQDIDKSFPILELXXXXXXXXXXXXXXXXXXXXX 109
           VQD++D+SD    +ED K   K   K    + SFP LE+                     
Sbjct: 51  VQDIVDFSD----EEDTKKKPKSSNKTLTDNNSFPSLEISDDEDSNNKGDHEDDDDDL-- 104

Query: 110 XXXINAYFSTTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRD 169
               N YFS  N EKSKHKKGSFPSFG SK+I++N+ K+GFRQPTPIQRKTIPLILQ RD
Sbjct: 105 ----NDYFSINNSEKSKHKKGSFPSFGFSKLILSNVHKKGFRQPTPIQRKTIPLILQKRD 160

Query: 170 IVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQL 229
           IVGMARTGSGKTAAF+LPMI K+K+HSSKIGARAVILSPSRELA+QTH VFKEFSKGT L
Sbjct: 161 IVGMARTGSGKTAAFVLPMIEKLKSHSSKIGARAVILSPSRELALQTHRVFKEFSKGTHL 220

Query: 230 RSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEM 289
           RSVLLTGGDSLEDQF MMM+NPDVI+ATPGRFLHLKVEMSLDLK++EY VFDEADRLFEM
Sbjct: 221 RSVLLTGGDSLEDQFSMMMSNPDVIVATPGRFLHLKVEMSLDLKTVEYVVFDEADRLFEM 280

Query: 290 GFQDQLNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLF 349
           GFQ+QLNELLA+LP NRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAE+KISENLE+LF
Sbjct: 281 GFQEQLNELLAALPMNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEILF 340

Query: 350 LSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXX 409
           LSTKN+ERE NLLYLLQDVIKIPL T +Q +K +D                         
Sbjct: 341 LSTKNEERENNLLYLLQDVIKIPLGTDDQIKKLSDFNKSLSDSDSEDEDNKGKQNSRKSK 400

Query: 410 XXXXERL--PPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQ 467
               ++L    +N+LP+EK+TI+F PTRHHVEYI+QLLKDSG+L+SY+YGTLDQHARKRQ
Sbjct: 401 KGKFQKLKVSASNELPTEKSTIVFAPTRHHVEYITQLLKDSGFLVSYLYGTLDQHARKRQ 460

Query: 468 LYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYS 527
           L NFR GLTSILVVTDVAARGVDIPMLANVIN+SLPASSKIFIHRVGRTARAGNRGWAYS
Sbjct: 461 LLNFRAGLTSILVVTDVAARGVDIPMLANVINYSLPASSKIFIHRVGRTARAGNRGWAYS 520

Query: 528 IVSXXXXXXXXXXXXXXGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPKIAYTDRLI 587
           IVS              GKKI+LT MY++ C++MK+KWIA+GN ESSF +PKI+YT+RL+
Sbjct: 521 IVSETELPYMLDLELFLGKKILLTSMYEASCKLMKSKWIADGNTESSFEDPKISYTNRLV 580

Query: 588 LGSAPRLEVEGLGDLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESLKRSKEIIA 647
           LGSAPR ++E +GDLYKN++++NF+L++ K V++KAEKLY RTRT+ASPES+KRSKE+IA
Sbjct: 581 LGSAPRYDIESVGDLYKNIIESNFDLQMAKKVSLKAEKLYCRTRTAASPESIKRSKEVIA 640

Query: 648 SGWDEQNVLFGKNQEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQLAPIQ 707
           SGWDEQN+ FG+N EKEKL+FLAK QNRRNKETVFEF +NP+D+ ++ M++RR+Q+APIQ
Sbjct: 641 SGWDEQNIRFGRNLEKEKLNFLAKFQNRRNKETVFEFGKNPNDDTAILMQKRRKQIAPIQ 700

Query: 708 RKARERKELLQMEKMAGLTHSVEDEILKGDDNEAGYSVSEDTLKQQFQDADELLADQENX 767
           RKAR+R+ELL  E++AGLTH +EDEILKG+D+EAGYSV E+ LK  F+DAD++L +QE+ 
Sbjct: 701 RKARKRQELLDKERVAGLTHKIEDEILKGEDHEAGYSVPEEALK-SFEDADKILEEQES- 758

Query: 768 XXXXXXXXXXXXXPNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQVHKQ 827
                        PNFF+SHYAPAGDIQDKQL++T+GF NDAA+ AYDLN+DDKVQVHKQ
Sbjct: 759 --SRKKKSKTFRDPNFFISHYAPAGDIQDKQLQITSGFTNDAAQAAYDLNDDDKVQVHKQ 816

Query: 828 TAMVKWDKKRKKYVNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKPLKVGARE 887
           TA VKWDKKRKKYVN QG+DNKKYIIGE GQKI ASF+SGKF EW+K R +K +K GARE
Sbjct: 817 TATVKWDKKRKKYVNMQGIDNKKYIIGESGQKIPASFKSGKFAEWSKSRNIKGIKTGARE 876

Query: 888 TTIPSNILANPTNGSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKALANGI 947
           T+IP+N+L++PT  S   +G    G+FKHKQ KAP++PDK RDDY  QKKKV+ A+  G+
Sbjct: 877 TSIPTNLLSDPTTDSGSQRGPG--GRFKHKQNKAPRLPDKFRDDYQSQKKKVQSAIERGV 934

Query: 948 QVRGYGNAPGMSNELKSTEQIMKDRNVKENKRAKNARPSKRRKF 991
            V+G+G + G + ELK+T QI K+R  KE KR KNARP+K+RKF
Sbjct: 935 SVKGFGGSSG-NTELKTTAQIRKERMAKEKKRQKNARPTKKRKF 977

>KNAG0K01110 Chr11 (215540..218545) [3006 bp, 1001 aa] {ON} Anc_3.159
            YDL031W
          Length = 1001

 Score = 1297 bits (3356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 644/954 (67%), Positives = 757/954 (79%), Gaps = 25/954 (2%)

Query: 49   DVQDVIDYSDSEHQQEDNKIARKEKQKKQDI--DKSFPILELXXXXXXXXXXXXXXXXXX 106
            D+ D+IDYSD E  +   K  +++++  +    + +FP LEL                  
Sbjct: 62   DIADIIDYSDEEPAEAKGKQQKQKQKPSKKSPKENAFPSLELSDDESSKAAGDASDDD-- 119

Query: 107  XXXXXXINAYFSTTN-LEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLIL 165
                  +NAYFST N  EK K KKGSF SFGLSK I++N+T++GFRQPTPIQRKTIPLIL
Sbjct: 120  ------VNAYFSTNNQAEKQKFKKGSFASFGLSKAILSNVTRKGFRQPTPIQRKTIPLIL 173

Query: 166  QNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSK 225
            QNRDIVGMARTGSGKTAAF+LPMI K+KTHSSKIG RA+ILSPSRELA+QTHNVFK+FSK
Sbjct: 174  QNRDIVGMARTGSGKTAAFVLPMIEKLKTHSSKIGVRAIILSPSRELALQTHNVFKDFSK 233

Query: 226  GTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADR 285
            GT LRSVLLTGGDSLE+QFGMMM+NPDV+IATPGRFLHLKVEM+L LK++EYAVFDEADR
Sbjct: 234  GTHLRSVLLTGGDSLEEQFGMMMSNPDVVIATPGRFLHLKVEMNLVLKTVEYAVFDEADR 293

Query: 286  LFEMGFQDQLNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENL 345
            LFEMGFQ+QLNELLA+LPS+RQTLLFSATLPSSLV+FAKAGLTNPVLVRLDAESKISENL
Sbjct: 294  LFEMGFQEQLNELLAALPSSRQTLLFSATLPSSLVEFAKAGLTNPVLVRLDAESKISENL 353

Query: 346  EMLFLSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXX-- 403
            +MLFLS KNDEREANLLYLLQ+VIKIPLAT EQ +K  D                     
Sbjct: 354  QMLFLSIKNDEREANLLYLLQNVIKIPLATPEQLKKLRDSDAKFSESESEDESNEKRGGK 413

Query: 404  ---XXXXXXXXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLD 460
                         +RLP AN+LPSE AT++FVPTRHHVEYISQ+LKD GYL+SYIYG+LD
Sbjct: 414  RDFKKNGKKKFVKQRLPAANELPSENATVVFVPTRHHVEYISQVLKDCGYLVSYIYGSLD 473

Query: 461  QHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAG 520
            Q+ARK QLYNFR GLTSILVVTDVAARGVDIPMLANVIN+SLP+SSKIFIHRVGRTARAG
Sbjct: 474  QNARKSQLYNFRLGLTSILVVTDVAARGVDIPMLANVINYSLPSSSKIFIHRVGRTARAG 533

Query: 521  NRGWAYSIVSXXXXXXXXXXXXXXGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPKI 580
            N+GWAY+IVS               KK++LTPM ++   I+K KWI +GNDE SF  P +
Sbjct: 534  NKGWAYTIVSESELPYLLDLELFLSKKVLLTPMLEAKNAILKQKWIDQGNDEMSFKPPAV 593

Query: 581  AYTDRLILGSAPRLEVEGLGDLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESLK 640
            +YTDR++LGS PRL++E +GDL+KN+++NNF+L L+K  ++KAEKLYFRTRT AS ESLK
Sbjct: 594  SYTDRIVLGSCPRLDLESMGDLFKNILENNFDLSLMKATSLKAEKLYFRTRTHASLESLK 653

Query: 641  RSKEIIASGWDEQNVLFGKNQEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRR 700
            RSKE+IASGWDEQN++FG N EKEK++FLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRR
Sbjct: 654  RSKEVIASGWDEQNIIFGSNVEKEKINFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRR 713

Query: 701  RQLAPIQRKARERKELLQMEKMAGLTHSVEDEILKGDDN---EAGYSVSEDTLKQQFQDA 757
            RQLAP+Q+KA+ER+ELL+ E+ +GL+HS+EDEI   ++N   E GY+VSE+ LK QF+DA
Sbjct: 714  RQLAPVQKKAKERRELLEKERRSGLSHSIEDEIFNQNNNTEMETGYTVSEEALK-QFEDA 772

Query: 758  DELLADQENXXXXXXXXXXXXXXPNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLN 817
            DELL  Q                PNFFLSHYAPA DIQDKQL++T+GF NDAA+ AYDLN
Sbjct: 773  DELLQKQSE----KKTKPKNYKDPNFFLSHYAPAADIQDKQLQVTSGFTNDAAQAAYDLN 828

Query: 818  NDDKVQVHKQTAMVKWDKKRKKYVNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRK 877
            +DDKVQVHKQTA VKWDKKRKKYVN QG+DNKKYIIGE GQKIAASFRSGKFDEW+K R 
Sbjct: 829  DDDKVQVHKQTATVKWDKKRKKYVNMQGIDNKKYIIGESGQKIAASFRSGKFDEWSKARH 888

Query: 878  MKPLKVGARETTIPSNILANPTNGSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKK 937
            +KPLKVGA+E +I +++L +PT  S+ S   T  GK+KHKQ KAPK+PDKHRD+YH QKK
Sbjct: 889  IKPLKVGAKEDSIETHLLRDPTGRSNISGNRTASGKYKHKQDKAPKLPDKHRDNYHSQKK 948

Query: 938  KVEKALANGIQVRGYGNAPGMSNELKSTEQIMKDRNVKENKRAKNARPSKRRKF 991
            K+  A+  G  V+G+ N PG  +ELKST QI K R   E K+AKNARP+K+RKF
Sbjct: 949  KIASAMERGTYVKGF-NGPGTQSELKSTAQIRKGRLQAEKKKAKNARPNKKRKF 1001

>SAKL0C08778g Chr3 (804617..807628) [3012 bp, 1003 aa] {ON} similar to
            uniprot|Q12389 Saccharomyces cerevisiae YDL031W DBP10
            Essential protein involved in ribosome biogenesis
            putative ATP-dependent RNA helicase of the DEAD- box
            protein family
          Length = 1003

 Score = 1289 bits (3336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 639/967 (66%), Positives = 751/967 (77%), Gaps = 40/967 (4%)

Query: 48   EDVQDVIDYSDSEHQQEDNK-------IARKEKQKKQDIDKSFPILELXXXXXXXXXXXX 100
            ++VQDVI++SD E Q + N+        A+   +  +    SFP LEL            
Sbjct: 54   QEVQDVIEFSDGEEQGKKNQSKGAAKSAAKGNSKGAKQPRPSFPTLELSDAEDEAPDADK 113

Query: 101  XXXXXXXXXXXXINAYFSTTNLEK-SKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRK 159
                        +N YFSTT      KHKKGSFPSFG SK I+ NI+++GFRQPTPIQRK
Sbjct: 114  DA----------VNDYFSTTAAAAAGKHKKGSFPSFGFSKFILNNISRKGFRQPTPIQRK 163

Query: 160  TIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNV 219
            TIPLILQ RDIVGMARTGSGKTAAF LPMI K+K HS+KIG RAVILSPSRELAMQT+ V
Sbjct: 164  TIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSRELAMQTYKV 223

Query: 220  FKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAV 279
            FKEFS+G+ LRSVLLTGGDSLE+QFGMMM NPDV+IATPGRFLHLKVEM+LDLK++EY V
Sbjct: 224  FKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKTVEYVV 283

Query: 280  FDEADRLFEMGFQDQLNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAES 339
            FDEADRLFEMGFQ+QLNELLA+LP  RQTLLFSATLP SLVDFAKAGLTNPVLVRLDAES
Sbjct: 284  FDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAES 343

Query: 340  KISENLEMLFLSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXX 399
            K+SENLEMLFL+TKN EREANLLYLLQ+VI+IP+AT EQ ++   +              
Sbjct: 344  KVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLKQL--RALNDRSDSDADSDA 401

Query: 400  XXXXXXXXXXXXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTL 459
                           ++P AN+LPSEKATILFVPTRHHVEY+SQLLKDSGYL+SYIYGTL
Sbjct: 402  NDKNDRKKRKKQARRKMPSANELPSEKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTL 461

Query: 460  DQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARA 519
            DQ+ARK+QL+NFR+GLTSILVVTDVAARGVDIPMLANVINFSLP+SSKIFIHRVGRTARA
Sbjct: 462  DQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARA 521

Query: 520  GNRGWAYSIVSXXXXXXXXXXXXXXGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPK 579
            GN GWAYSIVS              GKKI+L PMYD+ CE+M+ +W+AEG  ES FV P+
Sbjct: 522  GNSGWAYSIVSENELPYLLDLELFLGKKILLAPMYDATCELMRKQWVAEGKQESEFVAPR 581

Query: 580  IAYTDRLILGSAPRLEVEGLGDLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESL 639
            ++YT+R++LGS PRLE+E +GDLYKN+++++F+L+L+K VA+KAEKLYFRTR  AS E++
Sbjct: 582  VSYTNRMVLGSCPRLEMESMGDLYKNLVESSFDLQLLKSVALKAEKLYFRTRAPASTEAM 641

Query: 640  KRSKEIIASGWDEQNVLFGKNQEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRR 699
            KRSKEIIASGWDEQN+ FGKN EKEKLDFLAKLQNR +KETVFEF+RN +DEM+V M+RR
Sbjct: 642  KRSKEIIASGWDEQNLKFGKNLEKEKLDFLAKLQNRNHKETVFEFARNQEDEMAVLMRRR 701

Query: 700  RRQLAPIQRKARERKELLQMEKMAGLTHSVEDEILKGDDNEAGYSVSEDTLKQQFQDADE 759
            RRQ+APIQRKARER+ELL+ E+MAGL H++EDE+LKG D E GYSV E+ L Q+F+DAD+
Sbjct: 702  RRQIAPIQRKARERQELLEKERMAGLRHTLEDEVLKGGDGEFGYSVPEEVLAQEFEDADK 761

Query: 760  LLADQENXXXXXXXXXXXXXX---------------PNFFLSHYAPAGDIQDKQLELTTG 804
            +L +QEN                             PNFFLSHYAPAGDIQDKQL+LT+G
Sbjct: 762  ILDEQENKKKTKTMKTRQGETKPKPKPKPKPKTYKDPNFFLSHYAPAGDIQDKQLQLTSG 821

Query: 805  FVNDAAKVAYDLNNDDKVQVHKQTAMVKWDKKRKKYVNTQGLDNKKYIIGEGGQKIAASF 864
            F NDAA   +DL++D+KVQVHKQTA VKWDKKRKKYVN QGLDNKKYIIGE GQKI ASF
Sbjct: 822  FTNDAADATFDLHDDNKVQVHKQTATVKWDKKRKKYVNAQGLDNKKYIIGESGQKIPASF 881

Query: 865  RSGKFDEWAKKRKMKPLKVGARETTIPSNILANPTNGSHGSQGNTIRGKFKHKQMKAPKM 924
            RSGKF EW+K RK+ PLKVGARET+ PSN+L++P +G     G    G+FKHK  KAPK+
Sbjct: 882  RSGKFAEWSKARKLGPLKVGARETSGPSNLLSDPASGGRRVAG----GRFKHKLDKAPKL 937

Query: 925  PDKHRDDYHIQKKKVEKALANGIQVRGYGNAPGMSNELKSTEQIMKDRNVKENKRAKNAR 984
            PD+HRDDY  Q+KKV  AL  GI V+G+G APG  +E+KSTEQI   R  K+ + AKNAR
Sbjct: 938  PDRHRDDYKTQQKKVANALERGISVKGFG-APGAKSEMKSTEQIRSQRVAKDKRLAKNAR 996

Query: 985  PSKRRKF 991
            PSK+RKF
Sbjct: 997  PSKKRKF 1003

>KLLA0F24684g Chr6 complement(2294708..2297629) [2922 bp, 973 aa]
           {ON} similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031W DBP10 Essential protein involved in ribosome
           biogenesis
          Length = 973

 Score = 1285 bits (3326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 635/945 (67%), Positives = 750/945 (79%), Gaps = 27/945 (2%)

Query: 49  DVQDVIDYSDSEHQQEDNKIARKEKQKKQD---IDKSFPILELXXXXXXXXXXXXXXXXX 105
           +VQDVI++S  E ++E     + +K K +    +D  FP LEL                 
Sbjct: 52  EVQDVIEFSSDEEEKEKKPKKQNKKAKVKAGPIVDSKFPSLELSDDEKKATNESDDD--- 108

Query: 106 XXXXXXXINAYFSTTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLIL 165
                  +N YF+TT    +KHKKGSF SFGLSK+++ NI+K+GFRQPTPIQRKTIPLIL
Sbjct: 109 -------LNDYFNTTADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLIL 161

Query: 166 QNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSK 225
           Q RDIVGMARTGSGKTAAF+LPMI K+KTHS+KIG RAVILSPSRELA+QTH VFKEFSK
Sbjct: 162 QKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSK 221

Query: 226 GTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADR 285
           G+ LRS+LLTGGDSLEDQFGMMM NPDV+IATPGRFLHLKVEM+LDLKS+EY VFDEADR
Sbjct: 222 GSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADR 281

Query: 286 LFEMGFQDQLNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENL 345
           LFEMGFQ+QLNELL + P+NRQTLLFSATLPSSLVDFAKAGL+NPVLVRLDAE+KISENL
Sbjct: 282 LFEMGFQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENL 341

Query: 346 EMLFLSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXX 405
           EMLF+S K DEREANLLYLLQ+ IK+P+AT+ Q +K   Q                    
Sbjct: 342 EMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNDADSDSDDSEDEKKKKAKK 401

Query: 406 XXXXXXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARK 465
                    RLP AN++PSEKATI+FVPTRHHVEY++QLLK+ GYL+SYIYG L+QHARK
Sbjct: 402 AKKSK---RRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARK 458

Query: 466 RQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWA 525
           +QLYNFR GLTSILVVTDVAARGVDIP+LANVIN+SLP SSKIFIHRVGRTARAGNRGWA
Sbjct: 459 QQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWA 518

Query: 526 YSIVSXXXXXXXXXXXXXXGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPKIAYTDR 585
           +SIVS              GKKI+LTPMY+S C+I++ K  +EGN+  +F +PK++YT R
Sbjct: 519 FSIVSENELPYLLDLELFLGKKILLTPMYESSCQILRKKAESEGNN--NFTDPKVSYTTR 576

Query: 586 LILGSAPRLEVEGLGDLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESLKRSKEI 645
           ++LG+ PR E++G+GDLY NM++++FEL  +K VA+KAEKLYFRTRT AS ES+KRSKEI
Sbjct: 577 MVLGACPRSEIDGMGDLYSNMIKSDFELNTVKGVALKAEKLYFRTRTPASAESMKRSKEI 636

Query: 646 IASGWDEQNVLFGKNQEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQLAP 705
           + SGWDEQN+ FGKN EKEKLDFLAKLQ+R NKETVFEF+RNPDDEMSV MKRRRRQ+AP
Sbjct: 637 LRSGWDEQNIYFGKNAEKEKLDFLAKLQHRNNKETVFEFARNPDDEMSVLMKRRRRQIAP 696

Query: 706 IQRKARERKELLQMEKMAGLTHSVEDEILKGDDNEAGYSVSEDTLKQQFQDADELLADQE 765
           IQRKA+ER+ELL+ E+M GL HS+EDEILKG+DNE GYSV ++ LK +F+DAD LL +QE
Sbjct: 697 IQRKAKERQELLEKERMIGLRHSIEDEILKGEDNEVGYSVPDEVLK-EFEDADVLLEEQE 755

Query: 766 NXXXXXXXXXXXXXXPNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQVH 825
           N              P F+LSH+AP  DIQDKQL++++GF NDA+  A+DL NDDKVQVH
Sbjct: 756 N---IKKKQKKTFRDPTFYLSHFAPTSDIQDKQLQISSGFTNDASNAAFDLANDDKVQVH 812

Query: 826 KQTAMVKWDKKRKKYVNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKPLKVGA 885
           KQTA VKWDKKRKKYVNTQGLDNKKYIIGE GQKI ASFRSGKF +W+K RK+ PLKVGA
Sbjct: 813 KQTATVKWDKKRKKYVNTQGLDNKKYIIGESGQKIPASFRSGKFQDWSKARKIAPLKVGA 872

Query: 886 RETTIPSNILANPTNGSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKALAN 945
           RE+TIPSN+LA+PT+ S      T+ GKFKHK  KAPK+PDKHRDDY  QKKKVE AL  
Sbjct: 873 RESTIPSNLLADPTSPSE----RTVGGKFKHKTQKAPKLPDKHRDDYAFQKKKVEAALER 928

Query: 946 GIQVRGYGNAPGMSNELKSTEQIMKDRNVKENKRAKNARPSKRRK 990
           G++V+GY N PGM  E+KS ++I K R +KE KR+KNARP+KRRK
Sbjct: 929 GVRVKGY-NGPGMKQEIKSVDEIRKLREIKEKKRSKNARPTKRRK 972

>KLTH0C08866g Chr3 (742559..745477) [2919 bp, 972 aa] {ON} highly
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031W DBP10 Essential protein involved in ribosome
           biogenesis putative ATP-dependent RNA helicase of the
           DEAD-box protein family
          Length = 972

 Score = 1277 bits (3305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/943 (66%), Positives = 755/943 (80%), Gaps = 21/943 (2%)

Query: 49  DVQDVIDYSDSEHQQEDNKIARKEKQKKQDIDKSFPILELXXXXXXXXXXXXXXXXXXXX 108
           DVQD+I++SD E ++E    A  +K+KK   +  FP LEL                    
Sbjct: 51  DVQDIIEFSD-EDEEEARAKAAPQKKKKNAHEGGFPALELSDNEDHDDGKDGADD----- 104

Query: 109 XXXXINAYFSTTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNR 168
               +  YFST N E +KHKKGSF SFGLSK IV+NI K+GFRQPTPIQRKTIPLILQ R
Sbjct: 105 ----VTEYFSTNNPEAAKHKKGSFASFGLSKFIVSNIAKKGFRQPTPIQRKTIPLILQKR 160

Query: 169 DIVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQ 228
           DIVGMARTGSGKTAAF+LPMI K+K HS+KIGARAVILSPSRELAMQTH VF+EFS+G+ 
Sbjct: 161 DIVGMARTGSGKTAAFVLPMIEKLKGHSAKIGARAVILSPSRELAMQTHKVFREFSRGSD 220

Query: 229 LRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFE 288
           LRSVLLTGG+SLE+QFG+MM+NPDV+IATPGRFLHLKVEM+LDLKS+EY VFDEADRLFE
Sbjct: 221 LRSVLLTGGESLEEQFGLMMSNPDVVIATPGRFLHLKVEMNLDLKSVEYLVFDEADRLFE 280

Query: 289 MGFQDQLNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEML 348
           MGF++QL+ELLA+LP  RQTLLFSATLPSSLV+FAKAGLTNPVLVRLDAE+K+SENLEML
Sbjct: 281 MGFEEQLSELLAALPVARQTLLFSATLPSSLVNFAKAGLTNPVLVRLDAETKVSENLEML 340

Query: 349 FLSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXX 408
           FLS+KN+EREANLLYLLQ+ +KIP+AT+EQ  ++  +                       
Sbjct: 341 FLSSKNEEREANLLYLLQEAMKIPVATEEQLLEYKAKVKNSYDSDDSDEDAKAKAKKQRK 400

Query: 409 XXXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQL 468
                ++LP AN+LPSE ATI+FVPTRHHVEYISQLLKD GYL+SY+YGTLDQHAR++QL
Sbjct: 401 SAIR-KKLPSANELPSEHATIVFVPTRHHVEYISQLLKDCGYLVSYLYGTLDQHARRQQL 459

Query: 469 YNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSI 528
           +NFR GLT+ILVVTDVAARGVDIP+LANV+N+SLPASSKIF+HRVGRTARAGN+G+AYSI
Sbjct: 460 FNFRAGLTTILVVTDVAARGVDIPLLANVVNYSLPASSKIFVHRVGRTARAGNKGFAYSI 519

Query: 529 VSXXXXXXXXXXXXXXGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPKIAYTDRLIL 588
           VS              GKKI+LTPM+++  E++K+KWIAEGN E +F  PK++YT+R++L
Sbjct: 520 VSENELPYLLDLELFLGKKILLTPMFEATTELLKSKWIAEGNSELTFNPPKVSYTNRMVL 579

Query: 589 GSAPRLEVEGLGDLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESLKRSKEIIAS 648
           G+ PRL++E  GDL+KN+ Q++F+L+ +K VA KAEKLYFRTR  AS +S+KRSKE+IAS
Sbjct: 580 GACPRLDLETCGDLFKNLTQSSFDLQQLKGVAAKAEKLYFRTRPPASSQSMKRSKEVIAS 639

Query: 649 GWDEQNVLFGKNQEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQLAPIQR 708
           GWDEQN+ FGKN EKEKLDFLAKLQNR NKETVFEF+RN DDEMS+ MK+RR Q+APIQR
Sbjct: 640 GWDEQNLRFGKNIEKEKLDFLAKLQNRNNKETVFEFARNQDDEMSLLMKKRRIQIAPIQR 699

Query: 709 KARERKELLQMEKMAGLTHSVEDEILKGDDNEAGYSVSEDTLKQQFQDADELLADQENXX 768
           +A+ERKELL+ E+MAGL H+VEDEILKGD+NE GYSV E+ L ++FQDADELL  Q    
Sbjct: 700 RAKERKELLEKERMAGLRHTVEDEILKGDENEVGYSVPEEVLHREFQDADELLGAQSK-- 757

Query: 769 XXXXXXXXXXXXPNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQVHKQT 828
                       P FFLSHYAPA +IQDKQLE+T GF N+AA   +DL+NDDKVQ HKQ 
Sbjct: 758 ---SKRPKSFRDPAFFLSHYAPASEIQDKQLEVTNGFTNEAANATFDLHNDDKVQNHKQV 814

Query: 829 AMVKWDKKRKKYVNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKPLKVGARET 888
           A  KWDKKR+KYVNTQGLDNKKYI+GE G KI ASFRSGKFDEW+K RK+ PLKVGA+E+
Sbjct: 815 ATTKWDKKRQKYVNTQGLDNKKYIMGESGHKIPASFRSGKFDEWSKARKLGPLKVGAKES 874

Query: 889 TIPSNILANPTNGSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKALANGIQ 948
           +  + +L+NPT     S G    G+FKH +++APK+PDKHRDDYH+QKKKVEKA+++GI 
Sbjct: 875 STTAKMLSNPTAEGQRSIG----GRFKHNKVRAPKLPDKHRDDYHVQKKKVEKAVSSGIP 930

Query: 949 VRGYGNAPGMSNELKSTEQIMKDRNVKENKRAKNARPSKRRKF 991
           V+GY NAPGM +E++ST+QI K+R  KE KRAKNARP+K+RKF
Sbjct: 931 VKGY-NAPGMKSEMRSTQQIYKERVAKEKKRAKNARPAKKRKF 972

>TPHA0M00330 Chr13 complement(61976..64921) [2946 bp, 981 aa] {ON} 
          Length = 981

 Score = 1275 bits (3300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/948 (66%), Positives = 744/948 (78%), Gaps = 21/948 (2%)

Query: 47  NEDVQDVIDYSDSEHQQEDNKIARKEKQKKQDIDKSFPILELXXXXXXXXXXXXXXXXXX 106
           ++ VQD+I+YSD E  +       KE +K +     FP+LE+                  
Sbjct: 52  DDGVQDLIEYSDEETTE-------KEVKKTKKASNPFPLLEMSDDEDDKNSKNSAFNDDA 104

Query: 107 XXXXXXINAYFSTTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQ 166
                 +N YFST   +KSKHKKGSFPSFGLSK+I++NI K+GFRQPTPIQRKTIPLILQ
Sbjct: 105 DD----VNDYFSTNMQDKSKHKKGSFPSFGLSKLILSNINKKGFRQPTPIQRKTIPLILQ 160

Query: 167 NRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKG 226
            RDIVGMARTGSGKTAAFILPMI K+KTHS KIGARAVILSPSRELAMQTH VFK+FS+G
Sbjct: 161 RRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHKVFKDFSRG 220

Query: 227 TQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRL 286
           +QLRSVLLTGGDSLE+QF MMM+NPDVI+ATPGRF+HLKVEM LDLK++EY VFDEADRL
Sbjct: 221 SQLRSVLLTGGDSLEEQFSMMMSNPDVIVATPGRFMHLKVEMGLDLKTVEYVVFDEADRL 280

Query: 287 FEMGFQDQLNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLE 346
           FEMGFQ+QLNELLASLP NRQTLLFSATLP+SLVDFAKAGLTNPVLVRLDAESKISENL+
Sbjct: 281 FEMGFQEQLNELLASLPMNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDAESKISENLQ 340

Query: 347 MLFLSTKNDEREANLLYLLQDVIKIPLATKEQQRKF---NDQXXXXXXXXXXXXXXXXXX 403
           + F STKN+EREA LLY+LQDVI + + T+E+ +K    N +                  
Sbjct: 341 LAFFSTKNEEREATLLYILQDVIDLQIGTEEEIKKLTASNKRSDEIDSDNEREQADRKLN 400

Query: 404 XXXXXXXXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHA 463
                      +LP AN+LPSEKATI+FVPTRHHVEYIS LLKD GYL+SY+YGTLDQHA
Sbjct: 401 KKKKFEKFIKPKLPSANELPSEKATIVFVPTRHHVEYISNLLKDCGYLVSYLYGTLDQHA 460

Query: 464 RKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRG 523
           RK QL+NFR GLTSILVVTDVAARGVDIPMLANVIN+SLPASSKIF+HRVGRTARAGN+G
Sbjct: 461 RKHQLFNFRAGLTSILVVTDVAARGVDIPMLANVINYSLPASSKIFVHRVGRTARAGNKG 520

Query: 524 WAYSIVSXXXXXXXXXXXXXXGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPKIAYT 583
           WAYSI S              GKKI+LT MY++ C + KNKWIA GN+E +F  PK +YT
Sbjct: 521 WAYSIASETELPYLLDLELFLGKKILLTQMYEATCSLAKNKWIAAGNEEYTFQPPKPSYT 580

Query: 584 DRLILGSAPRLEVEGLGDLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESLKRSK 643
           DR+ILGS PRLE+E +GDLYKN+M  +F+L++ K  ++KAEKLYFRTRT+ASPES+KR K
Sbjct: 581 DRMILGSCPRLELENIGDLYKNIMSASFDLQMAKKTSLKAEKLYFRTRTAASPESIKRGK 640

Query: 644 EIIASGWDEQNVLFGKNQEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQL 703
           E+IASGWDEQ+++FGKN EKEKLDFL+K QNR NKETVFEF RNP D  +V M RRRRQL
Sbjct: 641 ELIASGWDEQHIMFGKNVEKEKLDFLSKFQNRNNKETVFEFGRNPTDATAVLMNRRRRQL 700

Query: 704 APIQRKARERKELLQMEKMAGLTHSVEDEILKGDDNEAGYSVSEDTLKQQFQDADELLAD 763
           APIQRKA ER++LL+ E++AGL+H++EDEILKG+D+E+GY++S++ L   F+DAD+LL +
Sbjct: 701 APIQRKAVERRKLLEKERLAGLSHALEDEILKGEDHESGYTISKEAL-AAFEDADKLLQE 759

Query: 764 QENXXXXXXXXXXXXXXPNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQ 823
           QE               P FFLSHYAPA DIQDKQL LT+GF NDAA+ AYDLNNDDKVQ
Sbjct: 760 QE----KKKRKPKTYKDPQFFLSHYAPAKDIQDKQLNLTSGFTNDAAQAAYDLNNDDKVQ 815

Query: 824 VHKQTAMVKWDKKRKKYVNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKPLKV 883
           VHKQTA +KWDK RKKYVN  GLDNKKYIIGEGGQKI ASF+SG+FDEW+K R +KPLK 
Sbjct: 816 VHKQTANIKWDKGRKKYVNINGLDNKKYIIGEGGQKIPASFKSGRFDEWSKARHIKPLKA 875

Query: 884 GARETTIPSNILANPTNGSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKAL 943
           G RE +IP+N+LA+ T  S GS+  T  G+FKHKQ KAP++PDKHRDDY  QKKKV+ AL
Sbjct: 876 GVREDSIPTNLLADVTGPSDGSR--TFGGRFKHKQNKAPRLPDKHRDDYESQKKKVQNAL 933

Query: 944 ANGIQVRGYGNAPGMSNELKSTEQIMKDRNVKENKRAKNARPSKRRKF 991
             G+QV+GY N   + +ELK+  QI K+R V ENK+ KNARPSK+RK+
Sbjct: 934 ERGVQVKGYNNRNSVKSELKTVAQIRKERMVNENKQKKNARPSKKRKY 981

>Kwal_56.22804 s56 complement(286570..289491) [2922 bp, 973 aa] {ON}
           YDL031W (DBP10) - similar to RNA helicases [contig 184]
           FULL
          Length = 973

 Score = 1256 bits (3251), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/943 (64%), Positives = 749/943 (79%), Gaps = 21/943 (2%)

Query: 50  VQDVIDYS-DSEHQQEDNKIARKEKQKKQDIDKSFPILELXXXXXXXXXXXXXXXXXXXX 108
           VQD+ID+S D E   ++ K   K ++K      SFP+LEL                    
Sbjct: 51  VQDIIDFSGDEEETSKNAKKTGKAEKKPSSKQASFPLLELSDDEEEQAANDGEDD----- 105

Query: 109 XXXXINAYFSTTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNR 168
               +  YF+TTN E SKHKKGSF SFGLSK I++NI K+GFRQPTPIQRKTIPLILQ R
Sbjct: 106 ----VTEYFTTTNAEASKHKKGSFASFGLSKFIISNIAKKGFRQPTPIQRKTIPLILQKR 161

Query: 169 DIVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQ 228
           DIVGMARTGSGKTAAF+LPMI ++K HS+KIGARAVI+SPSRELA+QTH VF+EFS+G+ 
Sbjct: 162 DIVGMARTGSGKTAAFVLPMIERLKGHSAKIGARAVIMSPSRELALQTHKVFREFSRGSD 221

Query: 229 LRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFE 288
           LRSVLLTGG+SLE+QFG+MM+NPDV+IATPGRFLHLKVEM+LDLKSIEY VFDEADRLFE
Sbjct: 222 LRSVLLTGGESLEEQFGLMMSNPDVVIATPGRFLHLKVEMNLDLKSIEYVVFDEADRLFE 281

Query: 289 MGFQDQLNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEML 348
           MGF++QLNELLA+ P  RQTLLFSATLPSSLVDFAKAGLT+PVLVRLD E+K+SENLEML
Sbjct: 282 MGFEEQLNELLAAFPVARQTLLFSATLPSSLVDFAKAGLTSPVLVRLDTETKVSENLEML 341

Query: 349 FLSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXX 408
           +LS+KN+EREANLLYLLQ+ ++IP+AT+EQ  ++  +                       
Sbjct: 342 YLSSKNEEREANLLYLLQEAMQIPVATEEQLAEYRTKIKDDYDSDDSDSKDKLKAKKKKK 401

Query: 409 XXXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQL 468
                 ++P AN+LPSE ATI+FVPTRHHVEYI+QLLKD GYL+SY+YGTLDQHAR++QL
Sbjct: 402 AMIR-RKMPAANELPSEHATIVFVPTRHHVEYITQLLKDCGYLVSYLYGTLDQHARRQQL 460

Query: 469 YNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSI 528
           +NFR GLT+ILVVTDVAARGVDIPMLANV+N+SLPASSKIF+HRVGRTARAGN+G AYSI
Sbjct: 461 FNFRAGLTTILVVTDVAARGVDIPMLANVVNYSLPASSKIFVHRVGRTARAGNKGSAYSI 520

Query: 529 VSXXXXXXXXXXXXXXGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPKIAYTDRLIL 588
           VS              GKKI+LTPMY++  E++K++WIAEG  E +F  PK++YT+R++L
Sbjct: 521 VSDNELPYLLDLELFLGKKILLTPMYEATTEMLKSRWIAEGKSELTFNAPKVSYTNRMVL 580

Query: 589 GSAPRLEVEGLGDLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESLKRSKEIIAS 648
           G+ PRLE+E  GDL+K+++ ++F+LK +K VA KAEKLYFRTR  AS +S+KRSKE+++S
Sbjct: 581 GACPRLELETCGDLFKSLIDSSFDLKQLKAVANKAEKLYFRTRPPASSQSMKRSKEVLSS 640

Query: 649 GWDEQNVLFGKNQEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQLAPIQR 708
           GWDEQN+ FGKN EKEKLDFLAKLQNR +KETVFEF+RN DDEM++ MK+RR Q+APIQR
Sbjct: 641 GWDEQNLRFGKNMEKEKLDFLAKLQNRHHKETVFEFARNHDDEMALLMKKRRIQIAPIQR 700

Query: 709 KARERKELLQMEKMAGLTHSVEDEILKGDDNEAGYSVSEDTLKQQFQDADELLADQENXX 768
           +A+ERKELL+ E+ AGL HSVEDEILKGD+ E GYSV E+ L Q+F+DADELL  Q+   
Sbjct: 701 RAKERKELLEKERKAGLVHSVEDEILKGDETEVGYSVPEEVLHQEFEDADELLEGQKK-- 758

Query: 769 XXXXXXXXXXXXPNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQVHKQT 828
                       P +FLSHYAPA +IQDKQLE++ GF N+AA   +DL+NDDKVQ HKQ 
Sbjct: 759 ---EKKQKSFRDPTYFLSHYAPASEIQDKQLEVSNGFTNEAANATFDLHNDDKVQNHKQI 815

Query: 829 AMVKWDKKRKKYVNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKPLKVGARET 888
           A +KWDKKR+KYVN+QGLDNKKYI GE G KI ASFRSGKFDEW+K RK+ P+KVGARE+
Sbjct: 816 ATIKWDKKRQKYVNSQGLDNKKYITGESGHKIPASFRSGKFDEWSKARKLGPIKVGARES 875

Query: 889 TIPSNILANPTNGSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKALANGIQ 948
           +  S +L+NPT+ +    G    GKFKH ++KAPK+PDK+RDDYH+QKKKVEKA+++GI+
Sbjct: 876 SSTSKMLSNPTSNNQRMGG----GKFKHNKVKAPKLPDKNRDDYHVQKKKVEKAISSGIR 931

Query: 949 VRGYGNAPGMSNELKSTEQIMKDRNVKENKRAKNARPSKRRKF 991
           V+G+ NAPGM +E+++ +QI K+R  KE KRAKNARP+K+RK+
Sbjct: 932 VKGF-NAPGMKSEMRTPQQIYKERVAKEKKRAKNARPAKKRKY 973

>AEL086W Chr5 (464521..467403) [2883 bp, 960 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL031W (DBP10)
          Length = 960

 Score = 1250 bits (3234), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 627/997 (62%), Positives = 761/997 (76%), Gaps = 43/997 (4%)

Query: 1   MALKEKRTRDTAVDSSDSENXXXXXXXXXXXXLNXXXXXXXXXXXXNEDVQDVIDYSDSE 60
           M L  KR RDT   S + E+            L+            NE VQD+I++SD E
Sbjct: 1   MGLASKRKRDTEEHSDEGEDFDIAGNIA----LDSEDSDDSVSDSDNE-VQDIIEFSDDE 55

Query: 61  HQ-----QEDNKIARKEKQKKQDIDKSFPILELXXXXXXXXXXXXXXXXXXXXXXXXINA 115
            Q      +  K A+  K      D +FP LEL                        +++
Sbjct: 56  KQNAPQVSKTAKGAKGAKVAAPRSDAAFPSLELSDGEDADNGDKDD-----------VDS 104

Query: 116 YFSTTN-LEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMA 174
           YF+TT+ L  SK KKGSF SFGLSK I+ NI+++GFRQPTPIQRKTIPLILQ RDIVGMA
Sbjct: 105 YFNTTSQLAASKAKKGSFASFGLSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMA 164

Query: 175 RTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLL 234
           RTGSGKTAAF+LP+I K+K HS+KIGARA+ILSPSRELAMQTH VFKEF+KG+ LRSVLL
Sbjct: 165 RTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLL 224

Query: 235 TGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQ 294
           TGGD LEDQF MMM+NPDVIIATPGRFLHLKVEM+LDL SIEY VFDEADRLFEMGFQ+Q
Sbjct: 225 TGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQ 284

Query: 295 LNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKN 354
           LNELL SLP+ RQTLLFSATLPSSLVDFAKAGLTNPVLVRLD E+K+SENLEMLFLS KN
Sbjct: 285 LNELLGSLPTARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKN 344

Query: 355 DEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXE 414
           DEREANLLYLLQ+VIKIP+AT+EQ ++F  Q                            +
Sbjct: 345 DEREANLLYLLQEVIKIPVATEEQLQRFRKQSNDDADDSDDETDKKKKHSKKSK-----Q 399

Query: 415 RLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTG 474
            LP A  +PS  +TI+FV TRHHVEY+S LLKD GYL+SY+YGTLDQHAR++QL+NFR G
Sbjct: 400 PLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCG 459

Query: 475 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXX 534
           LT+ILVVTDVAARGVDIP+LANV+N SLPASSKIF+HRVGRTARAGN+GWAY+I+S    
Sbjct: 460 LTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTILSESEL 519

Query: 535 XXXXXXXXXXGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPKIAYTDRLILGSAPRL 594
                     GKK++LTPMY++ C+++K KWI+EGN+ + F  PKI+Y +RLILGSAPRL
Sbjct: 520 PYLLDLELFLGKKVLLTPMYEATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRL 579

Query: 595 EVEGLGDLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESLKRSKEIIASGWDEQN 654
           ++E +GDL+KN++++NFEL+ +K V++KAEKLY RTR  AS ES+KR+KE+IA+GWDEQN
Sbjct: 580 DLEAMGDLFKNLVESNFELQNLKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQN 639

Query: 655 VLFGKNQEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQLAPIQRKARERK 714
           V FGKN EKEKL+FLAKLQNR NKETVFEF+RN DDEM++ MKRRRRQ+APIQ++A+ER+
Sbjct: 640 VRFGKNIEKEKLEFLAKLQNRHNKETVFEFARNHDDEMAILMKRRRRQIAPIQQRAKERQ 699

Query: 715 ELLQMEKMAGLTHSVEDEILKGDDNEAGYSVSEDTLKQQFQDADELLADQENXXXXXXXX 774
           +LL+ E+ AGL H++EDEILKG++NE GYSV ++ L+  F+DADEL A +          
Sbjct: 700 QLLEKERQAGLRHTLEDEILKGEENEVGYSVPQELLR-DFEDADELAAKRNTKKGFRDE- 757

Query: 775 XXXXXXPNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQVHKQTAMVKWD 834
                  NF+LSH+APA DIQDKQL++ + F N+ +K  +DL+NDDKVQVHKQTA VKWD
Sbjct: 758 -------NFYLSHFAPASDIQDKQLQVASSFTNEVSKATFDLHNDDKVQVHKQTATVKWD 810

Query: 835 KKRKKYVNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKPLKVGARETTIPSNI 894
           KKRKKYVN QG+DNKKYIIGE GQKI ASFRSGKFDEW+K RK+ PLKVGARE++IP+N+
Sbjct: 811 KKRKKYVNVQGIDNKKYIIGESGQKIPASFRSGKFDEWSKARKLAPLKVGARESSIPANL 870

Query: 895 LANPTNGSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKALANGIQVRGYGN 954
           LA+PT    GS+     GKFKHKQ+KAPKMPDK+RDDY  Q KKV KA+ +G+ V+GY N
Sbjct: 871 LADPT----GSR--LANGKFKHKQIKAPKMPDKNRDDYQSQLKKVNKAMESGLHVKGY-N 923

Query: 955 APGMSNELKSTEQIMKDRNVKENKRAKNARPSKRRKF 991
           APGM  EL++TEQI K R++ E ++AKNARP+K+RKF
Sbjct: 924 APGMKQELRTTEQIRKQRSMAEKRKAKNARPAKKRKF 960

>ZYRO0B04972g Chr2 complement(401735..404674) [2940 bp, 979 aa] {ON}
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031W DBP10 Essential protein involved in ribosome
           biogenesis putative ATP-dependent RNA helicase of the
           DEAD- box protein family
          Length = 979

 Score = 1236 bits (3197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 611/944 (64%), Positives = 733/944 (77%), Gaps = 13/944 (1%)

Query: 48  EDVQDVIDYSDSEHQQEDNKIARKEKQKKQDIDKSFPILELXXXXXXXXXXXXXXXXXXX 107
           E+ QDVIDYSD + ++E  K  ++  +K    D  FPILEL                   
Sbjct: 47  ENYQDVIDYSDDDKEKEAGKKKKEPVKKSDKHD--FPILELSDNEEDADAKKKKEDGDAD 104

Query: 108 XXXXXINAYFSTTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQN 167
                I+ YF+T N E  KHKKGSFPSFG SK I+ NI K+GFRQPTPIQRKTIPLILQN
Sbjct: 105 D----ISEYFTTNNSESKKHKKGSFPSFGFSKFILNNINKKGFRQPTPIQRKTIPLILQN 160

Query: 168 RDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT 227
           RDIVGMARTGSGKTAAF+LPMI K+K HSSKIGARAVILSPSRE+AMQT+ VFKEFSKG+
Sbjct: 161 RDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPSREIAMQTYKVFKEFSKGS 220

Query: 228 QLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF 287
            LRSVLLTGGDSLEDQFGMMM+NPDV++ATPGRFLHLKVEM+L+LKS+EYAVFDEADRLF
Sbjct: 221 DLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLF 280

Query: 288 EMGFQDQLNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEM 347
           EMGF +QLNELLASLP  RQTLLFSATLP++LVDFAKAGLTNPVLVRLDAESKISENLEM
Sbjct: 281 EMGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEM 340

Query: 348 LFLSTKNDEREANLLYLLQDVIKIPLATKEQQRKFND--QXXXXXXXXXXXXXXXXXXXX 405
           LF+STK+DEREANL YLLQ+VIKIPLAT+EQ+    +  +                    
Sbjct: 341 LFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGKKDRRKK 400

Query: 406 XXXXXXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARK 465
                    +LP AN+LPSEKATI+FVPTRHHVEYISQLLK  GYL+SYIYGTLDQHAR+
Sbjct: 401 GKKNKAKRPKLPSANELPSEKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARR 460

Query: 466 RQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWA 525
           RQLYNFR GLTSILVVTDVAARGVDIPMLANVINF++P+SSKIF+HRVGRTARAGNRGWA
Sbjct: 461 RQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWA 520

Query: 526 YSIVSXXXXXXXXXXXXXXGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPKIAYTDR 585
           YSIVS              GKKI+L PMY++ C ++K KW+ EGNDE  F  PK++YTDR
Sbjct: 521 YSIVSESELPYLLDLELFLGKKILLAPMYEATCNLLKEKWVNEGNDEFRFQPPKVSYTDR 580

Query: 586 LILGSAPRLEVEGLGDLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESLKRSKEI 645
           ++LGS PR+E+E +GDLYKN+M +N++L   + V++KAE +Y RTR  AS ES+KR+K++
Sbjct: 581 MVLGSCPRIELESMGDLYKNLMDSNYDLGSTRGVSIKAEIMYMRTRQPASAESMKRAKQM 640

Query: 646 IASGWDEQNVLFGKNQEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQLAP 705
           I SGWDEQN+LFGKN E EK  FLAKLQ+RRNKETVFEF+RNPDD+MSV MK+RR+QL P
Sbjct: 641 IISGWDEQNILFGKNMEAEKNKFLAKLQDRRNKETVFEFARNPDDKMSVLMKKRRQQLEP 700

Query: 706 IQRKARERKELLQMEKMAGLTHSVEDEILKGDDNEAGYSVSEDTLKQQFQDADELLADQE 765
           +Q +A++R+EL++ EK+AGLTHS+EDE+L     E GYSV  D + ++F+DAD++L DQE
Sbjct: 701 VQLRAKQRQELMEKEKLAGLTHSLEDEVLDKYKGEVGYSVP-DAVLEEFEDADQVLEDQE 759

Query: 766 NXXXXXXXXXXXXXXPNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQVH 825
                           NFF+SHYAPA  +QD QL +++GF  DAA+ +YDLN+DDK+QVH
Sbjct: 760 TEGKKQKQKSKSFKDSNFFMSHYAPAQSVQDSQLNISSGFTTDAAQASYDLNDDDKIQVH 819

Query: 826 KQTAMVKWDKKRKKYVNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKPLKVGA 885
           KQTA VKWDKK+KKYVN QG DN +YI  E GQKI AS+RSGKFDEW+KKRK+K  KVG+
Sbjct: 820 KQTATVKWDKKKKKYVNPQGADNVRYITSESGQKIPASYRSGKFDEWSKKRKLKMPKVGS 879

Query: 886 RETTIPSNILANPTNGSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKALAN 945
           RE+++ +N+L +PT G+  S       +F HKQ+KAPK+PDK+RDDY  QK KV KAL  
Sbjct: 880 RESSMATNLLQDPTRGNPSSNNR----RFMHKQVKAPKVPDKYRDDYGKQKTKVAKALEK 935

Query: 946 GIQVRGYGNAPGMSNELKSTEQIMKDRNVKENKRAKNARPSKRR 989
           GI V+G+ NAPGM+NEL+S +QI K R VK+ +RAKNAR  K+R
Sbjct: 936 GIHVKGHNNAPGMTNELRSADQIRKQRVVKDKRRAKNARVGKKR 979

>TDEL0D04630 Chr4 complement(849268..852174) [2907 bp, 968 aa] {ON}
           Anc_3.159 YDL031W
          Length = 968

 Score = 1216 bits (3145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/943 (64%), Positives = 728/943 (77%), Gaps = 30/943 (3%)

Query: 51  QDVIDYSDSEHQQEDNKIARKEKQKKQDIDKSFPILELXXXXXXXXXXXXXXXXXXXXXX 110
           QD+I+YSD E + +  K     K      DKSFP LE                       
Sbjct: 54  QDIIEYSDEEEEHQHEKKKSAPK------DKSFPKLE-------------ASGDEAEDDA 94

Query: 111 XXINAYFSTTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDI 170
             +N YFSTT     KHKKGSFPSFGLSK+I+ NI+++GF QPTPIQRKTIPLILQ+RDI
Sbjct: 95  DDVNEYFSTTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDI 154

Query: 171 VGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLR 230
           VG+ARTGSGKTAAFILPMI K+K+HSSK+GARAVILSPSRELAMQTH VFK+FS+GT LR
Sbjct: 155 VGLARTGSGKTAAFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLR 214

Query: 231 SVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMG 290
           SVLLTGGDSLE+QFGMMM+NPDVI+ATPGRFLHLKVEM+LDLKSIEYAVFDE+DRLFEMG
Sbjct: 215 SVLLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMG 274

Query: 291 FQDQLNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFL 350
           F++QLNELLA+LPSNRQTLLFSATLP+SLVDFAKAGLTNPVLVRLD ESKISENLEMLFL
Sbjct: 275 FEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFL 334

Query: 351 STKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXX 410
           STK+DEREA LLYL+Q+VI+IPLAT+EQ +   D+                         
Sbjct: 335 STKHDEREAALLYLIQEVIQIPLATEEQIKLIKDKSPDSDEESDDDNGKRSHNKHKKEKF 394

Query: 411 XXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYN 470
               R+P ANQLPSEK+TILFVPTRHHVEYI+ LLK+ GYL+SYIYG+LDQ AR RQLYN
Sbjct: 395 KKV-RMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYN 453

Query: 471 FRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           FR GLTSILVVTDVAARGVDIPMLANVINFS P+SSKIF+HRVGRTARAGNRGWAYSI+S
Sbjct: 454 FRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513

Query: 531 XXXXXXXXXXXXXXGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPKIAYTDRLILGS 590
                         GKKI+ TPMY++  ++++ +W+ EG ++  F  PK +YT+RL+LGS
Sbjct: 514 ESELPYLLDLELFLGKKILTTPMYEAATDLLEKRWVEEGKEKILFKAPKPSYTNRLVLGS 573

Query: 591 APRLEVEGLGDLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESLKRSKEIIASGW 650
            PRL+++ +GDLYKN+M ++FEL+ ++ VA KAEKLY RTRT+AS ES+KRS+E++ SGW
Sbjct: 574 CPRLDIDSMGDLYKNLM-SSFELETLRGVAKKAEKLYLRTRTAASVESVKRSRELMTSGW 632

Query: 651 DEQNVLFGKNQEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQLAPIQRKA 710
           DEQNV+FGKN EKEKLDFLAKLQ+R NKETVFEF+RN DDE S+ MK+RR Q+API  KA
Sbjct: 633 DEQNVMFGKNLEKEKLDFLAKLQDRTNKETVFEFARNADDETSMLMKKRRFQVAPITEKA 692

Query: 711 RERKELLQMEKMAGLTHSVEDEILKGDDNE-AGYSVSEDTLKQQFQDADELLADQENXXX 769
           ++RKELL+++K AG +H++EDE+L  +DNE    SV E+ L Q+F+DAD+LL DQE    
Sbjct: 693 KKRKELLELQKAAGFSHAMEDELL--NDNELIKESVPEEVL-QEFEDADKLLEDQEK--- 746

Query: 770 XXXXXXXXXXXPNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQVHKQTA 829
                      PNFFLSHYAP G + + +L LT+GF  DAA+ A D+N DDKVQVHKQ A
Sbjct: 747 LGRKKSKSFRDPNFFLSHYAPQGGLHENELNLTSGFTTDAAQAACDINGDDKVQVHKQNA 806

Query: 830 MVKWDKKRKKYVNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKPLKVGARETT 889
            VKWD K+KKY+N+QG DNKKYI+GE GQKI ASFRSGK+ EW+K R ++P+KVGARE+ 
Sbjct: 807 TVKWDSKKKKYINSQGADNKKYIVGESGQKIPASFRSGKYAEWSKARNLQPIKVGARESP 866

Query: 890 IPSNILANPTNGSHGSQGN-TIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKALANGIQ 948
             +N+L NP   +H + G  T+ GKFKHKQ+KAPK+PDKHRDDYH QKKKV++AL  GI 
Sbjct: 867 TAANMLRNPAQ-NHPTDGQRTVGGKFKHKQVKAPKLPDKHRDDYHKQKKKVKEALDKGIN 925

Query: 949 VRGYGNAPGMSNELKSTEQIMKDRNVKENKRAKNARPSKRRKF 991
           V+GY       NEL+S  QI K R   E K AKNARPSK+RK+
Sbjct: 926 VKGYNTRGAPKNELQSIAQIRKQRQTSEKKHAKNARPSKKRKY 968

>TBLA0B01590 Chr2 (349441..352230) [2790 bp, 929 aa] {ON} Anc_3.159
           YDL031W
          Length = 929

 Score =  929 bits (2402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/962 (53%), Positives = 638/962 (66%), Gaps = 91/962 (9%)

Query: 49  DVQDVIDYSDSEHQQ-EDNKIARKEKQKKQDIDKSFPILELXXXXXXXXXXXXXXXXXXX 107
           +VQD I+YSD++ ++ +++K   KE   K   D  FP L+                    
Sbjct: 39  EVQDEIEYSDNQEEEVKEDKRTDKENNTKSKND--FPQLD--------------GNVEVE 82

Query: 108 XXXXXINAYFSTTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQN 167
                IN YF+TT+L+  K KKGSF SFG ++ I+ NI K+G++QPTPIQRKTIPLILQ 
Sbjct: 83  SDDDDINDYFATTHLDTKKFKKGSFASFGFNRFIMNNINKKGYKQPTPIQRKTIPLILQK 142

Query: 168 RDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT 227
           RDIVGMARTGSGKTAAF+LPMI K+KTHSSKIG R VILSPSRE+A+QTH VFKEFSK T
Sbjct: 143 RDIVGMARTGSGKTAAFLLPMIEKLKTHSSKIGVRGVILSPSREIAIQTHRVFKEFSKNT 202

Query: 228 QLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF 287
           +LRSVLLTGGDSLEDQFGMMM+NPDV+IATPGRFLHLKVEM LDLKS+EY VFDEADRLF
Sbjct: 203 ELRSVLLTGGDSLEDQFGMMMSNPDVVIATPGRFLHLKVEMKLDLKSVEYIVFDEADRLF 262

Query: 288 EMGFQDQLNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEM 347
           EMGF++QLNELLA+LP NRQ+LLFSATLP+SLV+FAKAGL NPVLV+LD ESKIS+NLEM
Sbjct: 263 EMGFEEQLNELLAALPDNRQSLLFSATLPNSLVEFAKAGLKNPVLVKLDQESKISDNLEM 322

Query: 348 LFLSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXX 407
           LFLS K +ERE+NLL+LLQDVI +P+A+ E+ ++F                         
Sbjct: 323 LFLSCKKEERESNLLFLLQDVIGVPVASTEEMKRFQTDSREVEEKEEKEKEKGKEKEKRA 382

Query: 408 XXXXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQ 467
                  +   ++++P E+ATI+FVPTRHHVEYISQLL   GYL+SY+YGTLDQHAR+ Q
Sbjct: 383 -------KYYKSDEIPHEQATIIFVPTRHHVEYISQLLMKCGYLVSYLYGTLDQHARRNQ 435

Query: 468 LYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYS 527
           L  F  G+T ILVVTDVAARGVDIP+L NVIN+SLP SSKIF+HRVGRTARAGNRGWAYS
Sbjct: 436 LRQFCFGITRILVVTDVAARGVDIPLLPNVINYSLPGSSKIFVHRVGRTARAGNRGWAYS 495

Query: 528 IVSXXXXXXXXXXXXXXGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPKIAYTDRLI 587
           IVS              GKK++ T M + L                SF   KI+Y   ++
Sbjct: 496 IVSESELPYLVELGTFLGKKVITTGMVEKLG--------------VSF--DKISYNKWMV 539

Query: 588 LGSAPRLEVEGLGDLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESLKRSKEIIA 647
           LGS PR++VE  GDLYKN+    F+L++ K    KAEKLY RTR  AS +S+KRSKE+I 
Sbjct: 540 LGSGPRVDVESFGDLYKNVYDQEFDLQMSKKTCEKAEKLYLRTRGGASNDSVKRSKELIL 599

Query: 648 SGWDEQNVLFGKNQEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQLAPIQ 707
             WD QNV FG++ E+ KL+ L K   R+NKETVFEF +N +DEMS  M RR + +  I+
Sbjct: 600 QKWDGQNVKFGQDLERAKLELLNKFALRKNKETVFEFGKNGEDEMSTLMNRRWKVVKGIE 659

Query: 708 RKARERKELLQMEKMAGLTHSVEDEILKGDDNEAGYS------VSEDTLKQQFQDADELL 761
           RKA+ R+E+ + E+         +E L                V        F+D D +L
Sbjct: 660 RKAKRRREMKEEEEGGVEEELQFEEELGSGSGPGPGQGPGQDLVDAGNYNGVFEDGDAIL 719

Query: 762 ADQENXXXXXXXXXXXXXXPNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDK 821
             Q                  FFLSHYA    ++++  E+  GF+N A++ +YDLNND+K
Sbjct: 720 NGQ-------TKKRKTFKDERFFLSHYADPKKVENE--EVVDGFINAASEASYDLNNDEK 770

Query: 822 VQVHKQ-TAMVKWDKKRKKYVNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKP 880
           +QVHKQ +A VKWD+KRKKYVN QG+DNKKYIIGE G+KI A+FRSGK++EWAK R +  
Sbjct: 771 IQVHKQSSATVKWDRKRKKYVNLQGIDNKKYIIGESGRKIPATFRSGKYEEWAKARNINT 830

Query: 881 ---LKVGARETTIPSNILANPTNGSHGSQGNTI-------RGKFKHKQMKAPKMPDKHRD 930
              ++VGARE                 S+G+ +        G+FKHK  K PKMPDK+RD
Sbjct: 831 RNVMRVGARE-----------------SEGSVVGGGRGGGGGRFKHKLDKKPKMPDKYRD 873

Query: 931 DYHIQKKKVEKALANGIQ--VRGYGNAPGMSNELKSTEQIMKDRNVKENKRAKNARPSKR 988
           DY  QK+K E+A+  G+    RGY       +ELK+  +I K+R  KE +RAKN RP + 
Sbjct: 874 DYKKQKEKNERAVERGVMKGKRGY------KDELKNVAEIRKNRVEKEKRRAKNGRPGRE 927

Query: 989 RK 990
           R+
Sbjct: 928 RR 929

>CAGL0D03124g Chr4 complement(321029..323206) [2178 bp, 725 aa] {ON}
           highly similar to uniprot|P32892 Saccharomyces
           cerevisiae YLL008w DRS1 RNA helicase of the DEAD box
           family
          Length = 725

 Score =  235 bits (600), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 139/415 (33%), Positives = 222/415 (53%), Gaps = 57/415 (13%)

Query: 119 TTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGS 178
           + N +K  HK  +F    LS+ ++  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGS
Sbjct: 197 SENAKKEVHK--TFNDLALSRPVMKGLSNLGYVKPSPIQSATIPIALLGKDIIAGAVTGS 254

Query: 179 GKTAAFILPMIRKIKTHSSKIGA-RAVILSPSRELAMQTHNVFKEFSK-GTQLRSVLLTG 236
           GKTAAF++P+I ++    +K+ + R ++L+P+RELA+Q  +V K+  +  + L   L  G
Sbjct: 255 GKTAAFMIPIIERLLYKPAKVASTRVIVLTPTRELAIQVADVGKKIGQFVSNLTFGLAVG 314

Query: 237 GDSLEDQFGMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQL 295
           G +L  Q  M+   PD++IATPGRF+ H++   S ++ S+E  V DEADR+ E GFQD+L
Sbjct: 315 GLNLRQQEQMLKTRPDIVIATPGRFIDHIRNSASFNVDSVEVLVIDEADRMLEDGFQDEL 374

Query: 296 NELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLST-KN 354
           NE+++ LPS RQTLLFSAT+ S +       L  PV + +D   + +  L   F+   K 
Sbjct: 375 NEIMSLLPSKRQTLLFSATMNSRIKQLISLSLKRPVRIMIDPPKQAATKLTQEFVRIRKR 434

Query: 355 DEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXE 414
           D  + +LL+ L                                                 
Sbjct: 435 DHLKPSLLFNL-----------------------------------------------IR 447

Query: 415 RLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTG 474
           +L P  Q    K  ++FV  +     +  +L   G  ++ ++G+L Q  R   +  F++ 
Sbjct: 448 KLDPNGQ----KRIVVFVARKDMAHKLRIILGLLGMAVAELHGSLTQEQRLDSVNKFKSL 503

Query: 475 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
              +L+ TD+A+RG+DIP +  VIN+ +P S +I++HRVGRTARAG  G + + V
Sbjct: 504 QVPVLICTDLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSITFV 558

>YLL008W Chr12 (131729..133987) [2259 bp, 752 aa] {ON}
           DRS1Nucleolar DEAD-box protein required for ribosome
           assembly and function, including synthesis of 60S
           ribosomal subunits; constituent of 66S pre-ribosomal
           particles
          Length = 752

 Score =  234 bits (597), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 143/414 (34%), Positives = 217/414 (52%), Gaps = 61/414 (14%)

Query: 123 EKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTA 182
           E  K    +F S  LS+ ++  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTA
Sbjct: 224 EAKKQMYENFNSLSLSRPVLKGLASLGYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTA 283

Query: 183 AFILPMIRKIKTHSSKIGA-RAVILSPSRELAMQTHNVFKEFSK-GTQLRSVLLTGGDSL 240
           AF++P+I ++    +KI + R ++L P+RELA+Q  +V K+ ++  + +   L  GG +L
Sbjct: 284 AFMIPIIERLLYKPAKIASTRVIVLLPTRELAIQVADVGKQIARFVSGITFGLAVGGLNL 343

Query: 241 EDQFGMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELL 299
             Q  M+ + PD++IATPGRF+ H++   S ++ S+E  V DEADR+ E GFQD+LNE++
Sbjct: 344 RQQEQMLKSRPDIVIATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIM 403

Query: 300 ASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLST-KNDERE 358
             LPSNRQ LLFSAT+ S +       L  PV + +D   K +  L   F+   K D  +
Sbjct: 404 GLLPSNRQNLLFSATMNSKIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIRKRDHLK 463

Query: 359 ANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPP 418
             LL+ L                                                 +L P
Sbjct: 464 PALLFNL-----------------------------------------------IRKLDP 476

Query: 419 ANQLPSEKATILFVP---TRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGL 475
             Q    K  ++FV    T H +  I  LL   G  +  ++G+L Q  R   +  F+   
Sbjct: 477 TGQ----KRIVVFVARKETAHRLRIIMGLL---GMSVGELHGSLTQEQRLDSVNKFKNLE 529

Query: 476 TSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
             +L+ TD+A+RG+DIP +  VIN+ +P S +I++HRVGRTARAG  G + + V
Sbjct: 530 VPVLICTDLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFV 583

>Smik_12.55 Chr12 (118743..120950) [2208 bp, 735 aa] {ON} YLL008W
           (REAL)
          Length = 735

 Score =  233 bits (594), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 143/414 (34%), Positives = 216/414 (52%), Gaps = 61/414 (14%)

Query: 123 EKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTA 182
           E  K    +F S  LS+ ++  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTA
Sbjct: 207 EAKKQLYDNFNSLSLSRPVLKGLASLGYAKPSPIQSATIPIALLGKDIIAGAVTGSGKTA 266

Query: 183 AFILPMIRKIKTHSSKIGA-RAVILSPSRELAMQTHNVFKEFSKGTQ-LRSVLLTGGDSL 240
           AF++P+I ++    +KI + R ++L P+RELA+Q  +V K+ ++    +   L  GG +L
Sbjct: 267 AFMIPIIERLLYKPAKIASTRVIVLLPTRELAIQVADVGKQIARFVSGITFGLAVGGLNL 326

Query: 241 EDQFGMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELL 299
             Q  M+ + PD++IATPGRF+ H++   S ++ S+E  V DEADR+ E GFQD+LNE++
Sbjct: 327 RQQEQMLKSRPDIVIATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIM 386

Query: 300 ASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLST-KNDERE 358
             LPSNRQ LLFSAT+ S +       L  PV + +D   K +  L   F+   K D  +
Sbjct: 387 GLLPSNRQNLLFSATMNSKIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIRKRDHLK 446

Query: 359 ANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPP 418
             LL+ L                                                 +L P
Sbjct: 447 PALLFNL-----------------------------------------------IRKLDP 459

Query: 419 ANQLPSEKATILFVP---TRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGL 475
             Q    K  ++FV    T H +  I  LL   G  +  ++G+L Q  R   +  F+   
Sbjct: 460 VGQ----KRIVVFVARKETAHRLRIIMGLL---GMSVGELHGSLTQEQRLDSVNKFKNLE 512

Query: 476 TSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
             +L+ TD+A+RG+DIP +  VIN+ +P S +I++HRVGRTARAG  G + + V
Sbjct: 513 VPVLICTDLASRGLDIPKIEVVINYDMPKSHEIYLHRVGRTARAGREGRSVTFV 566

>ZYRO0B10318g Chr2 complement(808717..810969) [2253 bp, 750 aa] {ON}
           similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 750

 Score =  231 bits (588), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 138/420 (32%), Positives = 223/420 (53%), Gaps = 58/420 (13%)

Query: 116 YFSTTNLEKSKHKK-GSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMA 174
           Y   +  E++K K   +F S  LS+ ++  +   G+  P+PIQ  TIP+ L  +DI+  A
Sbjct: 222 YAPQSESEEAKKKVFNNFNSLSLSRPVLKALGDLGYATPSPIQGATIPIALLGKDIIAGA 281

Query: 175 RTGSGKTAAFILPMIRKIKTHSSKIGA-RAVILSPSRELAMQTHNVFKEFSKGTQ-LRSV 232
            TGSGKTAAF++P+I ++    +K+ + R ++L+P+RELA+Q  +V K+  K    L   
Sbjct: 282 VTGSGKTAAFMIPIIERLIYKPAKVASTRVIVLAPTRELAIQVADVGKKLGKYVNGLTFG 341

Query: 233 LLTGGDSLEDQFGMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGF 291
           +  GG +L  Q  ++   PD++IATPGRF+ H++   S ++ S+E  V DEADR+ E GF
Sbjct: 342 IAVGGLNLRQQEQILKTRPDIVIATPGRFIDHIRNSSSFNVDSVEVLVIDEADRMLEEGF 401

Query: 292 QDQLNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLS 351
           QD++NE++  LPS RQT+LFSAT+ S +       L  PV V  D   +    L+  F+ 
Sbjct: 402 QDEINEIMHLLPSKRQTMLFSATMNSKIKQLVSLSLKRPVRVMTDPPQQAVSKLQQEFVR 461

Query: 352 TKNDE--REANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXX 409
            +  +  + + L YL++                                           
Sbjct: 462 IRKRDHLKPSTLFYLIK------------------------------------------- 478

Query: 410 XXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLY 469
                +L  A Q    K  ++FV  +  V  +  +L   G  ++ ++G+L+Q  R + + 
Sbjct: 479 -----KLDGAAQ----KRMVVFVSKKEMVHRLRIILGLLGMAVAELHGSLNQEQRLQSIN 529

Query: 470 NFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
            F++    +L+ TD+A+RG+DIP +  VIN+ +P S +I++HRVGRTARAG  G + S V
Sbjct: 530 KFKSLEVPVLICTDLASRGLDIPKIEVVINYDMPKSFEIYLHRVGRTARAGREGRSVSFV 589

>Kpol_534.53 s534 (137204..139462) [2259 bp, 752 aa] {ON}
           (137204..139462) [2259 nt, 753 aa]
          Length = 752

 Score =  229 bits (584), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 135/404 (33%), Positives = 215/404 (53%), Gaps = 57/404 (14%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F S  LS+ ++  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+I 
Sbjct: 232 TFNSLTLSRPVLKGLSDLGYTKPSPIQSATIPIGLSGKDIIAGAVTGSGKTAAFMIPIIE 291

Query: 191 KIKTHSSKIGA-RAVILSPSRELAMQTHNVFKEFSKGTQ-LRSVLLTGGDSLEDQFGMMM 248
           ++    +K+ + R ++L+P+RELA+Q  +V K+  K    L   L  GG +L  Q   + 
Sbjct: 292 RLLYKPAKVASTRVIVLTPTRELAIQIADVGKKIGKYVSGLTFGLAVGGLNLRQQEQELK 351

Query: 249 NNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
             PD++IATPGRF+ H++   S ++ S+E  V DEADR+ E GFQ++LNE+L  LPS RQ
Sbjct: 352 TRPDIVIATPGRFIDHVRNSSSFNVDSVEVLVMDEADRMLEEGFQEELNEILTLLPSKRQ 411

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDE--REANLLYLL 365
           TLLFSAT+ S +       L  PV + ++   + +  L   F+  +  +  + A L YL+
Sbjct: 412 TLLFSATMNSRIKSLISLSLRKPVRIMINPPKQAAARLTQEFVRIRKRDHLKPALLFYLI 471

Query: 366 QDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSE 425
                         RK +                                         +
Sbjct: 472 --------------RKLDGT--------------------------------------GQ 479

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K  ++FV  +     +  +L   G  +  ++G+L Q  R + + NF++    +L+ TD+A
Sbjct: 480 KRIVVFVARKEMAHKLRIILGLLGMKVGELHGSLTQEQRLQSVNNFKSLEVPVLICTDLA 539

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           +RG+DIP +  VINF +P S +I++HRVGRTARAG  G + + V
Sbjct: 540 SRGLDIPKIEVVINFDMPKSYEIYLHRVGRTARAGREGRSVTFV 583

>KNAG0H02520 Chr8 complement(463527..465791) [2265 bp, 754 aa] {ON}
           Anc_5.208 YLL008W
          Length = 754

 Score =  229 bits (584), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 140/416 (33%), Positives = 221/416 (53%), Gaps = 71/416 (17%)

Query: 126 KHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           K    +F S  LS+ ++  +   G+ +P+PIQ  TIP+ LQ +D++  A TGSGKTAAF+
Sbjct: 235 KQTHETFNSLSLSRPVLKGLAHLGYTKPSPIQSATIPVALQGKDVIAGAVTGSGKTAAFM 294

Query: 186 LPMIRKIKTHSSKIG-ARAVILSPSRELAMQTHNVFK---EFSKGTQLRSVLLTGGDSLE 241
           +P+I ++    SK+   R ++L+P+RELA+Q  +V K   +F  G  L   L  GG +L 
Sbjct: 295 IPIIERLLFKPSKVAMTRVIVLTPTRELAIQISDVAKKIGQFVSG--LTFGLAVGGLNLR 352

Query: 242 DQFGMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLA 300
            Q   +   PD++IATPGRF+ H++   S ++ S+E  V DEADR+ E GFQD+L E++ 
Sbjct: 353 QQEQALKARPDIVIATPGRFIDHIRNSASFNVDSVEILVLDEADRMLEEGFQDELKEIMT 412

Query: 301 SLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLD----AESKISENLEMLFLSTKNDE 356
            LPS RQ LLFSAT+ S +       L  PV + +D    A SK+++  E + +  +++ 
Sbjct: 413 MLPSKRQNLLFSATMNSKIKSLVSLSLRRPVRIMIDPPKQAASKLTQ--EFVRIRKRDNL 470

Query: 357 REANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERL 416
           + A L  L+              RK +                                 
Sbjct: 471 KPALLFNLI--------------RKLDSN------------------------------- 485

Query: 417 PPANQLPSEKATILFVP---TRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRT 473
                  ++K  ++FV    T H +  I  LL   G  ++ ++G+L Q  R   +  F++
Sbjct: 486 -------AQKRIVVFVARKETAHRLRIILGLL---GMAVAELHGSLTQEQRLESVTRFKS 535

Query: 474 GLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
               +L+ TD+A+RG+DIP +  VIN+ +P S +I++HRVGRTARAG  G + ++V
Sbjct: 536 LDVPVLICTDLASRGLDIPKIEVVINYDMPKSHEIYLHRVGRTARAGREGRSVTLV 591

>KLLA0F15752g Chr6 (1454735..1456981) [2247 bp, 748 aa] {ON} similar
           to uniprot|P32892 Saccharomyces cerevisiae YLL008W DRS1
           Nucleolar DEAD-box protein required for ribosome
           assembly and function
          Length = 748

 Score =  229 bits (583), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 139/415 (33%), Positives = 217/415 (52%), Gaps = 57/415 (13%)

Query: 119 TTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGS 178
           + + +K  HK  +F S  LS+ ++  +   G+  P+PIQ   IP+ L  +DI+  A TGS
Sbjct: 224 SADAKKIVHK--TFNSLSLSRPVLKGLGSLGYTSPSPIQSAAIPIALLGKDIIAGAVTGS 281

Query: 179 GKTAAFILPMIRKIKTHSSKIGA-RAVILSPSRELAMQTHNVFKEFSKGTQ-LRSVLLTG 236
           GKTAAF++P+I ++    + I + R V+L+P+RELA+Q  +V K   K    L   L  G
Sbjct: 282 GKTAAFMIPIIERLLYKPAHIASTRVVVLTPTRELAIQVADVGKNIGKFVNGLTFGLAVG 341

Query: 237 GDSLEDQFGMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQL 295
           G +L  Q   +   PD++IATPGRF+ HL+   S  + S+E  V DEADR+ E GFQ++L
Sbjct: 342 GLNLRQQEQALKTRPDIVIATPGRFIDHLRNSASFSVDSVEILVIDEADRMLEEGFQEEL 401

Query: 296 NELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLST-KN 354
            E+++ +PS RQTLLFSAT+ S +       L  PV + +D   + ++ L   F+   K 
Sbjct: 402 QEIMSLIPSKRQTLLFSATMNSKIKQLISLSLKKPVRIMIDPPKQAADKLTQEFIRIRKR 461

Query: 355 DEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXE 414
           D  +  LLY L              RK ++                              
Sbjct: 462 DHLKPALLYQL-------------IRKLDNT----------------------------- 479

Query: 415 RLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTG 474
                    S+K  ++FV  +     +  +L   G  +  ++G+L Q  R + + NF++ 
Sbjct: 480 ---------SQKRIVVFVARKETAHKLRIVLGLLGMQVGELHGSLTQEQRLQSVNNFKSL 530

Query: 475 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
              +L+ TD+A+RG+DIP +  VINF +P + +I++HRVGRTARAG  G + + V
Sbjct: 531 QVPVLICTDLASRGLDIPKIEVVINFDMPKTYEIYLHRVGRTARAGREGRSVTFV 585

>Skud_12.59 Chr12 (122973..125249) [2277 bp, 758 aa] {ON} YLL008W
           (REAL)
          Length = 758

 Score =  228 bits (580), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 135/411 (32%), Positives = 213/411 (51%), Gaps = 55/411 (13%)

Query: 123 EKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTA 182
           E  K    +F S  LS+ ++  +   G+  P+PIQ  TIP+ L  +DI+  A TGSGKTA
Sbjct: 230 EAKKQMYDNFNSLSLSRPVLKGLANLGYVTPSPIQSATIPIALLGKDIIAGAVTGSGKTA 289

Query: 183 AFILPMIRKIKTHSSKIGA-RAVILSPSRELAMQTHNVFKEFSKGT-QLRSVLLTGGDSL 240
           AF++P+I ++    +KI + R ++L P+RELA+Q  +V K+ ++    +   L  GG +L
Sbjct: 290 AFMIPIIERLLYKPAKIASTRVIVLLPTRELALQVADVGKQIARFVPSITFGLAVGGLNL 349

Query: 241 EDQFGMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELL 299
             Q  M+ + PD++IATPGRF+ H++   S ++ S+E  V DEADR+ E GFQD+LNE++
Sbjct: 350 RQQEQMLKSRPDIVIATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIM 409

Query: 300 ASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLST-KNDERE 358
             LPS+RQ LLFSAT+ S +       L  PV + +D   K +  L   F+   K D  +
Sbjct: 410 GLLPSSRQNLLFSATMNSKIKSLVSLSLKRPVRIMIDPPKKAATKLTQEFVRIRKRDHLK 469

Query: 359 ANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPP 418
             L++ L                                                 +L P
Sbjct: 470 PALIFNL-----------------------------------------------IRKLDP 482

Query: 419 ANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSI 478
             Q    K  ++FV  +     +  ++   G  +  ++G+L Q  R   +  F+     +
Sbjct: 483 MAQ----KRIVVFVARKESAHRLRIIMGLLGMSVGELHGSLTQEQRLDSVSKFKNLEVPV 538

Query: 479 LVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           L+ TD+A+RG+DIP +  VIN+ +P S ++++HRVGRTARAG  G + + V
Sbjct: 539 LICTDLASRGLDIPKIEVVINYDMPKSHEVYLHRVGRTARAGREGRSVTFV 589

>Suva_10.67 Chr10 (136688..138922) [2235 bp, 744 aa] {ON} YLL008W
           (REAL)
          Length = 744

 Score =  227 bits (579), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 138/406 (33%), Positives = 214/406 (52%), Gaps = 61/406 (15%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F S  LS+ ++  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+I 
Sbjct: 224 NFNSLSLSRPVLKGLASLGYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIE 283

Query: 191 KIKTHSSKIGA-RAVILSPSRELAMQTHNVFKEFSK-GTQLRSVLLTGGDSLEDQFGMMM 248
           ++     KI + R ++L P+RELA+Q  +V K+ ++  + +   L  GG +L  Q  ++ 
Sbjct: 284 RLLYKPGKIASTRVIVLLPTRELALQVADVGKQIARFVSGITFGLAVGGLNLRQQEQLLK 343

Query: 249 NNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
           + PD++IATPGRF+ H++   S ++ S+E  V DEADR+ E GFQD+LNE++  LPSNRQ
Sbjct: 344 SRPDIVIATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIMGLLPSNRQ 403

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLST-KNDEREANLLYLLQ 366
            LLFSAT+ S +       L  PV + +D   + +  L   F+   K D  +  LL+ L 
Sbjct: 404 NLLFSATMNSKIKSLVSLSLRRPVRIMIDPPKQAATKLTQEFVRIRKRDHLKPALLFNL- 462

Query: 367 DVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 426
                                                           +L P  Q    K
Sbjct: 463 ----------------------------------------------IRKLDPMGQ----K 472

Query: 427 ATILFVP---TRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 483
             ++FV    T H +  I  LL   G  +  ++G+L Q  R   +  F+     +LV TD
Sbjct: 473 RIVVFVARKETAHRLRIIMGLL---GMSVGELHGSLTQEQRLDSVNKFKNLEVPVLVCTD 529

Query: 484 VAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           +A+RG+DIP +  V+N+ +P S +I++HRVGRTARA   G + ++V
Sbjct: 530 LASRGLDIPKIEVVVNYDMPKSYEIYLHRVGRTARADREGRSVTLV 575

>SAKL0G12760g Chr7 complement(1088344..1090557) [2214 bp, 737 aa]
           {ON} similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 737

 Score =  227 bits (578), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 135/403 (33%), Positives = 215/403 (53%), Gaps = 55/403 (13%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF S  LS+ ++  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAA+++P+I 
Sbjct: 224 SFNSLSLSRPVLKGLGALGYVKPSPIQGATIPIALLGKDIIAGAVTGSGKTAAYMIPIIE 283

Query: 191 KIKTHSSKIGA-RAVILSPSRELAMQTHNVFKEFSKGTQ-LRSVLLTGGDSLEDQFGMMM 248
           ++    +++ + R V+L+P+RELA+Q  +V K+  K    L   L  GG +L  Q   + 
Sbjct: 284 RLLYKPAQVASTRVVVLAPTRELAIQVADVGKKIGKFVNGLTFGLAVGGLNLRQQEQTLK 343

Query: 249 NNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
             PD++IATPGRF+ H++   S  + S+E  V DEADR+ E GF D+LNE+++ +PS RQ
Sbjct: 344 LRPDIVIATPGRFIDHIRNSASFSVDSVEVLVIDEADRMLEEGFHDELNEIMSLIPSKRQ 403

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLST-KNDEREANLLYLLQ 366
           TLLFSAT+ S +       L  PV + +D   + +  L   F+   K D  +  LL+ L 
Sbjct: 404 TLLFSATMNSKIKQLVSLSLKKPVRIMIDPPKQAAAKLTQEFVRIRKRDHLKPALLFHL- 462

Query: 367 DVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 426
                        RK ++                                       S+K
Sbjct: 463 ------------IRKIDET--------------------------------------SQK 472

Query: 427 ATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 486
             ++FV  +     +  +L   G  ++ ++G+L Q  R + + +F++    +L+ TD+A+
Sbjct: 473 RIVVFVSRKEMAHRLRIILGLLGMKVAELHGSLTQEQRLQSVNSFKSLDVPVLICTDLAS 532

Query: 487 RGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           RG+DIP +  VINF +P + +I++HRVGRTARAG  G + S V
Sbjct: 533 RGLDIPKIEVVINFDMPKTYEIYLHRVGRTARAGREGRSVSFV 575

>TBLA0C06160 Chr3 (1494579..1496852) [2274 bp, 757 aa] {ON}
           Anc_5.208 YLL008W
          Length = 757

 Score =  227 bits (578), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 139/414 (33%), Positives = 215/414 (51%), Gaps = 61/414 (14%)

Query: 123 EKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTA 182
           E  K    +F +  LS+ ++  +   G+ +P+PIQ   IP+ L  +DI+  A TGSGKTA
Sbjct: 229 EAKKQVHNTFNTLSLSRPVLKGLAALGYSKPSPIQSAAIPIALLGKDIIAGAVTGSGKTA 288

Query: 183 AFILPMIRKIKTHSSKI-GARAVILSPSRELAMQTHNVFKEFSKGTQLRSV-LLTGGDSL 240
           AF++P+I ++    +K+   R ++L+P+RELA+Q  +V K+  K     +  L  GG +L
Sbjct: 289 AFMIPIIERLLYKPAKVTSTRVIVLTPTRELAIQVSDVGKKVGKFVNGVTFGLAVGGLNL 348

Query: 241 EDQFGMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELL 299
             Q   + + PD+++ATPGRF+ H++   S ++ S+E  V DEADR+ E GFQD+LNE++
Sbjct: 349 RQQEQQLKSRPDIVVATPGRFIDHIRNSASFNVDSVEILVIDEADRMLEDGFQDELNEIM 408

Query: 300 ASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLST-KNDERE 358
           + LPS RQTLLFSAT+ S +       L  PV + +D   + +  L   F+   K D  +
Sbjct: 409 SLLPSKRQTLLFSATMNSKIKQLISLSLKKPVRIMIDPPKQAAAKLVQEFVRIRKRDNLK 468

Query: 359 ANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPP 418
             LLY L                                                 +L  
Sbjct: 469 PALLYTL-----------------------------------------------IRKLDG 481

Query: 419 ANQLPSEKATILFVP---TRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGL 475
           A Q    K  ++FV    T H +  I  LL   G  +  ++G+L Q  R   +  F++  
Sbjct: 482 AGQ----KRIVVFVARKETAHKLRIILGLL---GQSVGELHGSLTQEQRLDSVNKFKSLE 534

Query: 476 TSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
             +L+ TD+A+RG+DIP +  VIN+ +P S +I++HRVGRTARAG  G + + V
Sbjct: 535 VPVLLCTDLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFV 588

>KLTH0B03278g Chr2 complement(257395..259614) [2220 bp, 739 aa] {ON}
           similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 739

 Score =  225 bits (574), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 136/415 (32%), Positives = 221/415 (53%), Gaps = 57/415 (13%)

Query: 119 TTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGS 178
           +T  +K+ H   +F S  LS+ ++  +    + +P+PIQ  TIP+ L  +DI+  A TGS
Sbjct: 214 STEAKKTVHT--NFNSLSLSRPVLKGLGALNYVKPSPIQSATIPIALLGKDIIAGAVTGS 271

Query: 179 GKTAAFILPMIRKIKTHSSKIGA-RAVILSPSRELAMQTHNVFKEFSKGTQLRSV-LLTG 236
           GKTAA+++P+I ++    ++I + R ++L+P+RELA+Q  +V  + +K     S  L  G
Sbjct: 272 GKTAAYMIPIIERLLYKPAQIASTRVIVLTPTRELAIQVSDVGAKLAKFVNGISFGLAVG 331

Query: 237 GDSLEDQFGMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQL 295
           G +L  Q   + + PD++IATPGR + H++   S ++ S+E  V DEADR+ E GFQD+L
Sbjct: 332 GLNLRQQEQTLRSRPDIVIATPGRLIDHIRNSASFNVDSVEILVIDEADRMLEEGFQDEL 391

Query: 296 NELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLST-KN 354
           NE+++ +PS RQTLLFSAT+ S +       L  PV + +D   + +  L   F+   K 
Sbjct: 392 NEIMSLIPSKRQTLLFSATMNSKINQLISLSLKKPVKIMIDPPRQAAAKLTQEFVRVRKR 451

Query: 355 DEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXE 414
           DE +  LL+ L              RK +D                              
Sbjct: 452 DELKPALLFHL-------------IRKLDDL----------------------------- 469

Query: 415 RLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTG 474
                    S+K  ++FV  +     +  +L   G  ++ ++G+L Q  R + +  F++ 
Sbjct: 470 ---------SQKRVVVFVARKEVAHKLRIILGLLGMKVAELHGSLSQEQRLQAVNGFKSL 520

Query: 475 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
              +L+ TD+A+RG+DIP +  VIN+ +P +  I++HRVGRTARAG  G + S V
Sbjct: 521 QVPVLICTDLASRGLDIPKIEFVINYDMPKTYDIYLHRVGRTARAGREGRSISFV 575

>Kwal_33.15165 s33 (987878..990073) [2196 bp, 731 aa] {ON} YLL008W
           (DRS1) - putative ATP dependent RNA helicase [contig 94]
           FULL
          Length = 731

 Score =  224 bits (571), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 134/416 (32%), Positives = 221/416 (53%), Gaps = 59/416 (14%)

Query: 119 TTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGS 178
           +T   K+ H   +F S  LS+ ++  +    + +P+PIQ  TIP+ L  +DI+  A TGS
Sbjct: 206 STEARKAIHT--NFNSLSLSRPVLKGLGALNYVKPSPIQSATIPIALTGKDIIAGAVTGS 263

Query: 179 GKTAAFILPMIRKIKTHSSKIGA-RAVILSPSRELAMQTHNVFKEFSKGTQ-LRSVLLTG 236
           GKTAA+++P+I ++    +++ + R ++L+P+RELA+Q  +V  + +K    +   L  G
Sbjct: 264 GKTAAYMIPIIERLLYKPAQVSSTRVIVLAPTRELAIQVSDVGTKLAKYVNGINFGLAVG 323

Query: 237 GDSLEDQFGMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQL 295
           G +L  Q   +   PDV+IATPGR + H++   S ++ S+E  V DEADR+ E GFQD+L
Sbjct: 324 GLNLRQQEQALRARPDVVIATPGRLIDHIRNSASFNVDSVEILVIDEADRMLEDGFQDEL 383

Query: 296 NELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENL--EMLFLSTK 353
           NE+++ +PS RQTLLFSAT+ S +       L  PV + +D   + +  L  E + +  +
Sbjct: 384 NEIMSLIPSKRQTLLFSATMNSKINQLISLSLKKPVRIMIDPPKQAAAKLVQEFVRVRKR 443

Query: 354 NDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXX 413
           +D + A L +L+              RK +D                             
Sbjct: 444 DDLKPALLFHLI--------------RKLDD----------------------------- 460

Query: 414 ERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRT 473
                     S+K  ++FV  +     +  +L   G  ++ ++G+L Q  R + +  F++
Sbjct: 461 ---------ASQKRVVVFVARKEMAHKLRIILGLLGMKVAELHGSLSQEQRLQAVNGFKS 511

Query: 474 GLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
               +L+ TD+A+RG+DIP +  VINF +P +  I++HRVGRTARAG  G + S V
Sbjct: 512 LQIPVLICTDLASRGLDIPKIEFVINFDMPKTYDIYLHRVGRTARAGREGRSISFV 567

>TPHA0N00700 Chr14 (157186..159453) [2268 bp, 755 aa] {ON} Anc_5.208
           YLL008W
          Length = 755

 Score =  224 bits (571), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 137/415 (33%), Positives = 219/415 (52%), Gaps = 63/415 (15%)

Query: 123 EKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTA 182
           E  K    +F +  LS+ ++  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTA
Sbjct: 213 EAKKQVHTNFNTLSLSRPVLKGLSDLGYTKPSPIQSATIPIGLLGKDIIAGAVTGSGKTA 272

Query: 183 AFILPMIRKIKTHSSKIGA-RAVILSPSRELAMQTHNVFKEFSKGTQ-LRSVLLTGGDSL 240
           AF++P+I ++    + I + R ++L+P+RELA+Q  +V K   K    L   L  GG +L
Sbjct: 273 AFMIPIIERLLYKPANIASTRVIVLTPTRELAIQVSDVGKRIGKYVNGLTFGLAVGGLNL 332

Query: 241 EDQFGMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELL 299
             Q   +   PDV+IATPGRF+ H++   S ++ S+E  V DEADR+ E GFQ++LNE++
Sbjct: 333 RQQEQELKTRPDVVIATPGRFIDHIRNSASFNVDSVEVLVIDEADRMLEDGFQEELNEIM 392

Query: 300 ASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDE--R 357
           + LP+ RQTLLFSAT+ S +       L  PV + ++   + +  L   F+  +  +  +
Sbjct: 393 SLLPTKRQTLLFSATMNSKIKQLISLSLRRPVRIMINPPKQAAARLTQEFVRIRKRDLLK 452

Query: 358 EANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLP 417
            A L YL+              RK +                                  
Sbjct: 453 PALLYYLI--------------RKLDSS-------------------------------- 466

Query: 418 PANQLPSEKATILFVPTR---HHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTG 474
                 S+K  ++FV  +   H +  I  LL   G  ++ ++G+L Q  R + +  F++ 
Sbjct: 467 ------SQKRIVVFVSRKEMAHRLRIIMGLL---GMKVAELHGSLTQEQRLQSVNQFKSL 517

Query: 475 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
              +L+ TD+A+RG+DIP +  VIN+ +P S +I++HRVGRTARAG  G + + V
Sbjct: 518 EVPVLICTDLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFV 572

>AAL164C Chr1 complement(55223..57427) [2205 bp, 734 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL008W
           (DRS1)
          Length = 734

 Score =  224 bits (570), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 134/405 (33%), Positives = 214/405 (52%), Gaps = 57/405 (14%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F S  LS+ ++  +   G+ +P+PIQ  TIP+ L  +D++  A TGSGKTAAF++P+I 
Sbjct: 220 TFNSLSLSRPVLKGLAALGYTKPSPIQGATIPIALLGKDVIAGAVTGSGKTAAFMIPIIE 279

Query: 191 KIKTHSSKIGA-RAVILSPSRELAMQTHNVFKEFSK-GTQLRSVLLTGGDSLEDQFGMMM 248
           ++    +KI + R ++L+P+RELA+Q  +V K+  K  + L   L  GG +L  Q   + 
Sbjct: 280 RLLYKPAKIASTRVLVLTPTRELAIQVADVGKKLGKFVSGLTFGLAVGGLNLRQQEQALK 339

Query: 249 NNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
             PD++IATPGR + H++   S  + S+E  V DEADR+ E GFQD+LNE+++ +PS RQ
Sbjct: 340 LRPDIVIATPGRIIDHIRNSASFSVDSVEVLVIDEADRMLEDGFQDELNEIMSLIPSKRQ 399

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDE--REANLLYLL 365
           TLLFSAT+ S +       L  PV + +D   + +  L   F+  +  E  + A L +LL
Sbjct: 400 TLLFSATMNSRIKQLISLSLKKPVRIMIDPPKQAANKLTQEFVRLRKREHLKPALLYHLL 459

Query: 366 QDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSE 425
                         RK +                                         +
Sbjct: 460 --------------RKLDS--------------------------------------TGQ 467

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K  ++FV  +     +  +L   G     ++G+L Q  R + + NF++    +LV TD+A
Sbjct: 468 KRIVVFVARKEVAHRLRVILGLLGMKAGELHGSLTQEQRLQSVNNFKSLDVPVLVCTDLA 527

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           +RG+DIP +  VIN+ +P + +I++HRVGRTARAG  G + ++V 
Sbjct: 528 SRGLDIPKIEVVINYDMPKTYEIYLHRVGRTARAGREGKSVTLVG 572

>Kwal_14.1653 s14 complement(406891..408957) [2067 bp, 688 aa] {ON}
           YBR237W (PRP5) - 1:1 [contig 238] PARTIAL
          Length = 688

 Score =  213 bits (541), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 130/407 (31%), Positives = 212/407 (52%), Gaps = 53/407 (13%)

Query: 132 FPSFGLSKIIVTNITKR-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +   GL+  I+  IT    F  PTPIQ + IP I+  RD++G+++TGSGKT +F+LPM+R
Sbjct: 109 WSQLGLTTDIMNLITNDFKFESPTPIQAQAIPAIMTGRDVIGISKTGSGKTVSFLLPMLR 168

Query: 191 KIKT----HSSKIGARAVILSPSRELAMQTHNVFKEFSKG-TQLRSVLLTGGDSLEDQFG 245
           +IK        + G   +IL+P+RELA+Q H    +F KG T+LRS+  TGG  L+ Q  
Sbjct: 169 QIKALRPLAREESGPLGLILAPTRELAVQIHEESMKFLKGNTRLRSICCTGGSELKQQIN 228

Query: 246 MMMNNPDVIIATPGRFLHLKVEMS---LDLKSIEYAVFDEADRLFEMGFQDQLNELLASL 302
            +    ++++ATPGRF+ L    S   ++ + I + V DEADRLF++GF+ Q+ E++ ++
Sbjct: 229 DLKKGVEIVVATPGRFIDLLTLNSGKLINTERITFVVMDEADRLFDLGFEPQITEIMKTV 288

Query: 303 PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLL 362
             ++Q +LFSAT PS L  FA   L  PV + ++++S I+EN+E      +NDE + N L
Sbjct: 289 RPDKQCVLFSATFPSKLKSFASRILHTPVSITINSKSLINENIEQKLQIHENDEEKFNSL 348

Query: 363 YLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 422
               +V+K  +  + +     D+                                     
Sbjct: 349 L---EVLKAQINREAESHDDKDEK------------------------------------ 369

Query: 423 PSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 482
                TI+FV ++   + I   L D  Y    I+     H R   L  F+     IL+ T
Sbjct: 370 -----TIIFVSSQQICDLIYLKLLDHNYTTYAIHAGKPYHERASNLEKFKNTRNGILLCT 424

Query: 483 DVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           +V +RG+++P ++ V+ ++   +   ++H  GRTAR   +G A S++
Sbjct: 425 EVLSRGLNVPEVSLVVIYNAVKTFAQYVHTTGRTARGDKKGTAISLL 471

>NDAI0F02010 Chr6 (492540..495206) [2667 bp, 888 aa] {ON} Anc_6.148
          Length = 888

 Score =  214 bits (545), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 122/408 (29%), Positives = 222/408 (54%), Gaps = 45/408 (11%)

Query: 132 FPSFGLSKIIVTNITKR-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +   GL+  ++  ITK  GFR  TPIQ + IP I+   D++G+++TGSGKT +++LP+IR
Sbjct: 288 WSQLGLNTDVMDLITKDFGFRSLTPIQSQAIPAIMDGHDVIGISKTGSGKTISYLLPLIR 347

Query: 191 KIKTHS----SKIGARAVILSPSRELAMQTHN-VFKEFSKGTQLRSVLLTGGDSLEDQFG 245
            IK  +    ++ G   +IL+P+RELA+Q H  + K  S  T + S+  TGG  L+ Q  
Sbjct: 348 HIKAQNPLMKNETGPLGLILAPTRELALQIHQEIIKFISTDTAITSICCTGGSELKQQIN 407

Query: 246 MMMNNPDVIIATPGRFLHLKVEMS---LDLKSIEYAVFDEADRLFEMGFQDQLNELLASL 302
            +     +++ATPGR + L    +   + +K + + + DEADRLF++GF+ Q+ +++ ++
Sbjct: 408 SLKKGVHIVVATPGRLIDLLTLNNGRLMSIKRVTFVIMDEADRLFDLGFEPQITQIMKTI 467

Query: 303 PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREAN-L 361
             ++Q +LFSAT P+ L +FA   L +P+ + ++++S ++E ++  F    NDE + + L
Sbjct: 468 RPDKQCVLFSATFPNKLRNFAMRILRDPLSITINSQSLVNERVQQRFHICANDEEKFDEL 527

Query: 362 LYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 421
           L ++++    P+ T +  ++  ++                                    
Sbjct: 528 LAMIEENSSEPIETTDLGKEEEEE-----------------------------------H 552

Query: 422 LPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVV 481
            P ++ TI+FV ++   ++I   L++ GY    I+       R + L NF++   SILV 
Sbjct: 553 TPQDRKTIIFVASQQICDFIGTKLENEGYQPFSIHAGKSYQERVQNLENFKSTKNSILVA 612

Query: 482 TDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           T+V +RG++I  ++ VI F+   +   ++H  GRTAR  + G A S++
Sbjct: 613 TEVLSRGLNITEVSLVIIFNAVKTFAQYVHTTGRTARGNHSGVAISLI 660

>CAGL0H03377g Chr8 complement(313755..315377) [1623 bp, 540 aa] {ON}
           highly similar to uniprot|P20447 Saccharomyces
           cerevisiae YGL078c DBP3
          Length = 540

 Score =  200 bits (508), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 127/404 (31%), Positives = 206/404 (50%), Gaps = 57/404 (14%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F    L K +   I K  F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I 
Sbjct: 131 AFNQISLDKEVQNEIAK--FPKPTPIQAVSWPYLLSGKDVIGVAETGSGKTFAFGVPAIN 188

Query: 191 KIKTHSSKI-GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMN 249
            + T SSK  G + +++SP+RELA Q ++     ++   +   ++ GG   +DQ   +  
Sbjct: 189 NLLTSSSKPKGIKVLVISPTRELASQIYDNLVLLTQKVGIDCCVVYGGVPKDDQRRQIAK 248

Query: 250 NPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-NRQT 308
           + +V++ATPGR L L  E S+DL  ++Y V DEADR+ E GF++ +  ++    S +RQT
Sbjct: 249 S-NVVVATPGRLLDLIEEGSVDLSPVDYMVLDEADRMLEKGFEEDIKRIIGQTKSKDRQT 307

Query: 309 LLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDER--EANLLYLLQ 366
           L+F+AT P  + + A   +  PV V +    ++S N  +  +    D R  E  LL LL+
Sbjct: 308 LMFTATWPKEVRELASTFMKEPVKVSIGNRDELSANKRITQIVEVVDPRSKERKLLDLLK 367

Query: 367 DVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 426
                P        K ND+                                         
Sbjct: 368 KYQSGP--------KKNDK----------------------------------------- 378

Query: 427 ATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 486
             ++F   +     + + L  +GY ++ I+G L Q  R + L  F++G +++L+ TDVAA
Sbjct: 379 -VLIFALYKKEASRVERNLNYNGYKVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAA 437

Query: 487 RGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           RG+DIP +  VIN + P + + ++HR+GRT RAG  G A+++ +
Sbjct: 438 RGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 481

>CAGL0L03846g Chr12 complement(443677..444047,445148..446411) [1635
           bp, 544 aa] {ON} highly similar to uniprot|P24783
           Saccharomyces cerevisiae YNL112w DBP2 ATP-dependent RNA
           helicase of DEAD box family
          Length = 544

 Score =  199 bits (506), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 119/404 (29%), Positives = 198/404 (49%), Gaps = 56/404 (13%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F   G    ++  +   GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 111 TFDEAGFPDYVLKEVKAEGFDKPTSIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 170

Query: 191 KIKTH---SSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            I      S   G   ++L+P+RELA+Q      +F K +++R+  + GG     Q   +
Sbjct: 171 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIREL 230

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
           +   +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +  +RQ
Sbjct: 231 IRGAEIVIATPGRLIDMLEAGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 290

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ESKISENLEMLFLSTKNDEREANLLYLLQ 366
           TL++SAT P  +   A+  L +P+ V++ + E   S N+  L       E+   L+  L 
Sbjct: 291 TLMWSATWPKEVQQLARDYLNDPIQVQIGSLELAASHNITQLVEVVSEFEKRDRLVKHLD 350

Query: 367 DVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 426
                  A+++++ K                                             
Sbjct: 351 ------TASQDKESKI-------------------------------------------- 360

Query: 427 ATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 486
             ++F  T+   + I+  L+  G+    I+G  DQ  R   L  FRTG + I+V TDVAA
Sbjct: 361 --LIFASTKRTCDEITSYLRQDGWPALAIHGDKDQRERDWVLNEFRTGNSPIMVATDVAA 418

Query: 487 RGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           RG+D+  +  V+N+ +P + + ++HR+GRT RAG  G A S  +
Sbjct: 419 RGIDVKGINFVVNYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 462

>Kpol_534.31 s534 complement(73551..76169) [2619 bp, 872 aa] {ON}
           complement(73551..76169) [2619 nt, 873 aa]
          Length = 872

 Score =  204 bits (519), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 119/410 (29%), Positives = 221/410 (53%), Gaps = 49/410 (11%)

Query: 132 FPSFGLSKIIVTNITKR-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +   GL   I+  ITK   + +PT IQ + IP I+  RD++G+++TGSGKT ++ILPM+R
Sbjct: 278 WSQLGLPTDIMNLITKELKYDEPTAIQSQAIPAIMSGRDLIGISKTGSGKTISYILPMLR 337

Query: 191 KIKTHSS----KIGARAVILSPSRELAMQTHNVFKEFSKGTQ-LRSVLLTGGDSLEDQFG 245
           +IK   +    + G   +IL+P+RELA+Q +   ++F+K  + +R++  TGG  ++ Q  
Sbjct: 338 QIKAQRTLSKNETGPLGLILAPTRELALQINEEVEKFTKQDRSIRTICCTGGSEMKKQIN 397

Query: 246 MMMNNPDVIIATPGRFLHLKVEMS---LDLKSIEYAVFDEADRLFEMGFQDQLNELLASL 302
            +    ++++ATPGR + +    S   +  K I + V DEADRLF+MGF+ Q+ +++ ++
Sbjct: 398 DLKRGVEIVVATPGRLIDILTLNSGKLISTKRITFVVMDEADRLFDMGFEPQITQIMKTV 457

Query: 303 PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREAN-L 361
             ++Q +LFSAT P+ L  FA   LT+P+ V +++ + ++EN+   F    N+  + N L
Sbjct: 458 RPDKQCVLFSATFPNKLRSFAARILTDPLTVTINSNNLVNENVNQSFYIEDNENDKFNRL 517

Query: 362 LYLLQDVIKI--PLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 419
           + +L    K+   + +  ++R+ +++                                  
Sbjct: 518 VNILDGFYKVNKNITSNSEEREIDEEV--------------------------------- 544

Query: 420 NQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 479
               S+K  I+FV ++   + +   L++ GY    I+       R   L  F+T   SIL
Sbjct: 545 ----SDKKIIIFVSSQQFCDLLYSKLENFGYFPYTIHAGKPYQERVMNLEKFKTTTNSIL 600

Query: 480 VVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           + T+V +RG+++P ++ VI ++   +   ++H  GRTAR  ++G A +++
Sbjct: 601 LCTEVLSRGLNVPEVSLVIIYNAAKTFAQYVHTTGRTARGTHKGDAITLL 650

>TDEL0B04060 Chr2 complement(724075..726618) [2544 bp, 847 aa] {ON}
           Anc_6.148 YBR237W
          Length = 847

 Score =  203 bits (517), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 118/388 (30%), Positives = 210/388 (54%), Gaps = 45/388 (11%)

Query: 150 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTH----SSKIGARAVI 205
           +  PTPIQ + IP I+  RD++G++RTGSGKT +++LP++R+IK      +++ G   +I
Sbjct: 278 YDSPTPIQSQAIPAIMSGRDVIGISRTGSGKTISYLLPLLRQIKAQRPLATNETGPLGLI 337

Query: 206 LSPSRELAMQTHNVFKEFSKG-TQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRF--- 261
           L+P+RELA+Q H   + F+K    + S+  TGG  L+ Q  M+    ++++ATPGRF   
Sbjct: 338 LAPTRELALQIHEEVELFTKNDLAVNSLCCTGGSELKQQINMLKRGTEIVVATPGRFIDL 397

Query: 262 LHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQTLLFSATLPSSLVD 321
           L L     L  K I + V DEADRLF++GF+ Q+ +++ ++  ++Q +LFSAT P+ L  
Sbjct: 398 LTLNTGKLLTTKRITFVVLDEADRLFDLGFEPQITQIMKTIRPDKQCVLFSATFPNKLRS 457

Query: 322 FAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDVIKIPLATKEQQRK 381
           FA   L  P+ + +++++ ++EN++  F     DE +   L  + D  ++    + ++ +
Sbjct: 458 FAMRVLRLPLSITINSKNLVNENVKQRFEIFPTDENKYRALLSILDK-RMKEEDENEESE 516

Query: 382 FNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKATILFVPTRHHVEYI 441
             D                                   +++  +KA I+FV ++   +++
Sbjct: 517 LAD-----------------------------------DEVNDDKA-IIFVSSQQICDFL 540

Query: 442 SQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFS 501
              L++ GY I  I+       R   L NFR    SIL+ T+V +RG+++P ++ VI ++
Sbjct: 541 GTRLENEGYSIHTIHAGKPYQERVNNLQNFRHTRNSILLCTEVLSRGLNVPEVSLVIIYN 600

Query: 502 LPASSKIFIHRVGRTARAGNRGWAYSIV 529
              +   ++H  GRTAR  N G A +++
Sbjct: 601 AVKTFAQYVHTAGRTARGTNSGEAITLL 628

>Suva_7.192 Chr7 complement(353138..354694) [1557 bp, 518 aa] {ON}
           YGL078C (REAL)
          Length = 518

 Score =  197 bits (501), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 124/403 (30%), Positives = 202/403 (50%), Gaps = 56/403 (13%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF    L   I   I+K  F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P I 
Sbjct: 110 SFDHLSLDSSIQAEISK--FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAIS 167

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
            +     K G + +++SP+RELA Q ++     +    L+   + GG   ++Q   +  +
Sbjct: 168 HLMNDQKKRGIQVLVISPTRELASQIYDNLIILTDKVGLQCCCVYGGVPKDEQRNQLKKS 227

Query: 251 PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASL-PSNRQTL 309
             V++ATPGR L L  E S+DL  + Y V DE DR+ E GF++ +  ++     S RQTL
Sbjct: 228 -QVVVATPGRLLDLLQEGSVDLSQVNYLVLDEGDRMLEKGFEEDIKNIIRETDASKRQTL 286

Query: 310 LFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDER--EANLLYLLQD 367
           +F+AT P  + + A + + NP+ V +    +++ N ++  +    D R  E  LL LL  
Sbjct: 287 MFTATWPKEVRELASSFMKNPIRVSIGNTDQLTANKKITQIVEVVDPRGKERKLLELL-- 344

Query: 368 VIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKA 427
                       +K++                                 P  N+      
Sbjct: 345 ------------KKYHSG-------------------------------PKKNE-----K 356

Query: 428 TILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 487
            ++F   +     + + LK +GY ++ I+G L Q  R + L  F++G +++L+ TDVAAR
Sbjct: 357 VLIFALYKKEATRVERNLKYNGYNVAAIHGDLSQQQRTQALSEFKSGKSNLLLATDVAAR 416

Query: 488 GVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           G+DIP +  VIN + P + + ++HR+GRT RAG  G A+++ +
Sbjct: 417 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 459

>ZYRO0B09856g Chr2 complement(769104..769462,770138..771401) [1623
           bp, 540 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 540

 Score =  197 bits (502), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 120/408 (29%), Positives = 198/408 (48%), Gaps = 64/408 (15%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF   G    ++  +   GF  PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 111 SFDEAGFPDYVLKEVKAEGFAAPTGIQCQGWPMALSGRDMVGVAATGSGKTLSYCLPAIV 170

Query: 191 KIKTH---SSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            I      +   G   ++L+P+RELA+Q      +F + +++R+  + GG     Q   +
Sbjct: 171 HINAQPLLAPGDGPVVLVLAPTRELAVQIQKECSKFGRSSRIRNTCVYGGVPRGQQIRDL 230

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +  +RQ
Sbjct: 231 ARGAEIVIATPGRLIDMLEINKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 290

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVR-----LDAESKISENLEMLFLSTKNDEREANLL 362
           TL++SAT P  +   A+  LT+P+ V+     L A   I + +E++    K D    +L 
Sbjct: 291 TLMWSATWPKEVKQLARDYLTDPIQVQIGSLELSASHTIKQVVEVISEFEKRDRLSKHL- 349

Query: 363 YLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 422
                     +A+++Q  K                                         
Sbjct: 350 ---------EIASEDQDSK----------------------------------------- 359

Query: 423 PSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 482
                 ++F  T+   + I+Q L+  G+    I+G  DQ  R   L  F+ G + I+V T
Sbjct: 360 -----VLVFASTKRTCDDITQYLRQDGWSALAIHGDKDQRERDWVLEEFKNGRSPIMVAT 414

Query: 483 DVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           DVAARG+D+  +  VIN+ +P + + ++HR+GRT RAG +G A S  +
Sbjct: 415 DVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGAKGTAISFFT 462

>TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 aa]
           {ON} Anc_2.164 YNL112W
          Length = 549

 Score =  197 bits (502), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 118/404 (29%), Positives = 200/404 (49%), Gaps = 56/404 (13%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF   G    ++  +   GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 110 SFDEAGFPDYVLKEVKAEGFDKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPSIV 169

Query: 191 KIKTH---SSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            I      +   G   ++L+P+RELA+Q      +F K +++R+  + GG     Q   +
Sbjct: 170 HINAQPLLAPGDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIRDL 229

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +  +RQ
Sbjct: 230 ARGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 289

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ESKISENLEMLFLSTKNDEREANLLYLLQ 366
           TL++SAT P  +   A   L +P+ V++ + E   S N++ +     + E+   L   + 
Sbjct: 290 TLMWSATWPKEVKQLASDYLHDPIQVQIGSLELAASHNIKQVVEVITDFEKRDRLTKHMD 349

Query: 367 DVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 426
                 +A+++++ K                                             
Sbjct: 350 ------IASQDKESKI-------------------------------------------- 359

Query: 427 ATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 486
             ++F  T+   + I++ L+D G+    I+G  DQ  R   L  FRTG + I+V TDVAA
Sbjct: 360 --LVFASTKRTCDEITKYLRDDGWPALAIHGDKDQRERDWVLNEFRTGRSPIMVATDVAA 417

Query: 487 RGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           RG+D+  +  VIN+ +P + + ++HR+GRT RAG  G A S  +
Sbjct: 418 RGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 461

>AFL027C Chr6 complement(386001..388451) [2451 bp, 816 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR237W
           (PRP5)
          Length = 816

 Score =  202 bits (514), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 126/405 (31%), Positives = 211/405 (52%), Gaps = 61/405 (15%)

Query: 135 FGLSKIIVTNITKR-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIK 193
            GL+  I+  +T+   F  PTPIQ + IP I+  RD++G+++TGSGKT +FILP++R+IK
Sbjct: 241 LGLNSGIMNLLTRELEFTVPTPIQAQAIPAIMSGRDVIGISKTGSGKTVSFILPLLRQIK 300

Query: 194 TH----SSKIGARAVILSPSRELAMQTHNVFKEFSKG-TQLRSVLLTGGDSLEDQFGMMM 248
                   + G   +ILSP+RELA+Q H    +F+ G   +RS+  TGG  L+ Q   + 
Sbjct: 301 AQRPLGGDETGPLGLILSPTRELALQIHEEVTKFTSGDPSIRSLCCTGGSELKRQINDIK 360

Query: 249 NNPDVIIATPGRFLHLKVEMSLDL---KSIEYAVFDEADRLFEMGFQDQLNELLASLPSN 305
              +++IATPGRF+ L    S +L   K I + V DEADRLF++GF+ Q+N+++  +  +
Sbjct: 361 RGVEIVIATPGRFIDLLSLNSGNLINPKRIVFVVMDEADRLFDLGFEPQVNQIMKCIRPD 420

Query: 306 RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDE-REANLLYL 364
           +Q +LFSAT P+ L  FA   L +PV + ++++S I+EN+E       N+E +  +L++ 
Sbjct: 421 KQCVLFSATFPNKLKSFASKILHDPVYITVNSKSLINENIEQKVEIFSNEEDKFKSLIHW 480

Query: 365 LQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPS 424
           L             Q+  ND+                                       
Sbjct: 481 LALT----------QQNLNDEK-------------------------------------- 492

Query: 425 EKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 484
              TI+FV ++   + +   L+ +G+    I+       R   L  F+     IL+ T+V
Sbjct: 493 ---TIVFVSSQQICDILYNRLEANGFTTFAIHAGKIYTERAWNLKCFKETANGILICTEV 549

Query: 485 AARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
            +RG+++P ++ VI ++   +   ++H  GRTAR  N+G A +++
Sbjct: 550 LSRGLNVPEVSLVIIYNAAKTFAQYVHTTGRTARGSNKGTALTLL 594

>YGL078C Chr7 complement(360288..361859) [1572 bp, 523 aa] {ON}
           DBP3RNA-Dependent ATPase, member of DExD/H-box family;
           involved in cleavage of site A3 within the ITS1 spacer
           during rRNA processing; not essential for growth, but
           deletion causes severe slow-growth phenotype
          Length = 523

 Score =  197 bits (500), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 124/403 (30%), Positives = 201/403 (49%), Gaps = 56/403 (13%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF    L   I   I+K  F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P I 
Sbjct: 115 SFDYLSLDSSIQAEISK--FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAIS 172

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
            +     K G + +++SP+RELA Q ++     +    ++   + GG   ++Q  + +  
Sbjct: 173 HLMNDQKKRGIQVLVISPTRELASQIYDNLIVLTDKVGMQCCCVYGGVPKDEQ-RIQLKK 231

Query: 251 PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASL-PSNRQTL 309
             V++ATPGR L L  E S+DL  + Y V DEADR+ E GF++ +  ++     S RQTL
Sbjct: 232 SQVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETDASKRQTL 291

Query: 310 LFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDER--EANLLYLLQD 367
           +F+AT P  + + A   + NP+ V +    +++ N  +  +    D R  E  LL LL  
Sbjct: 292 MFTATWPKEVRELASTFMNNPIKVSIGNTDQLTANKRITQIVEVVDPRGKERKLLELL-- 349

Query: 368 VIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKA 427
                       +K++                                 P  N+      
Sbjct: 350 ------------KKYHSG-------------------------------PKKNE-----K 361

Query: 428 TILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 487
            ++F   +     + + LK +GY ++ I+G L Q  R + L  F++G +++L+ TDVAAR
Sbjct: 362 VLIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAAR 421

Query: 488 GVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           G+DIP +  VIN + P + + ++HR+GRT RAG  G A+++ +
Sbjct: 422 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 464

>Smik_7.205 Chr7 complement(354693..356261) [1569 bp, 522 aa] {ON}
           YGL078C (REAL)
          Length = 522

 Score =  196 bits (499), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 124/403 (30%), Positives = 202/403 (50%), Gaps = 56/403 (13%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF    L   I   I+K  F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P I 
Sbjct: 114 SFDYLSLDPSIQAEISK--FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAIS 171

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
            +     K G + +++SP+RELA Q ++     +    ++   + GG   ++Q   +  +
Sbjct: 172 HLMNDQKKRGIQVLVISPTRELASQIYDNLIILTDKVGMQCCCVYGGVPKDEQRNQLKKS 231

Query: 251 PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASL-PSNRQTL 309
             V++ATPGR L L  E S+DL  + Y V DEADR+ E GF++ +  ++     S RQTL
Sbjct: 232 -QVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETNVSKRQTL 290

Query: 310 LFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDER--EANLLYLLQD 367
           +F+AT P  + + A   + NP+ V +    +++ N ++  +    D R  E  LL LL  
Sbjct: 291 MFTATWPKEVRELASTFMKNPIKVSIGNTDQLTANKKITQIVEVVDPRAKERKLLELL-- 348

Query: 368 VIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKA 427
                       +K++                                 P  N+      
Sbjct: 349 ------------KKYHSG-------------------------------PKKNE-----K 360

Query: 428 TILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 487
            ++F   +     + + LK +GY ++ I+G L Q  R + L  F++G +++L+ TDVAAR
Sbjct: 361 VLIFALYKKEAARVERNLKYNGYSVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAAR 420

Query: 488 GVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           G+DIP +  VIN + P + + ++HR+GRT RAG  G A+++ +
Sbjct: 421 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 463

>KLTH0H05852g Chr8 complement(514352..516787) [2436 bp, 811 aa] {ON}
           similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237W PRP5 RNA helicase in the DEAD-box family
          Length = 811

 Score =  202 bits (513), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 122/407 (29%), Positives = 214/407 (52%), Gaps = 55/407 (13%)

Query: 132 FPSFGLSKIIVTNITKR-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +   GL+  I+  ITK   F  PTPIQ + IP I+  RD++G+++TGSGKT +F+LP++R
Sbjct: 234 WSQLGLTTDIMDLITKEFAFVSPTPIQAQAIPAIMAGRDVIGISKTGSGKTVSFLLPLLR 293

Query: 191 KIKT----HSSKIGARAVILSPSRELAMQTHNVFKEF-SKGTQLRSVLLTGGDSLEDQFG 245
           +IK      S + G   +IL+P+RELA+Q H   ++F +  ++LRS+  TGG  L+ Q  
Sbjct: 294 QIKALRPLTSGETGPMGLILAPTRELAVQIHEETEKFLNPVSKLRSICCTGGSELKQQIK 353

Query: 246 MMMNNPDVIIATPGRFLHLKVEMS---LDLKSIEYAVFDEADRLFEMGFQDQLNELLASL 302
            +    ++++ATPGRF+ L    S   L+ + + + V DEADRLF++GF+ Q+ E++ ++
Sbjct: 354 ELKKGVEIVVATPGRFIDLLTLNSGKLLNTERVTFVVMDEADRLFDLGFEPQITEIMKTI 413

Query: 303 PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLL 362
             ++Q +LFSAT P+ L  FA   L  P+ + ++++S I+EN+E       NDE +   L
Sbjct: 414 RPDKQCVLFSATFPTKLKSFASRILDRPISITINSKSLINENIEQQLRIYDNDESKFEGL 473

Query: 363 YLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 422
               D+++     K+ Q   +D+                                     
Sbjct: 474 L---DILR-----KQTQMSSDDER------------------------------------ 489

Query: 423 PSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 482
             ++  I+F+ ++   + I   L++  Y    I+     + R   L  F+     IL+ T
Sbjct: 490 --DEKIIVFLSSQQICDLIYYRLQEQNYTTYAIHAGKPYNERASSLEKFKNTKNGILLCT 547

Query: 483 DVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           +V +RG+++P ++ VI ++   +   ++H  GRTAR    G A +++
Sbjct: 548 EVLSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGDKHGTAVTLL 594

>Skud_7.204 Chr7 complement(363553..365103) [1551 bp, 516 aa] {ON}
           YGL078C (REAL)
          Length = 516

 Score =  196 bits (498), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 124/403 (30%), Positives = 202/403 (50%), Gaps = 56/403 (13%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF    L+  I   I+K  F  PTPIQ    P +L  +D+VG+A TGSGKT AF +P I 
Sbjct: 108 SFDYLSLNPSIQAEISK--FPTPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAIS 165

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
            +     K G + +++SP+RELA Q ++     +    ++   + GG   ++Q   +  +
Sbjct: 166 HLMNDQGKRGIQVLVISPTRELASQIYDNLIILTDKVGMQCCCVYGGVPKDEQRNQLKRS 225

Query: 251 PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASL-PSNRQTL 309
             V++ATPGR L L  E S+DL  + Y V DEADR+ E GF++ +  ++     S RQTL
Sbjct: 226 -QVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIRNIIRETDASKRQTL 284

Query: 310 LFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDER--EANLLYLLQD 367
           +F+AT P  + + A   + NP+ V +    +++ N ++  +    D R  E  LL LL  
Sbjct: 285 MFTATWPKEVRELASTFMKNPIKVSIGNTDQLTANKKITQIVEVVDPRGKERKLLELL-- 342

Query: 368 VIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKA 427
                       +K++                                 P  N+      
Sbjct: 343 ------------KKYHSG-------------------------------PKKNE-----K 354

Query: 428 TILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 487
            ++F   +     + + LK +GY ++ I+G L Q  R + L  F++G +++L+ TDVAAR
Sbjct: 355 VLIFALYKKEATRVERNLKYNGYDVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAAR 414

Query: 488 GVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           G+DIP +  VIN + P + + ++HR+GRT RAG  G A+++ +
Sbjct: 415 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 457

>KAFR0B04560 Chr2 complement(947248..947615,948264..949527) [1632
           bp, 543 aa] {ON} Anc_2.164 YNL112W
          Length = 543

 Score =  196 bits (498), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 119/404 (29%), Positives = 198/404 (49%), Gaps = 56/404 (13%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F   G    ++  +   GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 111 NFEEAGFPDYVLKEVKAEGFDKPTSIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 170

Query: 191 KIKTH---SSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            I      S   G   ++LSP+RELA+Q      +F   +++R+  + GG     Q   +
Sbjct: 171 HINAQPLLSPGDGPIVLVLSPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPKGQQIRDL 230

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
           +   +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +  +RQ
Sbjct: 231 VRGAEIVIATPGRLIDMMEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 290

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ESKISENLEMLFLSTKNDEREANLLYLLQ 366
           TL++SAT P  +   A   L +P+ V++ + E   S N+  L     + E+   L   L+
Sbjct: 291 TLMWSATWPKEVRQLAADYLNDPIQVQVGSLELSASHNITQLVEVLSDFEKRDRLSKHLE 350

Query: 367 DVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 426
                 +A++++  K                                             
Sbjct: 351 ------IASEDKDSKI-------------------------------------------- 360

Query: 427 ATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 486
             ++F  T+   + I++ L+  G+    I+G  DQ  R   L  FR G + I+V TDVAA
Sbjct: 361 --LVFASTKRTCDDITKYLRADGWPALAIHGDKDQKERDWVLNEFRCGRSPIMVATDVAA 418

Query: 487 RGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           RG+D+  +  VIN+ +P + + ++HR+GRT RAG +G A S  +
Sbjct: 419 RGIDVKGINFVINYDMPGNIEDYVHRIGRTGRAGAKGTAISFFT 462

>Ecym_2269 Chr2 complement(527849..530482) [2634 bp, 877 aa] {ON}
           similar to Ashbya gossypii AFL027C
          Length = 877

 Score =  202 bits (513), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 119/389 (30%), Positives = 208/389 (53%), Gaps = 60/389 (15%)

Query: 150 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTHS----SKIGARAVI 205
           F  PTPIQ + IP I+  RDI+G+++TGSGKT +F+LP++R+IK+       + G   ++
Sbjct: 318 FNFPTPIQSQAIPAIMSGRDIIGISKTGSGKTVSFLLPLLRQIKSQRPLRVGETGPIGLL 377

Query: 206 LSPSRELAMQTHNVFKEFSKGT-QLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHL 264
           L+P+RELA+Q H    +F+    +++S+  TGG  ++ Q   +    ++I+ATPGRF+ L
Sbjct: 378 LAPTRELAVQIHEEVVKFTAANPRIKSICCTGGSEIKKQINDIKRGIEIIVATPGRFIDL 437

Query: 265 KVEMSLDL---KSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQTLLFSATLPSSLVD 321
               S +L   K I + V DEADRLF++GF+ Q+N+++  +  ++Q +LFSAT P+ L  
Sbjct: 438 LSLNSGNLVNPKRIVFVVLDEADRLFDLGFEPQVNQIMKCIRPDKQCVLFSATFPTKLKS 497

Query: 322 FAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDERE-ANLLYLLQDVIKIPLATKEQQR 380
           FA   L NP+ + ++++S I+EN+E       ++E +  +LL+ L     +P  T+E   
Sbjct: 498 FASKILHNPIHITINSKSLINENIEQRVEIFGDEESKFKSLLHWL-----VPTQTREVDE 552

Query: 381 KFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKATILFVPTRHHVEY 440
           K                                              TI+FV ++   ++
Sbjct: 553 K----------------------------------------------TIIFVSSQQICDF 566

Query: 441 ISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINF 500
           +S  L+ +G     I+     + R   L +F+     IL+ T+V +RG+++P ++ V+ +
Sbjct: 567 LSNRLEVNGLGTFSIHAGKPFNERTWNLRSFKETKNGILICTEVLSRGLNVPEVSLVLIY 626

Query: 501 SLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           +   S   ++H  GRTAR  N+G A +++
Sbjct: 627 NAAKSFAQYVHTTGRTARGTNKGMAVTLL 655

>KLTH0D09328g Chr4 complement(773449..773837,774557..775823) [1656
           bp, 551 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 551

 Score =  196 bits (498), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 118/404 (29%), Positives = 200/404 (49%), Gaps = 56/404 (13%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F   G  + +++ +   GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 112 TFDEAGFPEYVLSEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 171

Query: 191 KIKTH---SSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            I      S   G   ++L+P+RELA+Q      +F K +++R+  + GG     Q   +
Sbjct: 172 HINAQPLLSPGDGPIVLVLAPTRELAVQIQTECSKFGKSSRIRNTCVYGGVPRGHQIREL 231

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +  +RQ
Sbjct: 232 TRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 291

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ESKISENLEMLFLSTKNDEREANLLYLLQ 366
           TL++SAT P  +   A+  L +P+ V + + E   S N+  +     + E+   LL  L+
Sbjct: 292 TLMWSATWPKEVQQLARDYLHDPIQVNVGSLELAASHNIAQIVEVVSDMEKRDRLLKHLE 351

Query: 367 DVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 426
                  A++++  K                                             
Sbjct: 352 ------TASEDKDSKI-------------------------------------------- 361

Query: 427 ATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 486
             ++F  T+   + I++ L+  G+    I+G   Q+ R   L  FRTG + I+V TDVAA
Sbjct: 362 --LIFASTKRTCDEITRYLRQDGWPALAIHGDKAQNERDWVLQEFRTGNSPIMVATDVAA 419

Query: 487 RGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           RG+D+  +  VIN+ +P + + ++HR+GRT RAG  G A S  +
Sbjct: 420 RGIDVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 463

>NDAI0F02740 Chr6 complement(670654..671051,672039..673326) [1686
           bp, 561 aa] {ON} 
          Length = 561

 Score =  196 bits (498), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 119/404 (29%), Positives = 198/404 (49%), Gaps = 56/404 (13%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF   G    ++  +   GF  PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 119 SFDEAGFPDYVLKEVKAEGFDAPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 178

Query: 191 KIKTH---SSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            I      S   G   ++L+P+RELA+Q      +F   +++R+  + GG     Q   +
Sbjct: 179 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDL 238

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +  +RQ
Sbjct: 239 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 298

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ESKISENLEMLFLSTKNDEREANLLYLLQ 366
           TL++SAT P  +   A   L +P+ V++ + E   S N+  L       E+   LL  L+
Sbjct: 299 TLMWSATWPKEVQQLASDYLNDPIQVQVGSLELSASHNIAQLVEVLSEFEKRDRLLKHLE 358

Query: 367 DVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 426
                  A+++++ K                                             
Sbjct: 359 ------TASEDKESKI-------------------------------------------- 368

Query: 427 ATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 486
             ++F  T+   + I+++L++ G+    I+G  DQ  R   L  FR G + I+V TDVAA
Sbjct: 369 --LIFASTKRMCDEITKMLREDGWPALAIHGDKDQRERDWVLGEFRAGNSPIMVATDVAA 426

Query: 487 RGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           RG+D+  +  VIN+ +P + + ++HR+GRT RAG +G A S  +
Sbjct: 427 RGIDVKGINFVINYDMPGNIEDYVHRIGRTGRAGAKGTAISFFT 470

>NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 aa]
           {ON} Anc_2.164
          Length = 556

 Score =  196 bits (497), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 117/404 (28%), Positives = 198/404 (49%), Gaps = 56/404 (13%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F   G    ++  +   GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 116 TFDEAGFPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 175

Query: 191 KIKTH---SSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            I      +   G   ++L+P+RELA+Q      +F   +++R+  + GG     Q   +
Sbjct: 176 HINAQPLLAPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDL 235

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +  +RQ
Sbjct: 236 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 295

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ESKISENLEMLFLSTKNDEREANLLYLLQ 366
           TL++SAT P  +   A   L +P+ V++ + E   S N+  L       E+   LL  L+
Sbjct: 296 TLMWSATWPKEVKQLASDYLNDPIQVQIGSLELSASHNITQLVEVVSEFEKRDRLLKHLE 355

Query: 367 DVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 426
                  A+++Q+ K                                             
Sbjct: 356 ------TASQDQESKI-------------------------------------------- 365

Query: 427 ATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 486
             ++F  T+   + +++ L++ G+    I+G  DQ  R   L  FR+G + I+V TDVAA
Sbjct: 366 --LIFASTKRTCDEVTKYLREDGWPALAIHGDKDQRERDWVLEEFRSGRSPIMVATDVAA 423

Query: 487 RGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           RG+D+  +  VIN+ +P + + ++HR+GRT RAG  G A S  +
Sbjct: 424 RGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 467

>ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} similar
           to uniprot|P21372 Saccharomyces cerevisiae YBR237W PRP5
           RNA helicase in the DEAD-box family
          Length = 831

 Score =  199 bits (505), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 122/407 (29%), Positives = 211/407 (51%), Gaps = 45/407 (11%)

Query: 132 FPSFGL-SKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +   GL S I    I    F  PT IQ + IP I+  RD++G+++TGSGKT +++LP+IR
Sbjct: 242 WSQLGLTSDITSVLINDLKFENPTSIQAQAIPAIMCGRDVIGISKTGSGKTISYLLPLIR 301

Query: 191 KIKTH----SSKIGARAVILSPSRELAMQTHNVFKEFS-KGTQLRSVLLTGGDSLEDQFG 245
            IK      S + G   ++L+P+RELA+Q +    +F+ K   + SV  TGG  L++Q  
Sbjct: 302 HIKAQRHLASDESGPLGLVLAPTRELAIQINEEVTKFTAKDKSVNSVCCTGGSELKEQIR 361

Query: 246 MMMNNPDVIIATPGRF---LHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASL 302
            +    ++++ATPGRF   L L     L  + I + + DEADRLF+MGF+ Q+ +++ ++
Sbjct: 362 KLKKGIEIVVATPGRFIDLLTLNTGKLLSTRRITFVIMDEADRLFDMGFEPQITQIMKTI 421

Query: 303 PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLL 362
             ++Q +LFSAT P+ L +FA   L  P+ + ++++S ++EN+   F    +DE + N L
Sbjct: 422 RPDKQCVLFSATFPNKLRNFAMRVLHRPLSITINSKSLVNENVTQRFDIANSDEEKFNTL 481

Query: 363 YLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 422
             + +  +        Q+ +ND                                      
Sbjct: 482 LRILEKHEESSNGVPMQQDWNDSENK---------------------------------- 507

Query: 423 PSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 482
             EKA I+FV ++   + +   L++ GY I  I+       R   L NF++   SIL+ T
Sbjct: 508 -DEKA-IIFVSSQQICDLLHIKLENEGYTIYSIHAGKPYQERLNNLENFKSTPNSILLCT 565

Query: 483 DVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           +V +RG+++P ++ V+ ++   +   ++H  GRTAR  + G A +++
Sbjct: 566 EVLSRGLNVPEVSLVLIYNAVKTFAQYVHTTGRTARGTHTGVAMTLL 612

>YBR237W Chr2 (691969..694518) [2550 bp, 849 aa] {ON}  PRP5RNA
           helicase in the DEAD-box family, necessary for
           prespliceosome formation, bridges U1 and U2 snRNPs and
           enables stable U2 snRNP association with intron RNA
          Length = 849

 Score =  198 bits (503), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 117/408 (28%), Positives = 214/408 (52%), Gaps = 45/408 (11%)

Query: 132 FPSFGLSKIIVTNITKR-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +   GLS   +  IT++  F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++R
Sbjct: 257 WSQLGLSTDTMVLITEKLHFGSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLR 316

Query: 191 KIKTH----SSKIGARAVILSPSRELAMQTHNVFKEFSKG-TQLRSVLLTGGDSLEDQFG 245
           ++K        + G   +IL+P+RELA+Q H    +F++  T +RSV  TGG  ++ Q  
Sbjct: 317 QVKAQRPLSKHETGPMGLILAPTRELALQIHEEVTKFTEADTSIRSVCCTGGSEMKKQIT 376

Query: 246 MMMNNPDVIIATPGRF---LHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASL 302
            +    ++++ATPGRF   L L     L  K I + V DEADRLF++GF+ Q+ +++ ++
Sbjct: 377 DLKRGTEIVVATPGRFIDILTLNDGKLLSTKRITFVVMDEADRLFDLGFEPQITQIMKTV 436

Query: 303 PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLF-LSTKNDEREANL 361
             ++Q +LFSAT P+ L  FA   L +P+ + ++++  ++EN++  F +    DE+  NL
Sbjct: 437 RPDKQCVLFSATFPNKLRSFAVRVLHSPISITINSKGMVNENVKQKFRICHSEDEKFDNL 496

Query: 362 LYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 421
           + L+            ++ +F D+                                    
Sbjct: 497 VQLIH-----------ERSEFFDEVQSENDGQSSDVEEV--------------------- 524

Query: 422 LPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVV 481
              +   I+FV +++  ++IS+ L ++G +   I+       R   L  F+    SIL+ 
Sbjct: 525 ---DAKAIIFVSSQNICDFISKKLLNAGIVTCAIHAGKPYQERLMNLEKFKREKNSILLC 581

Query: 482 TDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           T+V +RG+++P ++ VI ++   +   ++H  GRTAR    G A +++
Sbjct: 582 TEVLSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGSRSGTAITLL 629

>AFL080W Chr6 (288205..289812) [1608 bp, 535 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL078C (DBP3)
          Length = 535

 Score =  192 bits (489), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 125/407 (30%), Positives = 201/407 (49%), Gaps = 63/407 (15%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF    L   I   I+K  F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I 
Sbjct: 126 SFSHLNLHSAIQKEISK--FPKPTPIQAVSWPYLLAGKDVIGVAETGSGKTFAFGVPAIN 183

Query: 191 KIKTH-SSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGG---DSLEDQFGM 246
            + +  S+  G + +++SP+RELA Q ++   + +    L    + GG   DS  +Q   
Sbjct: 184 SLMSEKSTPRGVKCLVISPTRELASQIYDNLVQLTDKVGLNCCCVYGGVQKDSQREQ--- 240

Query: 247 MMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSN- 305
            +    V++ATPGR L L  E S  L  ++Y V DEADR+ E GF++ +  ++    S+ 
Sbjct: 241 -LKKAQVVVATPGRLLDLIEEGSAKLAGVQYLVLDEADRMLEKGFEEDIKRIIKETKSDV 299

Query: 306 RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKND--EREANLLY 363
           RQTL+F+AT P  + + A   +  PV V +    ++S N  +  +    D  ++E  LL 
Sbjct: 300 RQTLMFTATWPKEVRELASTFMRAPVKVSIGNRDELSANKRITQVVEVIDPFKKEKRLLE 359

Query: 364 LLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLP 423
           LL+          +   K ND+                                      
Sbjct: 360 LLKQY--------QSGAKKNDK-------------------------------------- 373

Query: 424 SEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 483
                ++F   +     + + LK +GY ++ I+G L Q  R + L  F+ G  ++L+ TD
Sbjct: 374 ----VLIFALYKKEASRVERNLKYNGYNVAAIHGDLSQQQRTQALSEFKAGTANLLLATD 429

Query: 484 VAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           VAARG+DIP +  VIN + P + + ++HR+GRT RAG  G A+++ +
Sbjct: 430 VAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGATGVAHTLFT 476

>Skud_2.369 Chr2 (660665..663211) [2547 bp, 848 aa] {ON} YBR237W
           (REAL)
          Length = 848

 Score =  196 bits (498), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 121/409 (29%), Positives = 215/409 (52%), Gaps = 47/409 (11%)

Query: 132 FPSFGLSKIIVTNIT-KRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +   GLS  I+T IT K  F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++R
Sbjct: 255 WSQLGLSTDIMTLITGKLHFDSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLR 314

Query: 191 KIKTHSS----KIGARAVILSPSRELAMQTHNVFKEFSKGT--QLRSVLLTGGDSLEDQF 244
           ++K   S    + G   +IL+P+RELA+Q H    +F+ GT   +RSV  TGG  ++ Q 
Sbjct: 315 QVKAQRSLSKHETGPLGLILAPTRELALQIHEEVTKFT-GTDASIRSVCCTGGSEMKKQI 373

Query: 245 GMMMNNPDVIIATPGRF---LHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLAS 301
             +    ++++ATPGRF   L L     L  K I + + DEADRLF++GF+ Q+ +++ +
Sbjct: 374 TDLKRGAEIVVATPGRFIDILTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMKT 433

Query: 302 LPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLF-LSTKNDEREAN 360
           +  ++Q +LFSAT P+ L  FA   L +P+ + ++++  ++EN++  F +   +DE+  N
Sbjct: 434 VRPDKQCVLFSATFPNKLRSFAVRVLRSPISITINSKGLVNENVKQKFKICHSDDEKFEN 493

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
           L+ +                KF D+                                 ++
Sbjct: 494 LIQIAHG-----------GNKFFDEGQTEIDGET------------------------SD 518

Query: 421 QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480
              ++   I+FV ++   + IS+ L ++G +   I+       R   L  F+    SIL+
Sbjct: 519 LDETDAKAIIFVSSQQICDLISKKLTNAGIVAYAIHAGKPYQERLMNLEKFKREKNSILL 578

Query: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
            T+V +RG+++P ++ VI ++   +   ++H  GRTAR    G A +++
Sbjct: 579 CTEVLSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGSRSGTAITLL 627

>Ecym_5422 Chr5 complement(868686..869065,869897..871199) [1683 bp,
           560 aa] {ON} similar to Ashbya gossypii AFL221C
          Length = 560

 Score =  191 bits (484), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 116/404 (28%), Positives = 195/404 (48%), Gaps = 56/404 (13%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F   G  + ++  + + GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 124 TFDEAGFPEYVLKEVKEEGFDKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 183

Query: 191 KIKTH---SSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            I      S   G   ++L+P+RELA+Q      +F   +++R+  + GG     Q   +
Sbjct: 184 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPKSQQIRDL 243

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +  +RQ
Sbjct: 244 QRGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 303

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ESKISENLEMLFLSTKNDEREANLLYLLQ 366
           TL++SAT P  +   A+  L +P+ V + + E   S  +  +     + E+   L+  L 
Sbjct: 304 TLMWSATWPKEVQQLARDYLHDPIQVNIGSLELAASHTITQIVEVISDFEKRDRLVKHLD 363

Query: 367 DVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 426
                 +A+K+ + K                                             
Sbjct: 364 ------IASKDPESKI-------------------------------------------- 373

Query: 427 ATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 486
             I+F  T+   + I+  L+  G+    I+G   Q  R   L  FR G + I+V TDVAA
Sbjct: 374 --IIFASTKRTCDDITSYLRQDGWPALAIHGDKQQQERDWVLNEFRCGRSPIMVATDVAA 431

Query: 487 RGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           RG+D+  +  VIN+ +P + + ++HR+GRT RAG  G A S  +
Sbjct: 432 RGIDVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 475

>YHR169W Chr8 (442181..443476) [1296 bp, 431 aa] {ON}  DBP8ATPase,
           putative RNA helicase of the DEAD-box family; component
           of 90S preribosome complex involved in production of 18S
           rRNA and assembly of 40S small ribosomal subunit; ATPase
           activity stimulated by association with Esf2p
          Length = 431

 Score =  186 bits (471), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 134/411 (32%), Positives = 185/411 (45%), Gaps = 67/411 (16%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F S GLSK +  ++      QPT IQ+  IP IL+ RD +G A+TGSGKT AF  PM+ K
Sbjct: 4   FKSLGLSKWLTESLRAMKITQPTAIQKACIPKILEGRDCIGGAKTGSGKTIAFAGPMLTK 63

Query: 192 IKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNP 251
                S  G   V+L+P+RELAMQ    F        +R  ++ GG+S+  Q   +   P
Sbjct: 64  WSEDPS--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVSVIVGGESIVQQALDLQRKP 121

Query: 252 DVIIATPGRFLHLKVEMSLD----LKSIEYAVFDEADRLFEMGFQDQLNELLASLP--SN 305
             IIATPGR  H  +    D    L   +Y V DEAD L    F D L   +++LP    
Sbjct: 122 HFIIATPGRLAHHIMSSGDDTVGGLMRAKYLVLDEADILLTSTFADHLATCISALPPKDK 181

Query: 306 RQTLLFSATLPSSLVDFAKAGLTN--PVLVRLDAES----KISENLEMLFLSTKNDEREA 359
           RQTLLF+AT+   +     A +    P L     ES     I   L++ ++      +EA
Sbjct: 182 RQTLLFTATITDQVKSLQNAPVQKGKPPLFAYQVESVDNVAIPSTLKIEYILVPEHVKEA 241

Query: 360 NLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 419
              YL Q      L T E+                                         
Sbjct: 242 ---YLYQ------LLTCEEYE--------------------------------------- 253

Query: 420 NQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 479
                 K  I+FV      E + + LK     ++ ++  + Q  R   L+ FR     IL
Sbjct: 254 -----NKTAIIFVNRTMTAEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARIL 308

Query: 480 VVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           + TDVA+RG+DIP +  V+N+ +P+   +FIHR GRTARAG  G A S V+
Sbjct: 309 IATDVASRGLDIPTVELVVNYDIPSDPDVFIHRSGRTARAGRIGDAISFVT 359

>KAFR0G03480 Chr7 (718012..720570) [2559 bp, 852 aa] {ON} Anc_6.148
           YBR237W
          Length = 852

 Score =  192 bits (488), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 121/408 (29%), Positives = 215/408 (52%), Gaps = 49/408 (12%)

Query: 132 FPSFGLSKIIVTNITK-RGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +   GL+  I+ +I     F++ TPIQ + +P I+  RD++G+++TGSGKT +++LP++R
Sbjct: 260 WSQLGLNTSIMNSIKNVMKFQELTPIQAQALPAIMSGRDVIGISKTGSGKTISYLLPLLR 319

Query: 191 KIKTH----SSKIGARAVILSPSRELAMQTHN-VFKEFSKGTQLRSVLLTGGDSLEDQFG 245
           ++K+     +S+ G   ++L+P+RELA+Q H  + K  +    L  +  TGG  L+DQ  
Sbjct: 320 QVKSQRDLSNSETGPIGLVLAPTRELALQIHEEINKLINDDASLNCICCTGGSELKDQIS 379

Query: 246 MMMNNPDVIIATPGRFLHLKVEMSLDLKS---IEYAVFDEADRLFEMGFQDQLNELLASL 302
            +     +++ATPGRF+ L    S  L S   I + V DEADRLF+MGF+ Q+ +++ ++
Sbjct: 380 SVKRGVKIVVATPGRFIDLLTINSGKLLSTGRITFVVMDEADRLFDMGFEPQVTQIMKAI 439

Query: 303 PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREAN-L 361
             ++Q +LFSAT  + +  FA   L NP+ + +++ + ++EN+   F   ++D ++ + L
Sbjct: 440 RPDKQCVLFSATFSNKIRSFAMRVLKNPITITINSNNIVNENVSQNFRVCESDTQKFDEL 499

Query: 362 LYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 421
           + LL          KE+  K   Q                            E    ++ 
Sbjct: 500 ISLL----------KERNDKHEAQ----------------------------EGFEESDN 521

Query: 422 LPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVV 481
           L   K TI+FV ++   + +   L  SG+ I  I+       R   L  +R    S+L+ 
Sbjct: 522 LQDNK-TIIFVASQQICDILETNLVSSGFEIFSIHAGKPYQERVLNLEKYRRTRNSLLLC 580

Query: 482 TDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           T+V +RG+++P ++ VI ++   +   +IH  GRTAR  ++G A S +
Sbjct: 581 TEVLSRGLNVPEVSLVIIYNAVKTFAQYIHTTGRTARGNSKGKAVSFL 628

>KLLA0A09669g Chr1 complement(847036..848529) [1494 bp, 497 aa] {ON}
           highly similar to uniprot|Q03532 Saccharomyces
           cerevisiae YMR290C HAS1 ATP-dependent RNA helicase
           localizes to both the nuclear periphery and nucleolus
           highly enriched in nuclear pore complex fractions
          Length = 497

 Score =  186 bits (471), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 125/410 (30%), Positives = 207/410 (50%), Gaps = 67/410 (16%)

Query: 129 KGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPM 188
           +GSF    LS   +  I K GF Q T +Q +TIP +L  +D++G A+TGSGKT AF++P 
Sbjct: 33  EGSFSDLKLSDGTMKAIGKMGFTQMTAVQTRTIPPLLAGKDVLGAAKTGSGKTLAFLIPA 92

Query: 189 IRKIKTHSSKI----GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQF 244
           I  +  HS K     G   ++++P+RELA+Q   V +E  +       ++ GG +   + 
Sbjct: 93  IEML--HSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEA 150

Query: 245 GMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLP 303
             +M   +++IATPGR L HL+       K+++  V DEADR+ E+GF+D++ +++  LP
Sbjct: 151 DKLMKGVNILIATPGRLLDHLQNTKGFIFKNLKALVIDEADRILEIGFEDEMRQIIKILP 210

Query: 304 S-NRQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAE--SKISENLEMLFLSTKNDEREA 359
           + +RQ++LFSAT  + + D A+  L   P+ + +D+E  +  ++ LE  ++  ++D+R  
Sbjct: 211 NEDRQSMLFSATQTTKVEDLARISLRPGPLFINVDSEKDTSTADGLEQGYVVCESDKRFL 270

Query: 360 NLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 419
            L   L+         + Q++K                                      
Sbjct: 271 LLFSFLK---------RNQKKK-------------------------------------- 283

Query: 420 NQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 479
                    I+F+ + + V+Y ++LL      +  ++G   Q  R    + F      IL
Sbjct: 284 --------VIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGIL 335

Query: 480 VVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           V TDVAARG+DIP +  +I F  P   + +IHRVGRTAR G +G   S++
Sbjct: 336 VCTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 384

>KLTH0H00638g Chr8 complement(64621..65922) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P38719 Saccharomyces
           cerevisiae YHR169W DBP8 Putative ATP-dependent RNA
           helicase of the DEAD-box family involved in biogenesis
           of the 40S ribosomal subunit
          Length = 433

 Score =  184 bits (467), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 129/411 (31%), Positives = 184/411 (44%), Gaps = 67/411 (16%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F + G+SK +V  +      QPT IQ+  IP ILQ +D +G A+TGSGKT AF  PM+ K
Sbjct: 5   FATLGISKWLVEALQAMKITQPTAIQKACIPQILQGKDCIGGAKTGSGKTIAFGAPMLTK 64

Query: 192 IKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNP 251
                S  G   V+L+P+RELAMQ    F        +R  L+ GG+S+ DQ   +   P
Sbjct: 65  WSEDPS--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVALVVGGESIVDQAINLQRKP 122

Query: 252 DVIIATPGRFLHLKVEMSLD----LKSIEYAVFDEADRLFEMGFQDQLNELLASLP--SN 305
             I+ATPGR  H  +    D    LK  ++ V DEAD L    F + L   ++ LP    
Sbjct: 123 HFIVATPGRMAHHIMNSGEDTIGGLKRAKFLVLDEADILLTDTFSEHLATCISILPPKEK 182

Query: 306 RQTLLFSATLPSSL--VDFAKAGLTNPVLVRLDAES----KISENLEMLFLSTKNDEREA 359
           RQTLLF+AT+   +  +  A A    P L   + ES     I   L+  +L      +EA
Sbjct: 183 RQTLLFTATVTDQVKALQNAPAAEGKPPLFSYEVESMDKVAIPSTLKTTYLLVPEQVKEA 242

Query: 360 NLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 419
            L  +L                                                      
Sbjct: 243 YLYQIL-----------------------------------------------------T 249

Query: 420 NQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 479
           N   +E + I+FV      E + + LK     ++ ++  + Q  R   L+ FR     +L
Sbjct: 250 NATYNESSAIIFVNRTVTAEILRRTLKQLDVRVASLHSQMPQQERTNSLHRFRANAARVL 309

Query: 480 VVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           + TDVA+RG+DIP +  VIN+ + ++   FIHR GRTARAG  G +   V+
Sbjct: 310 IATDVASRGLDIPTVQLVINYDISSNPDTFIHRAGRTARAGRSGESICFVA 360

>TPHA0N01130 Chr14 complement(237020..239653) [2634 bp, 877 aa] {ON}
           Anc_6.148 YBR237W
          Length = 877

 Score =  191 bits (484), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 120/408 (29%), Positives = 212/408 (51%), Gaps = 46/408 (11%)

Query: 132 FPSFGLSKIIVTNITKR-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +   G+S  ++  +TK   +  PTPIQ + IP I+  RD++G+++TGSGKT ++ LP+IR
Sbjct: 283 WSQLGISSDVMYLLTKTLQYDTPTPIQSQAIPAIMTGRDVIGISKTGSGKTISYALPLIR 342

Query: 191 KIKTH----SSKIGARAVILSPSRELAMQTHNVFKEFSKG-TQLRSVLLTGGDSLEDQFG 245
            +K      +S+ G   +I++P+RELA+Q +   ++F K    +RS+  TGG  L++Q  
Sbjct: 343 HVKAQRPLSNSETGPLGLIIAPTRELAIQINEEIQKFIKSDPSIRSICCTGGSELKNQIY 402

Query: 246 MMMNNPDVIIATPGRF---LHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASL 302
                 ++++ATPGRF   L L     L+ K I   + DEADRLF+MGF+ Q+ +++ ++
Sbjct: 403 EFKRGIEIVVATPGRFIDLLTLNTGKLLNTKRITSVILDEADRLFDMGFEPQVTQIMKTI 462

Query: 303 PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKND-EREANL 361
             ++Q +LFSAT P  L  F K  L NP+ + +D+++ ++EN+   F    ND E+   L
Sbjct: 463 RPDKQCVLFSATFPIKLQAFVKRVLHNPLTITIDSKTMVNENVHQAFEILNNDSEKFFKL 522

Query: 362 LYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 421
           + +L + ++     +  Q K ++Q                                    
Sbjct: 523 IEILDNFVE---KRESSQSKGSEQ---------------------------------VED 546

Query: 422 LPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVV 481
              +K  I+FV ++   + ++  L+   Y +  I+       R   L  F+    SIL+ 
Sbjct: 547 EIIDKKIIIFVSSQQTCDAVAANLEKYDYDVFSIHAGRSYQERVSNLEKFKKTKNSILLC 606

Query: 482 TDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           T+V +RG+++P ++ VI ++       ++H  GRTAR   RG A +++
Sbjct: 607 TEVLSRGLNVPEVSLVIIYNAVNKFSQYVHTTGRTARGTRRGNAITLL 654

>Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}
           similar to Ashbya gossypii AFR452C
          Length = 565

 Score =  186 bits (471), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 129/402 (32%), Positives = 202/402 (50%), Gaps = 73/402 (18%)

Query: 139 KIIVTNITK-----RGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK-- 191
           K+I T+I K      G+ +PTPIQR TIP +  NRD +G+A TGSGKT AF++P+  K  
Sbjct: 167 KLIPTDIVKVITDDLGYEEPTPIQRATIPNVQNNRDFMGVASTGSGKTLAFLIPIFMKFT 226

Query: 192 ----IKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLT---GGDSLEDQF 244
               +   + + G +A+IL+P+RELA Q     K+F    + R  L+T   GG +LE+  
Sbjct: 227 KLPPLNVITRQDGPQALILAPTRELAQQIEAEAKKFCAHWK-RPCLVTSIVGGHTLEEII 285

Query: 245 GMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS 304
             + +  ++++ATPGR +       L LK +   V DEADR+ + GF+DQL  +LA    
Sbjct: 286 FNLQDGCNILVATPGRLIDCLENHVLVLKQVYTLVLDEADRMVDFGFEDQLTTILARTDD 345

Query: 305 --NRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLL 362
              +QTL+F+AT+ SS+   A   L NP  V +       +                   
Sbjct: 346 ILEKQTLMFTATMSSSIERIANGYLRNPGFVTIGGSGSAPQ------------------- 386

Query: 363 YLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 422
             +Q +I+  +AT EQ+ K   Q                            + LP  N  
Sbjct: 387 --IQQIIEY-VATDEQRFKMLTQ----------------------------DILP--NYR 413

Query: 423 PSEKATILFVPTRHHVEY-ISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVV 481
           P     I+F+  +   ++ + +  ++S + ++ ++G+  Q  R+  L  FR G   I+V 
Sbjct: 414 P---PVIIFINYKVTADWLLRKFQEESKFRVTILHGSKSQTQREHSLKAFREGKVDIMVA 470

Query: 482 TDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRG 523
           TDVA RG+DIP ++ V+NF +P+    +IHR+GRT RA  +G
Sbjct: 471 TDVAGRGIDIPNVSLVVNFQMPSKLDDYIHRIGRTGRANQKG 512

>CAGL0M13519g Chr13 complement(1330802..1332286) [1485 bp, 494 aa]
           {ON} highly similar to uniprot|Q03532 Saccharomyces
           cerevisiae YMR290c HAS1 helicase associated with SET1P
          Length = 494

 Score =  183 bits (465), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 122/400 (30%), Positives = 202/400 (50%), Gaps = 66/400 (16%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF S  LS+  +  I K GF + TP+Q +TIP ++  RD++G A+TGSGKT AF+LP I 
Sbjct: 30  SFKSLNLSQPTMRAIEKMGFSKMTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLLPTIE 89

Query: 191 KIKTHSSKI----GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGM 246
            +  HS K     G   +I++P+RELA+Q   V +E  +       ++ GG +   +   
Sbjct: 90  LL--HSLKFKPRNGTGVIIITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEK 147

Query: 247 MMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS- 304
           +M   ++++ATPGR L HL+       K+++  V DEADR+ E+GF+D++ +++  LP+ 
Sbjct: 148 LMKGVNLLVATPGRLLDHLQNTKGFIFKNLKALVIDEADRILEIGFEDEMRQIIKILPNE 207

Query: 305 NRQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAE--SKISENLEMLFLSTKNDEREANL 361
           +RQ++LFSAT  + + D ++  L   P+ + + +E  S  ++ LE  ++  ++D+R   L
Sbjct: 208 DRQSMLFSATQTTKVEDLSRISLRPGPLFINVVSEHDSSTADGLEQGYVVCESDKRFLLL 267

Query: 362 LYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 421
              L+         + Q++K                                        
Sbjct: 268 FSFLK---------RNQKKKI--------------------------------------- 279

Query: 422 LPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVV 481
                  I+F+ + + V+Y ++LL      +  ++G   Q  R    + F      IL+ 
Sbjct: 280 -------IVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILIC 332

Query: 482 TDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGN 521
           TDVAARG+DIP +  +I F  P   + +IHRVGRTAR  N
Sbjct: 333 TDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGTN 372

>KAFR0B01520 Chr2 (286962..288452) [1491 bp, 496 aa] {ON} Anc_5.40
           YMR290C
          Length = 496

 Score =  183 bits (464), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 124/408 (30%), Positives = 206/408 (50%), Gaps = 67/408 (16%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F    LS+  +  I K GF + TP+Q +TIP ++  RD++G A+TGSGKT AF+LP I 
Sbjct: 35  TFKELNLSQPTLKAIDKMGFTKMTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLLPAIE 94

Query: 191 KIKTHSSKI----GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGM 246
            +  HS K     G   ++++P+RELA+Q   V +E  +       ++ GG +   +   
Sbjct: 95  ML--HSLKFKPRNGTGVIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEK 152

Query: 247 MMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS- 304
           +M   +++IATPGR L HL+       K+++  V DEADR+ E+GF+D++ +++  LP+ 
Sbjct: 153 LMKGVNILIATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMRQIIKILPNE 212

Query: 305 NRQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAE--SKISENLEMLFLSTKNDEREANL 361
           +RQ++LFSAT  + + D A+  L   P+ + + +E  S  ++ LE  ++  ++D+R   L
Sbjct: 213 DRQSMLFSATQTTKVEDLARISLRKGPLFINVVSEKDSSTADGLEQGYVVCESDKRFLLL 272

Query: 362 LYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 421
              L+         + Q++K                                        
Sbjct: 273 FSFLK---------RNQKKKI--------------------------------------- 284

Query: 422 LPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVV 481
                  I+F+ + + V+Y ++LL      +  ++G   Q  R    + F      ILV 
Sbjct: 285 -------IVFLSSCNSVKYHAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVC 337

Query: 482 TDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           TDVAARG+DIP +  +I F  P   + +IHRVGRTAR G +G   S++
Sbjct: 338 TDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 384

>NCAS0H01280 Chr8 complement(243749..246412) [2664 bp, 887 aa] {ON}
           Anc_6.148
          Length = 887

 Score =  189 bits (480), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 118/408 (28%), Positives = 207/408 (50%), Gaps = 45/408 (11%)

Query: 132 FPSFGLSKIIVTNITKR-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +   GL+   +  ITK   +   TPIQ + IP I+  RD++G+++TGSGKT +++LP++R
Sbjct: 292 WSQLGLNTDTMNLITKNLRYETLTPIQSQAIPAIMSGRDVIGISKTGSGKTISYLLPLLR 351

Query: 191 KIKTH----SSKIGARAVILSPSRELAMQTHNVFKEF-SKGTQLRSVLLTGGDSLEDQFG 245
            IK       ++ G   +IL+P+RELA+Q H+  + F      +RS+  TGG  L+ Q  
Sbjct: 352 HIKAQRPLSKNETGPLGLILAPTRELALQIHDEIERFIVHDENIRSICCTGGSELKKQIN 411

Query: 246 MMMNNPDVIIATPGRFLHLKVEMSLDLKSIE---YAVFDEADRLFEMGFQDQLNELLASL 302
            +     +++ATPGRF+ L    +  L S E   + + DEADRLF++GF+ Q+ +++ ++
Sbjct: 412 DLKRGVQIVVATPGRFIDLLTLNTGKLVSTERITFVIMDEADRLFDLGFEPQITQIMKTI 471

Query: 303 PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDERE-ANL 361
             ++Q +LFSAT P+ L +FA   L +P+ + +++ + ++EN+E      + D  +   L
Sbjct: 472 RPDKQCVLFSATFPNKLRNFAMRILNSPLSITINSNNLVNENVEQKVAICETDSAKFQEL 531

Query: 362 LYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 421
           L +LQ+           Q K  DQ                                    
Sbjct: 532 LTILQN-----------QNKQQDQCENDEDEEREDETTL--------------------- 559

Query: 422 LPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVV 481
              +K TI+FV ++   + +   L + GY +  I+       R   L  F+    SIL+ 
Sbjct: 560 ---DKKTIIFVASQQICDLLYSQLVNFGYSLFAIHAGKPYQERITNLEGFKNTKNSILIC 616

Query: 482 TDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           T+V +RG+++P ++ VI ++   +   ++H  GRTAR    G A +++
Sbjct: 617 TEVLSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGNLHGIAITLL 664

>SAKL0H01430g Chr8 (149724..151226) [1503 bp, 500 aa] {ON} highly
           similar to uniprot|Q03532 Saccharomyces cerevisiae
           YMR290C HAS1 ATP-dependent RNA helicase localizes to
           both the nuclear periphery and nucleolus highly enriched
           in nuclear pore complex fractions
          Length = 500

 Score =  182 bits (461), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 123/408 (30%), Positives = 204/408 (50%), Gaps = 67/408 (16%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F    LS+  V  I K GF Q T +Q +TIP ++  RD++G A+TGSGKT AF++P I 
Sbjct: 38  TFKELNLSQQTVKAIEKMGFTQMTQVQSRTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIE 97

Query: 191 KIKTHSSKI----GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGM 246
            +  HS K     G   ++++P+RELA+Q   V +E  +       ++ GG +   +   
Sbjct: 98  ML--HSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEK 155

Query: 247 MMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS- 304
           ++   +++IATPGR L HL+       K+++    DEADR+ E+GF+D++ +++  LP+ 
Sbjct: 156 LVKGVNLLIATPGRLLDHLQNTKGFVFKNLKALCIDEADRILEIGFEDEMKQIIKILPNE 215

Query: 305 NRQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDA--ESKISENLEMLFLSTKNDEREANL 361
           +RQ++LFSAT  + + D A+  L   P+ + +D+  E+   E LE  ++  ++D+R   L
Sbjct: 216 DRQSMLFSATQTTKVEDLARISLRPGPLFINVDSGKETSTVEGLEQGYVVCESDKRFLLL 275

Query: 362 LYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 421
              L+         + Q++K                                        
Sbjct: 276 FSFLK---------RNQKKKI--------------------------------------- 287

Query: 422 LPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVV 481
                  I+F+ + + V+Y ++LL      +  ++G   Q  R    + F      ILV 
Sbjct: 288 -------IVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVC 340

Query: 482 TDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           TDVAARG+DIP +  +I F  P   + +IHRVGRTAR G +G   S++
Sbjct: 341 TDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 387

>CAGL0K07029g Chr11 complement(690501..692951) [2451 bp, 816 aa]
           {ON} similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237w Pre-mRNA processing RNA helicase PRP5
          Length = 816

 Score =  187 bits (475), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 114/389 (29%), Positives = 197/389 (50%), Gaps = 59/389 (15%)

Query: 149 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTH----SSKIGARAV 204
            ++  TPIQ +TIP I+  RD++G+++TGSGKT +++LPMIR +K      + + G  AV
Sbjct: 271 SYKSLTPIQTQTIPAIMSGRDVIGISKTGSGKTISYLLPMIRHVKAQKKLRNGETGPIAV 330

Query: 205 ILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHL 264
           I +P+RELA+Q +   ++      + S+  TGG  L+ Q   +    ++ IATPGRF+ L
Sbjct: 331 IFAPTRELAVQINEEVQKLISDLDISSICCTGGSDLKKQIDKLKTGVEIAIATPGRFIDL 390

Query: 265 KVEMSLDLKS---IEYAVFDEADRLFEMGFQDQLNELLASLPSNRQTLLFSATLPSSLVD 321
                 +L S   I + V DEADRLF+ GF+ Q+  +L ++  +RQ +LFSAT PS + +
Sbjct: 391 LSLNGGNLVSTLRISFVVMDEADRLFDFGFEPQIASVLRTVRPDRQCVLFSATFPSKVSN 450

Query: 322 FAKAGLTNPVLVRLDAESKISENLEMLF-LSTKNDEREANLLYLLQDVIKIPLATKEQQR 380
           FA   L +P+ + ++AE  ++E +   F + +   ++   LL LL              +
Sbjct: 451 FASRFLDSPLQITVNAEGMVNERINQKFTICSDESDKFKELLSLL--------------K 496

Query: 381 KFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKATILFVPTRHHVEY 440
            FN +                                       ++ TI+FV ++   + 
Sbjct: 497 VFNSETV-------------------------------------DEKTIIFVSSQQICDI 519

Query: 441 ISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINF 500
           I + L D    +  I+     + R++ L  F+    SIL+ T+V +RG+++P ++ VI +
Sbjct: 520 IEKRLTDYSEKLYSIHAGRPYNERRQNLELFKKTSNSILLCTEVMSRGLNVPEVSRVILY 579

Query: 501 SLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           +   +   ++H  GRTAR    G + S++
Sbjct: 580 NSAKTFAQYVHSTGRTARGTREGTSISLL 608

>KLLA0A05203g Chr1 complement(462167..463474) [1308 bp, 435 aa] {ON}
           highly similar to uniprot|P38719 Saccharomyces
           cerevisiae YHR169W DBP8 Putative ATP-dependent RNA
           helicase of the DEAD-box family involved in biogenesis
           of the 40S ribosomal subunit
          Length = 435

 Score =  180 bits (456), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 127/411 (30%), Positives = 184/411 (44%), Gaps = 67/411 (16%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F S G SK +V  +      QPT IQ+  IP IL+ RD +G A TGSGKT AF  PM+ K
Sbjct: 6   FKSLGCSKWLVEALNAMKIVQPTAIQKACIPEILKGRDCIGGANTGSGKTIAFAAPMLTK 65

Query: 192 IKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNP 251
                   G   ++L+P+RELAMQ    F  F     +R  ++ GG+S+  Q   +   P
Sbjct: 66  WSEDPQ--GMFGIVLTPTRELAMQIAEQFTAFGSAMNIRVAIVVGGESIVQQAIELQKRP 123

Query: 252 DVIIATPGRFLHLKVEMSLD----LKSIEYAVFDEADRLFEMGFQDQLNELLASLP--SN 305
             IIATPGR  H  +    D    LK +++ V DEAD L    F   L   ++ LP  + 
Sbjct: 124 HFIIATPGRLAHHVLNSGEDTIGGLKRVKFLVLDEADILLTETFSKDLATCVSILPPKNK 183

Query: 306 RQTLLFSATLPSSLVDFAKAGLTN--PVLVRLDAES----KISENLEMLFLSTKNDEREA 359
           RQ LLF+AT+   +   + A  T   P +   + ES     I + LE  +L      +E+
Sbjct: 184 RQNLLFTATMTDQVKALSDAPQTEGKPPVFTFEVESVDNVAIPKTLETTYLLVPEHVKES 243

Query: 360 NLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 419
              YL Q      + T E+  K                                      
Sbjct: 244 ---YLYQ------ILTSEKYVK-------------------------------------- 256

Query: 420 NQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 479
                  + I+FV      E + + LK     ++ ++  + Q  R   +  FR     +L
Sbjct: 257 ------SSCIIFVNRTVTAEILRRTLKSLDVRVTSLHSQMPQQERTNSVQRFRAQAARVL 310

Query: 480 VVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           + TDVA+RG+DIP++  V+N+ +P +   FIHR GRTARAG  G +   V+
Sbjct: 311 IATDVASRGLDIPIVELVVNYDIPGNPDTFIHRAGRTARAGRHGESLCFVT 361

>Kpol_1062.5 s1062 complement(10370..11665) [1296 bp, 431 aa] {ON}
           complement(10370..11665) [1296 nt, 432 aa]
          Length = 431

 Score =  179 bits (454), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 130/411 (31%), Positives = 187/411 (45%), Gaps = 67/411 (16%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F S GLS+ +V ++       PT IQ+  IP IL+ RD +G A+TGSGKT AF  PM+ +
Sbjct: 4   FKSLGLSRWLVESLNAMRITHPTAIQKHCIPEILKGRDCIGGAKTGSGKTIAFAGPMLSQ 63

Query: 192 IKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNP 251
                S  G   V+L+P+RELA+Q    F        +R  L+ GG+S+  Q   +   P
Sbjct: 64  WSDDPS--GMFGVVLTPTRELAIQIAEQFTALGSSMNIRVCLVVGGESIVKQALELQKKP 121

Query: 252 DVIIATPGRFLHLKV----EMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLP--SN 305
             IIATPGR  H  +    E+   L  ++Y V DEAD +    F   L+  +A LP    
Sbjct: 122 HFIIATPGRLAHHILSSGEEVVGGLSRVKYLVLDEADLILTQTFAADLSTCIAKLPPKQK 181

Query: 306 RQTLLFSATLPSSL--VDFAKAGLTNPVLVRLDAES----KISENLEMLFLSTKNDEREA 359
           RQTLLF+AT+   +  +  A A  + P L   + E+     +   L++ +L      +EA
Sbjct: 182 RQTLLFTATITDQVRALQNAPAQDSKPPLFAYEVENVDNVAVPSTLKLEYLLVPEHVKEA 241

Query: 360 NLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 419
              YL Q      L T E  +                                       
Sbjct: 242 ---YLYQ------LLTCEDYK--------------------------------------- 253

Query: 420 NQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 479
                + + I+FV      E + + L+     ++ ++  + Q  R   L  FR     +L
Sbjct: 254 -----DSSVIVFVNRTTAAEVLRRTLRSLEVRVASLHSQMPQSERINSLQRFRANAARVL 308

Query: 480 VVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           + TDVAARG+DIP +  VIN+ +P     FIHR GRTARAG  G A S V+
Sbjct: 309 IATDVAARGLDIPTVELVINYDIPQDPDTFIHRSGRTARAGRSGDAISFVT 359

>TPHA0L02160 Chr12 complement(448305..449801) [1497 bp, 498 aa] {ON}
           Anc_5.40 YMR290C
          Length = 498

 Score =  180 bits (457), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 119/406 (29%), Positives = 204/406 (50%), Gaps = 63/406 (15%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF    LS+  +  I K GF   TP+Q +TIP +L  RD++G A+TGSGKT AF+LP I 
Sbjct: 35  SFADLKLSEPTMKAIEKMGFENMTPVQARTIPPLLAGRDVLGAAKTGSGKTLAFLLPAIE 94

Query: 191 KIKT--HSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMM 248
            + +  +  + G   ++++P+RELA+Q   V +E  +       ++ GG +   +   ++
Sbjct: 95  MLHSLKYKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADKLV 154

Query: 249 NNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLP-SNR 306
              +++IATPGR L HL+       K+++  + DEADR+ E+GF+D++ +++  LP  +R
Sbjct: 155 KGVNMLIATPGRLLDHLQNTKGFVYKNLKALIIDEADRILEIGFEDEMKQIIRILPKEDR 214

Query: 307 QTLLFSATLPSSLVDFAKAGL-TNPVLVRL--DAESKISENLEMLFLSTKNDEREANLLY 363
           Q++LFSAT  + + D A+  L   P+ + +  D ++  ++ LE  ++  ++D+R   L  
Sbjct: 215 QSMLFSATQTTKVEDLARMSLRKGPLFINVVTDKDTSTADGLEQGYVVCESDKRFLLLFS 274

Query: 364 LLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLP 423
            L+         + Q++K                                          
Sbjct: 275 FLK---------RNQKKKI----------------------------------------- 284

Query: 424 SEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 483
                I+F+ + + V+Y ++LL      +  ++G   Q  R    + F      ILV TD
Sbjct: 285 -----IVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTD 339

Query: 484 VAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           VAARG+DIP +  ++ F  P   + +IHRVGRTAR G +G   S++
Sbjct: 340 VAARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 384

>TBLA0C00640 Chr3 (129301..131040) [1740 bp, 579 aa] {ON} Anc_8.124
           YGL171W
          Length = 579

 Score =  182 bits (461), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 141/497 (28%), Positives = 240/497 (48%), Gaps = 86/497 (17%)

Query: 130 GSF----PSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           GSF      F   K ++ N+    F +PTPIQ + IP+ L +RDIV  A TGSGKT AF+
Sbjct: 125 GSFDDLITRFSFDKRLLNNLIDNHFTEPTPIQSEAIPIALLDRDIVACAPTGSGKTMAFL 184

Query: 186 LPMIRKIKTHSSKIGARAVILSPSRELAMQ--------THNVFKEFSKGTQLRSVLLTGG 237
           +P++++I      +G + +I+SP++ELA Q        + ++F  F K   L+  LL+  
Sbjct: 185 IPLLQQIIDEKKVVGLKGLIISPTKELANQIFLECVKLSRSIF--FEKKRPLQVALLSKS 242

Query: 238 DSLEDQFGMMMNNP-DVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLN 296
            S + +  ++ N+  D+II+TP R + +    SLDL  +++ +FDEAD+LF+  F +Q +
Sbjct: 243 LSAKLKNKVISNSKYDIIISTPLRLIDVVRNESLDLSKVKHLIFDEADKLFDKTFVEQTD 302

Query: 297 ELLASL--PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKN 354
           ++L+S   P+ R++ +FSAT+PSS+ D A++ + +PV V +  +   + N+E   +   N
Sbjct: 303 DILSSCTDPALRKS-MFSATIPSSVEDIAQSLMNDPVRVVIGHKEAANSNIEQKLIFCGN 361

Query: 355 DEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXE 414
           +E +         +I I   T+E + K                                 
Sbjct: 362 EEGK---------LIAIKQLTQEGEFK--------------------------------- 379

Query: 415 RLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTG 474
             PP          I+F+ +    + +   +      +  I+       R + +  F++G
Sbjct: 380 --PPV---------IIFLESITRAKALYHEMMYDRLNVDVIHAERTTIQRNKIIERFKSG 428

Query: 475 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXX 534
               L+ TDV ARGVD   +  VIN+ +P SS+ ++HR+GRT RAG +G A ++ +    
Sbjct: 429 ELWCLICTDVLARGVDFKGVNLVINYDVPRSSQAYVHRIGRTGRAGRKGKAITLYTKQDA 488

Query: 535 XXXXXXXXXXGKKIMLTPMYDSLCEIMKNKWIAE--GNDESSFVNPKIAYTDRLILGSAP 592
                       K ++  M  S CE+   +W+       E   +    A+ DRL + + P
Sbjct: 489 LAV---------KPIINVMKQSGCEVA--EWMDTKLTKREKESIKKGKAHKDRLQISTVP 537

Query: 593 RLEVEGLGDLYKNMMQN 609
           +  V+ L    KN M N
Sbjct: 538 K--VDKLKRKRKNEMIN 552

>Kwal_56.24760 s56 (1136947..1138248) [1302 bp, 433 aa] {ON} YHR169W
           (DBP8) - DEAD-box protein [contig 160] FULL
          Length = 433

 Score =  178 bits (452), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 125/412 (30%), Positives = 182/412 (44%), Gaps = 67/412 (16%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F + G+SK +   +       PT IQ+  IP IL+ +D +G A+TGSGKT AF  PM+ 
Sbjct: 4   TFSNLGVSKWLTEALRAMKIDHPTAIQKACIPQILKGKDCIGGAKTGSGKTIAFAAPMLT 63

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
           K     S  G   V+L+P+RELAMQ    F        +R  L+ GG+S+ DQ   +   
Sbjct: 64  KWSEDPS--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVALVVGGESIVDQAIALQRK 121

Query: 251 PDVIIATPGRFLHLKVEMSLD----LKSIEYAVFDEADRLFEMGFQDQLNELLASLP--S 304
           P  IIATPGR  H  +    D    LK +++ V DEAD L    F + L   +  LP   
Sbjct: 122 PHFIIATPGRLAHHVMNSGEDTIGGLKRVKFLVLDEADILLTDTFTEHLAICIGILPPKE 181

Query: 305 NRQTLLFSATLPSS--LVDFAKAGLTNPVLVRLDAES----KISENLEMLFLSTKNDERE 358
            RQ LLF+AT+     ++  A A    P L   + ES     I   L+  +L      +E
Sbjct: 182 RRQNLLFTATVTDQVKMLQNAPATEGKPPLFSYEVESMDKVAIPSTLKTSYLLVPEQVKE 241

Query: 359 ANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPP 418
           A L  +L     I                                               
Sbjct: 242 AYLYQILTSAAYI----------------------------------------------- 254

Query: 419 ANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSI 478
                 + + I+FV      E + + LK     ++ ++  + Q  R   L+ FR     +
Sbjct: 255 ------DSSAIIFVNRTVTAEILRRTLKQLDVRVASLHSQMPQQERTNSLHRFRANAARV 308

Query: 479 LVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           L+ TDVA+RG+DIP +  V+N+ + A+   FIHR GRTARAG +G +   V+
Sbjct: 309 LIATDVASRGLDIPTVQLVVNYDISANPDTFIHRAGRTARAGRKGESICFVA 360

>Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score =  185 bits (470), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 119/407 (29%), Positives = 207/407 (50%), Gaps = 49/407 (12%)

Query: 135 FGLSKIIVTNITKR-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIK 193
            GLS   +  IT    F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++R++K
Sbjct: 260 LGLSTDTMNLITSELQFDSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVK 319

Query: 194 TH----SSKIGARAVILSPSRELAMQTH---NVFKEFSKGTQLRSVLLTGGDSLEDQFGM 246
                   + G   +IL+P+RELA+Q H   N F E   G  +RSV  TGG  ++ Q   
Sbjct: 320 AQRPLSKHETGPLGLILAPTRELALQIHEEVNKFTETDAG--IRSVCCTGGSEMKKQITD 377

Query: 247 MMNNPDVIIATPGRF---LHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLP 303
           +    ++++ATPGRF   L L     L  K I + + DEADRLF++GF+ Q+ +++ ++ 
Sbjct: 378 LKRGAEIVVATPGRFIDILTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMKTVR 437

Query: 304 SNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLF-LSTKNDEREANLL 362
            ++Q +LFSAT P+ L  FA   L +P+ + ++++  ++EN++  F +    DE+  N  
Sbjct: 438 PDKQFVLFSATFPNKLRSFAVRVLRSPISITINSKGMVNENVKQKFKICHSEDEKFDN-- 495

Query: 363 YLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 422
            L+Q + K      E Q   + +                                     
Sbjct: 496 -LMQILRKRNELLDEVQSDVDGETSDLEEV------------------------------ 524

Query: 423 PSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 482
             +   I+FV ++   ++IS+ L + G +   I+       R   L  F+    SIL+ T
Sbjct: 525 --DAKAIIFVSSQQICDFISKKLANVGVVTYAIHAGKPYQERVMNLEKFKREKNSILLCT 582

Query: 483 DVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           +V +RG+++P ++ VI ++   +   ++H  GRTAR    G A +++
Sbjct: 583 EVLSRGLNVPEVSLVIIYNSVKTFAQYVHTTGRTARGSRSGTAITLL 629

>KNAG0M00660 Chr13 complement(107772..110426) [2655 bp, 884 aa] {ON}
           Anc_6.148 YBR237W
          Length = 884

 Score =  185 bits (470), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 111/397 (27%), Positives = 202/397 (50%), Gaps = 56/397 (14%)

Query: 141 IVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTH----S 196
           ++ N+ K  F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++R IK       
Sbjct: 318 LIENVFK--FDSLTPIQAQALPAIMSGRDVIGISKTGSGKTISYLLPLLRHIKAQRPLSK 375

Query: 197 SKIGARAVILSPSRELAMQTHN-VFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVII 255
           ++ G  A+I++P+RELA+Q +    +       LR++  TGG  L+ Q   +    ++++
Sbjct: 376 NETGPLALIIAPTRELALQIYQETLRFLDSDKSLRAICCTGGSQLKTQINDLKRGTEIVV 435

Query: 256 ATPGRFLHLKVEMSLDL---KSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQTLLFS 312
           ATPGRF+ L    S  L   K I + V DEADRLF+MGF+ Q+ +++ ++  ++Q +LFS
Sbjct: 436 ATPGRFIDLLTMNSGKLISSKKISFVVLDEADRLFDMGFEPQVTQIMKTIRPDKQCVLFS 495

Query: 313 ATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDVIKIP 372
           AT P+ L +FA   L +P+ + +++ + ++EN+        N+  + ++L  L +  +  
Sbjct: 496 ATFPNKLRNFAMRVLKSPLSITINSNTMVNENVTQKVELCNNELDKFDILLSLLEKHQAK 555

Query: 373 LATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKATILFV 432
           L + EQ  K                                               I+FV
Sbjct: 556 LVSPEQDEK----------------------------------------------VIIFV 569

Query: 433 PTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIP 492
            ++   + +   L++  Y +  I+       R   L  F+    SIL+ T+V +RG+++P
Sbjct: 570 ASQQICDTLYAKLENYDYDLFAIHAGKSYQERITNLNKFKETANSILICTEVLSRGLNVP 629

Query: 493 MLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
            ++ V+ F+   +   ++H  GRTAR  N G A +++
Sbjct: 630 EVSLVVIFNAIKTFAQYVHTTGRTARGNNHGDAITLL 666

>TDEL0G00650 Chr7 (132659..134116) [1458 bp, 485 aa] {ON} Anc_5.40
           YMR290C
          Length = 485

 Score =  178 bits (451), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 120/407 (29%), Positives = 202/407 (49%), Gaps = 67/407 (16%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F    LS   +  + K GF   TP+Q +TIP +L  RD++G A+TGSGKT AF++P I +
Sbjct: 23  FSGLNLSDATMKAVEKMGFSSMTPVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIER 82

Query: 192 IKTHSSKI----GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
           +  HS K     G   ++++P+RELA+Q   V +E  +       ++ GG +   +   +
Sbjct: 83  L--HSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTYGIVIGGANRRQEADKL 140

Query: 248 MNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-N 305
               +++IATPGR L HL+       K+++  V DEADR+ E+GF+D++ +++  LP+ +
Sbjct: 141 AKGVNMLIATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMRQIIKILPNDD 200

Query: 306 RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAE--SKISENLEMLFLSTKNDEREANLL 362
           RQ++LFSAT  + + D A+  L   P+ + + +E  +  ++ LE  ++   +D+R   L 
Sbjct: 201 RQSMLFSATQTTKVEDLARISLRPGPLFINVVSEKDNSTADGLEQGYVVCDSDKRFLLLF 260

Query: 363 YLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 422
             L+         + Q++K                                         
Sbjct: 261 SFLK---------RNQKKK----------------------------------------- 270

Query: 423 PSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 482
                 I+F+ + + V+Y ++LL      +  ++G   Q  R    + F      IL+ T
Sbjct: 271 -----VIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICT 325

Query: 483 DVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           DVAARG+DIP +  +I F  P   + +IHRVGRTAR G +G   S++
Sbjct: 326 DVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 371

>KLTH0B08998g Chr2 complement(731722..733200) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|Q03532 Saccharomyces
           cerevisiae YMR290C HAS1 ATP-dependent RNA helicase
           localizes to both the nuclear periphery and nucleolus
           highly enriched in nuclear pore complex fractions
          Length = 492

 Score =  177 bits (450), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 126/410 (30%), Positives = 199/410 (48%), Gaps = 67/410 (16%)

Query: 129 KGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPM 188
           K  F    LS   +  I K GF   T +Q +TIP +L  RD++G A+TGSGKT AF+LP 
Sbjct: 27  KEKFAELNLSPPTMKAIDKMGFTTMTQVQSRTIPPLLAGRDVLGAAKTGSGKTLAFLLPA 86

Query: 189 IRKIKTHSSKI----GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQF 244
           I  +  HS K     G   ++++P+RELA+Q   V K   +       ++ GG +   + 
Sbjct: 87  IEML--HSLKFKPRNGTGVIVITPTRELALQIFGVAKTLMEFHSQTFGIVIGGANRRQEA 144

Query: 245 GMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLP 303
             +    +++IATPGR L HL+       K+++  V DEADR+ E+GF+D++ +++  LP
Sbjct: 145 DKLAKGVNLLIATPGRLLDHLQNTKDFVFKNLKALVIDEADRILEIGFEDEMRQIVKILP 204

Query: 304 S-NRQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAESKIS--ENLEMLFLSTKNDEREA 359
           S  RQT+LFSAT  + + D A+  L   P+ + +D+E + S  + LE  ++   +D+R  
Sbjct: 205 SEERQTMLFSATQTTKVEDLARISLRPGPLFINVDSEKQTSTADGLEQGYVVCDSDKRFL 264

Query: 360 NLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 419
            L   L+         + Q++K                                      
Sbjct: 265 LLFSFLK---------RNQKKKI------------------------------------- 278

Query: 420 NQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 479
                    I+F+ + + V Y ++LL      +  ++G   Q  R    + F       L
Sbjct: 279 ---------IVFLSSCNSVRYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGTL 329

Query: 480 VVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           V TDVAARG+DIP +  +I F  P   + +IHRVGRTAR G++G   S++
Sbjct: 330 VCTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GSKGKGKSLM 378

>TDEL0G00930 Chr7 complement(186836..188146) [1311 bp, 436 aa] {ON}
           Anc_5.69 YHR169W
          Length = 436

 Score =  176 bits (446), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 131/417 (31%), Positives = 192/417 (46%), Gaps = 65/417 (15%)

Query: 125 SKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAF 184
           S+    +F S GL + +V  ++     QPT IQ+  IP I++  D +G A+TGSGKT AF
Sbjct: 2   SESSVSTFKSLGLPRWLVDALSAMRITQPTSIQKGCIPAIMKGGDCIGGAKTGSGKTIAF 61

Query: 185 ILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQF 244
             PM+ K     S  G   V+L+P+RELAMQ    F        +R  ++ GG+S+  Q 
Sbjct: 62  AAPMLTKWSEDPS--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVSIVVGGESIVKQA 119

Query: 245 GMMMNNPDVIIATPGRFLHLKVEMSLD----LKSIEYAVFDEADRLFEMGFQDQLNELLA 300
             +   P  IIATPGR  H  +    D    L   ++ V DEAD L    F   LN  ++
Sbjct: 120 LELQRKPHFIIATPGRLAHHILNSGEDTVGGLMRAKFLVLDEADSLLTSTFAKDLNVCVS 179

Query: 301 SLP--SNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFL-STKNDER 357
           +LP    RQTLLF+            A +T+ V    DA S+  EN   L+    +N + 
Sbjct: 180 ALPPKDKRQTLLFT------------ATITDQVRALQDAPSQ--ENKPPLYCYEVENVDN 225

Query: 358 EANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLP 417
            A    L  + I IP   KE                                        
Sbjct: 226 VAVPSTLKTEYILIPEYVKEAYLY------------------------------------ 249

Query: 418 PANQLPSEK----ATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRT 473
             + L SE+    + I+FV      E + + LK+    ++ ++  + Q  R   L  FR 
Sbjct: 250 --HLLTSEEYKDSSAIIFVNRTMTAEIMRRTLKNLDIRVASLHSQMPQQERTNSLQRFRA 307

Query: 474 GLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
               +L+ TDVA+RG+DIP++  V+N+ +P+   ++IHR GRTARAG RG A S ++
Sbjct: 308 NAARVLIATDVASRGLDIPVVELVVNYDIPSDPDVYIHRSGRTARAGRRGDAISFIT 364

>AGR333C Chr7 complement(1353154..1354668) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR290C
           (HAS1)
          Length = 504

 Score =  177 bits (449), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 123/407 (30%), Positives = 201/407 (49%), Gaps = 67/407 (16%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F    LS   +  I K GF + T +Q +TIP ++  RD++G A+TGSGKT AF+LP I  
Sbjct: 41  FDELNLSSQTLKAIGKMGFTKMTQVQARTIPPLMAGRDVLGAAKTGSGKTLAFLLPAIEM 100

Query: 192 IKTHSSKI----GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
           +  HS K     G   ++++P+RELA+Q   V +E  +       ++ GG +   +   +
Sbjct: 101 L--HSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKL 158

Query: 248 MNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-N 305
               +++IATPGR L HL+       K+++  V DEADR+ E+GF+D++ +++  LP+ +
Sbjct: 159 AKGVNLLIATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQIIKILPNED 218

Query: 306 RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAESKIS--ENLEMLFLSTKNDEREANLL 362
           RQ++LFSAT  + + D A+  L   P+ + +D+E + S  + LE  ++   +D+R   L 
Sbjct: 219 RQSMLFSATQTTKVEDLARISLRPGPLFINVDSEKETSTADGLEQGYVVCDSDKRFLLLF 278

Query: 363 YLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 422
             L              +KF +                                      
Sbjct: 279 TFL--------------KKFQN-------------------------------------- 286

Query: 423 PSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 482
              K  I+F+ + + V+Y ++LL      +  ++G   Q  R    + F      ILV T
Sbjct: 287 ---KKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCT 343

Query: 483 DVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           DVAARG+DIP +  +I F  P   + +IHRVGRTA+ G +G   S++
Sbjct: 344 DVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAK-GTKGKGKSLM 389

>Kpol_513.15 s513 complement(41334..42839) [1506 bp, 501 aa] {ON}
           complement(41334..42839) [1506 nt, 502 aa]
          Length = 501

 Score =  177 bits (448), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 121/408 (29%), Positives = 202/408 (49%), Gaps = 67/408 (16%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F    LS   +  I K GF   TP+Q +TIP +L  RD++G A+TGSGKT AF++P I 
Sbjct: 38  NFKDLKLSDPTLKAIEKMGFTSMTPVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIE 97

Query: 191 KIKTHSSKI----GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGM 246
            +  HS K     G   ++++P+RELA+Q   V +E  +       ++ GG +   +   
Sbjct: 98  ML--HSLKFKPRNGTGVIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEK 155

Query: 247 MMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS- 304
           ++   ++++ATPGR L HL+       K+++  V DEADR+ E+GF+D++ +++  LP+ 
Sbjct: 156 LIKGVNMLVATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQIIKILPNE 215

Query: 305 NRQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAE--SKISENLEMLFLSTKNDEREANL 361
           +RQ++LFSAT  + + D A+  L   P+ + +  E  +  ++ LE  ++  ++D+R   L
Sbjct: 216 DRQSMLFSATQTTKVEDLARISLRKGPLFINVVTERDTSTADGLEQGYVVCESDKRFLLL 275

Query: 362 LYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 421
              L+         + Q++K                                        
Sbjct: 276 FSFLK---------RNQKKKI--------------------------------------- 287

Query: 422 LPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVV 481
                  I+F+ + + V Y ++LL      +  ++G   Q  R    + F      ILV 
Sbjct: 288 -------IVFLSSCNSVRYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVC 340

Query: 482 TDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           TDVAARG+DIP +  +I F  P   + +IHRVGRTAR G +G   S++
Sbjct: 341 TDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 387

>CAGL0K11198g Chr11 complement(1087381..1089129) [1749 bp, 582 aa]
           {ON} similar to uniprot|P23394 Saccharomyces cerevisiae
           YDR243c PRP28
          Length = 582

 Score =  178 bits (452), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 124/406 (30%), Positives = 204/406 (50%), Gaps = 83/406 (20%)

Query: 149 GFRQPTPIQRKTIPLILQN-----RDIVGMARTGSGKTAAFILPMIRKIKTHSSKI---- 199
           GF +PT IQR TIP  + +     RDI+G+A TGSGKT AF +P++ ++    ++     
Sbjct: 190 GFDEPTAIQRITIPNAISSNKSVPRDILGIASTGSGKTLAFSIPILARLDALPARPVNLK 249

Query: 200 ---GARAVILSPSRELAMQT----HNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNPD 252
              G  A++L P+RELA Q     + +   +     L +V + GG S+ D    + N  D
Sbjct: 250 TLDGPLALVLVPTRELAQQISQEINRLLSAWENKKNLNAVSIVGGHSMSDISHTLRNGCD 309

Query: 253 VIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSN----RQT 308
           ++IATPGR L +     + L  I+  V DEADR+ ++GF+DQ+  +L+ L ++    RQT
Sbjct: 310 ILIATPGRLLDVLDNHLVVLNKIQSLVLDEADRMIDLGFEDQMKSILSHLMADELAARQT 369

Query: 309 LLFSATLPSSLVDFAKAGLTNPVLV----RLDAESKISENLEMLFLSTKNDEREANLLYL 364
           +LF+ATL SS+   AK  L NP+ V    R D++  +   +  +   T +D+++  L +L
Sbjct: 370 MLFTATLSSSVESIAKGYLKNPLHVSVGSRWDSDKPL---ITQVVRHTGDDDKK--LSFL 424

Query: 365 LQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPS 424
             D+IK                                                 N LP+
Sbjct: 425 KDDLIK-------------------------------------------------NGLPA 435

Query: 425 EKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 484
               I+F+  +   ++++  L D  + I  ++G+  Q  R+  +   ++G  ++L+ T+V
Sbjct: 436 ----IIFINYKETADWLTLRLSDR-FNIVTLHGSKSQSQRESAIQKLKSGTANVLIATNV 490

Query: 485 AARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           AARG+DIP +A V+NF +      +IHR+GRT RAG  G A + ++
Sbjct: 491 AARGLDIPDVALVVNFQMSKKFDDYIHRIGRTGRAGKTGIAVTYLT 536

>Kwal_23.4288 s23 (654900..656378) [1479 bp, 492 aa] {ON} YMR290C
           (HAS1) - Putative RNA-dependent helicase [contig 1] FULL
          Length = 492

 Score =  176 bits (447), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 124/420 (29%), Positives = 204/420 (48%), Gaps = 67/420 (15%)

Query: 119 TTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGS 178
             N  ++   K  F    LS   +  + K GF   T +Q +TIP +L  RD++G A+TGS
Sbjct: 17  VANAPEAPEYKEKFSELNLSSPTIKAVEKLGFTTMTQVQSRTIPPLLAGRDVLGAAKTGS 76

Query: 179 GKTAAFILPMIRKIKTHSSKI----GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLL 234
           GKT AF+LP +  +  HS K     G   V+++P+RELA+Q   V K   +       ++
Sbjct: 77  GKTLAFLLPAVEML--HSLKFKPRNGTGVVVITPTRELALQIFGVAKSLMEFHSQTFGIV 134

Query: 235 TGGDSLEDQFGMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQD 293
            GG +   +   +    +++IATPGR L HL+       K+++  + DEADR+ E+GF+D
Sbjct: 135 IGGANRRQEADKLAKGVNLLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFED 194

Query: 294 QLNELLASLPS-NRQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAESKIS--ENLEMLF 349
           ++ +++  LP+ +RQT+LFSAT  + + D A+  L   P+ + +D+E + S  + LE  +
Sbjct: 195 EMRQIVKILPNEDRQTMLFSATQTTKVEDLARISLRPGPLFINVDSEKENSTVDGLEQGY 254

Query: 350 LSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXX 409
           +  ++D+R   L   L+         + Q++K                            
Sbjct: 255 VVCESDKRFLLLFSFLK---------RNQKKK---------------------------- 277

Query: 410 XXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLY 469
                              I+F+ + + V Y ++LL      +  ++G   Q  R    +
Sbjct: 278 ------------------VIVFLSSCNSVRYYAELLNYIDLPVLELHGKQKQQKRTNTFF 319

Query: 470 NFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
            F       LV TDVAARG+DIP +  +I F  P   + +IHRVGRTAR G++G   S++
Sbjct: 320 EFCNAERGTLVCTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GSKGKGKSLM 378

>NDAI0C03600 Chr3 complement(826718..828277) [1560 bp, 519 aa] {ON}
           Anc_5.40
          Length = 519

 Score =  177 bits (448), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 118/406 (29%), Positives = 202/406 (49%), Gaps = 63/406 (15%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F    LS   +  I K GF   TP+Q +TIP ++  RD++G A+TGSGKT AF++P I 
Sbjct: 52  NFNDLSLSSQTMKAIEKMGFESLTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIE 111

Query: 191 KIKTHSSKI--GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMM 248
            + +   K   G   ++++P+RELA+Q   V +E  +       ++ GG +   +   +M
Sbjct: 112 LLYSLKFKPRNGTGIIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEKLM 171

Query: 249 NNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-NR 306
              +++IATPGR L HL+       K+++  + DEADR+ E+GF+D++ +++  LP+ +R
Sbjct: 172 KGVNILIATPGRLLDHLQNTKGFIFKNLKALIIDEADRILEIGFEDEMKQIIRILPNEDR 231

Query: 307 QTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAE--SKISENLEMLFLSTKNDEREANLLY 363
           Q++LFSAT  + + D A+  L   P+ + +++E  +  ++ LE  ++   +D+R   L  
Sbjct: 232 QSMLFSATQTTKVEDLARISLRKGPLFINVESEKDTSTADGLEQGYVVCDSDKRFLLLFS 291

Query: 364 LLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLP 423
            L+         + Q+RK                                          
Sbjct: 292 FLK---------RNQKRK------------------------------------------ 300

Query: 424 SEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 483
               ++ F  + + V+Y ++LL      +  ++G   Q  R    + F      ILV TD
Sbjct: 301 ----SLSFYSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNADKGILVCTD 356

Query: 484 VAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           VAARG+DIP +  ++ F  P   + +IHRVGRTAR G +G   S++
Sbjct: 357 VAARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 401

>AER301C Chr5 complement(1188485..1189792) [1308 bp, 435 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR169W
           (DBP8)
          Length = 435

 Score =  174 bits (442), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 128/430 (29%), Positives = 188/430 (43%), Gaps = 67/430 (15%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F   G++K +   +      QPT IQ+  IP IL  RD +G A+TGSGKT AF  PM+ 
Sbjct: 7   TFKDLGVAKWLAEALNSMKITQPTTIQKACIPEILAGRDCIGGAKTGSGKTIAFAAPMLT 66

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
           K    +   G   ++L+P+RELAMQ    F        +R  L+ GG+ +  Q   +   
Sbjct: 67  KWS--ADPCGMFGIVLTPTRELAMQIAEQFTALGSVMNIRVALVVGGEDIVSQALELQRK 124

Query: 251 PDVIIATPGRFLHLKVEMSLD----LKSIEYAVFDEADRLFEMGFQDQLNELLASLP--S 304
           P  IIATPGR  H  +    D    LK + Y V DEAD L    F D L   +  LP   
Sbjct: 125 PHFIIATPGRLAHHIMHSGEDTIGGLKRVRYLVLDEADILLTDTFSDALATCVQILPPKE 184

Query: 305 NRQTLLFSATLPSSLVDFAKAGLTN--PVLVRLDAES----KISENLEMLFLSTKNDERE 358
            RQ LLF+AT+   ++    A  T+  P L     E+     +  +L+  +L      +E
Sbjct: 185 KRQNLLFTATMTDQVLALKDAPPTSGKPPLFSFHVENLDDLAVPASLQTTYLLVPEHVKE 244

Query: 359 ANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPP 418
           A   YL Q      L+++E + K                                     
Sbjct: 245 A---YLYQ-----VLSSEEYKSK------------------------------------- 259

Query: 419 ANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSI 478
                   + I+FV      E + ++L      ++ ++  + Q  R   L  FR     +
Sbjct: 260 --------SAIVFVNRTISAEILRRMLMQLEIRVTSLHSQMPQRERTNSLQRFRANAARV 311

Query: 479 LVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXX 538
           L+ TDVA+RG+DIP +  V+N+ +PA+   +IHR GRTARAG  G A S ++        
Sbjct: 312 LIATDVASRGLDIPAVQLVVNYDIPANPDTYIHRAGRTARAGRGGEALSFIAPKDVSRIQ 371

Query: 539 XXXXXXGKKI 548
                 GKK+
Sbjct: 372 AIEERIGKKM 381

>NCAS0F02200 Chr6 (438960..440486) [1527 bp, 508 aa] {ON} Anc_5.40
          Length = 508

 Score =  176 bits (447), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 120/407 (29%), Positives = 201/407 (49%), Gaps = 67/407 (16%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F    LS   +  I K GF   TP+Q +TIP ++  RD++G A+TGSGKT AF++P I  
Sbjct: 46  FQDLTLSPPTLKAIEKMGFTTLTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIEL 105

Query: 192 IKTHSSKI----GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
           +  HS K     G   ++++P+RELA+Q   V +E  +       ++ GG +   +   +
Sbjct: 106 L--HSLKFKPRNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADKL 163

Query: 248 MNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-N 305
           M   +++IATPGR L HL+       K+++  + DEADR+ E+GF+D++ +++  LP+ +
Sbjct: 164 MKGVNMLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMKQIIKILPNED 223

Query: 306 RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAESKIS--ENLEMLFLSTKNDEREANLL 362
           RQ++LFSAT  + + D A+  L   P+ + + +E   S  + LE  ++   +D+R   L 
Sbjct: 224 RQSMLFSATQTTKVEDLARISLRKGPLFINVASEDNTSTADGLEQGYVVCDSDKRFLLLF 283

Query: 363 YLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 422
             L+         + Q++K                                         
Sbjct: 284 SFLK---------RNQKKKI---------------------------------------- 294

Query: 423 PSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 482
                 I+F+ + + V+Y ++LL      +  ++G   Q  R    + F      IL+ T
Sbjct: 295 ------IVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNADRGILICT 348

Query: 483 DVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           DVAARG+DIP +  ++ F  P   + +IHRVGRTAR G +G   S++
Sbjct: 349 DVAARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 394

>TBLA0C06780 Chr3 complement(1636223..1637713) [1491 bp, 496 aa]
           {ON} Anc_5.40 YMR290C
          Length = 496

 Score =  174 bits (442), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 121/408 (29%), Positives = 203/408 (49%), Gaps = 67/408 (16%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F    LS+  +  I K  F + T +Q +TIP +L  RD++G A+TGSGKT AF++P I 
Sbjct: 33  AFADLNLSEPTLKAIGKLDFTEMTAVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIE 92

Query: 191 KIKTHSSKI----GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGM 246
            +  HS K     G   ++++P+RELA+Q   V +E  +       ++ GG +   +   
Sbjct: 93  ML--HSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADK 150

Query: 247 MMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS- 304
           ++   +++IATPGR L HL+       K+++  V DEADR+ E+GF+D++ +++  LP+ 
Sbjct: 151 LVKGVNILIATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQIIKILPNE 210

Query: 305 NRQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAESKIS--ENLEMLFLSTKNDEREANL 361
           +RQ++LFSAT  + + D A+  L   P+ + +  E+  S  + LE  ++  ++D+R   L
Sbjct: 211 DRQSMLFSATQTTKVEDLARISLRKGPLFINVVPENDTSTADGLEQGYVVCESDKRFLLL 270

Query: 362 LYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 421
              L+         + Q++K                                        
Sbjct: 271 FSFLK---------RNQKKKI--------------------------------------- 282

Query: 422 LPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVV 481
                  I+F+ + + V+Y ++LL      +  ++G   Q  R    + F      ILV 
Sbjct: 283 -------IVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVC 335

Query: 482 TDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           TDVAARG+DIP +  +I F  P   + +IHRVGRTAR G +G   S++
Sbjct: 336 TDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 382

>Skud_7.100 Chr7 (187842..189518) [1677 bp, 558 aa] {ON} YGL171W
           (REAL)
          Length = 558

 Score =  176 bits (445), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 132/483 (27%), Positives = 234/483 (48%), Gaps = 86/483 (17%)

Query: 130 GSFPS----FGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           GSF      F   K ++ N+ + GF +PTPIQ + IP+ L NRDI+    TGSGKT AF+
Sbjct: 119 GSFEDLISRFSFDKRLLNNLVENGFTEPTPIQNECIPVALNNRDILACGPTGSGKTLAFL 178

Query: 186 LPMIRKIKTHSSKIGARAVILSPSRELAMQ--------THNVFKEFSKGTQLRSVLLTGG 237
           +P++++I       G + +I+SP++ELA Q        +H +F E  +  Q+  +  + G
Sbjct: 179 IPLVQQIIDDKHTSGLKGLIISPTKELASQIFIECFKLSHKIFLEKKRPLQVALLSKSLG 238

Query: 238 DSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNE 297
             L+++  +     D+II+TP R + +  + +LDL  +++ +FDEAD+LF+  F +Q ++
Sbjct: 239 AKLKNKV-ISDKKYDIIISTPLRLIDVVKKEALDLSRVKHLIFDEADKLFDKTFVEQSDD 297

Query: 298 LLASL--PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKND 355
           +L++   P+ R+  +FSAT+PSS+ + A++ + +P+ V +  +   + N+E   +   N+
Sbjct: 298 ILSACKEPALRKA-MFSATIPSSVEEIAQSIMMDPIRVIIGHKEAANTNIEQKLIFCGNE 356

Query: 356 EREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXER 415
             E  L+ + Q V         Q+ +F                                 
Sbjct: 357 --EGKLIAIRQLV---------QEGEFK-------------------------------- 373

Query: 416 LPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGL 475
            PP          I+F+ +    + +   L      +  I+       R R +  F++G 
Sbjct: 374 -PP---------IIIFLESIARAKALYHELMYDRINVDVIHAERTVLQRDRIIERFKSGE 423

Query: 476 TSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXX 535
              L+ TDV ARG+D   +  VIN+ +P SS+ ++HR+GRT RAG  G A +  +     
Sbjct: 424 LWCLICTDVLARGIDFKGVNLVINYDVPESSQAYVHRIGRTGRAGRSGKAVTFYTKQDSV 483

Query: 536 XXXXXXXXXGKKIMLTPMYDSLCEIMKNKWIAE-----GNDESSFVNPKIAYTDRLILGS 590
                      K ++  M  S CE+  +KW+ +       ++ S  N K A+T+R  + +
Sbjct: 484 AI---------KPIINVMKQSGCEV--SKWMDKMAKLTKREKESIKNGK-AHTERKQITT 531

Query: 591 APR 593
            P+
Sbjct: 532 VPK 534

>YMR290C Chr13 complement(850074..851591) [1518 bp, 505 aa] {ON}
           HAS1ATP-dependent RNA helicase; localizes to both the
           nuclear periphery and nucleolus; highly enriched in
           nuclear pore complex fractions; constituent of 66S
           pre-ribosomal particles
          Length = 505

 Score =  174 bits (441), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 124/420 (29%), Positives = 206/420 (49%), Gaps = 74/420 (17%)

Query: 119 TTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGS 178
           TT +EK       F    LS+  +  I K GF   T +Q +TIP +L  RD++G A+TGS
Sbjct: 38  TTCVEK-------FEELKLSQPTLKAIEKMGFTTMTSVQARTIPPLLAGRDVLGAAKTGS 90

Query: 179 GKTAAFILPMIRKIKTHSSKI----GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLL 234
           GKT AF++P I  +  HS K     G   ++++P+RELA+Q   V +E  +       ++
Sbjct: 91  GKTLAFLIPAIELL--HSLKFKPRNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIV 148

Query: 235 TGGDSLEDQFGMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQD 293
            GG +   +   +M   +++IATPGR L HL+       K+++  + DEADR+ E+GF+D
Sbjct: 149 IGGANRRQEAEKLMKGVNMLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFED 208

Query: 294 QLNELLASLPS-NRQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAES--KISENLEMLF 349
           ++ +++  LP+ +RQ++LFSAT  + + D A+  L   P+ + +  E+    ++ LE  +
Sbjct: 209 EMRQIIKILPNEDRQSMLFSATQTTKVEDLARISLRPGPLFINVVPETDNSTADGLEQGY 268

Query: 350 LSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXX 409
           +   +D+R   L   L+         + Q++K                            
Sbjct: 269 VVCDSDKRFLLLFSFLK---------RNQKKKI--------------------------- 292

Query: 410 XXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLY 469
                              I+F+ + + V+Y ++LL      +  ++G   Q  R    +
Sbjct: 293 -------------------IVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFF 333

Query: 470 NFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
            F      IL+ TDVAARG+DIP +  +I F  P   + +IHRVGRTAR G +G   S++
Sbjct: 334 EFCNAERGILICTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 392

>ZYRO0D07546g Chr4 (657145..658629) [1485 bp, 494 aa] {ON} highly
           similar to uniprot|Q03532 Saccharomyces cerevisiae
           YMR290C HAS1 ATP-dependent RNA helicase localizes to
           both the nuclear periphery and nucleolus highly enriched
           in nuclear pore complex fractions
          Length = 494

 Score =  174 bits (440), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 123/416 (29%), Positives = 206/416 (49%), Gaps = 67/416 (16%)

Query: 123 EKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTA 182
           E S+    +F    LS+  +  I K GF   T +Q +TIP +L  RD++G A+TGSGKT 
Sbjct: 23  ESSEKLSQTFGELELSQPTLKAIDKMGFTTMTSVQARTIPPLLAGRDVLGAAKTGSGKTL 82

Query: 183 AFILPMIRKIKTHSSKI----GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGD 238
           AF++P I ++  HS K     G   ++++P+RELA+Q   V +E  +       ++ GG 
Sbjct: 83  AFLIPAIERL--HSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGA 140

Query: 239 SLEDQFGMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNE 297
           +   +   ++   +++IATPGR L HL+       K+++  + DEADR+ E+GF++++ +
Sbjct: 141 NRRQEADKLVKGVNLLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEEEMRQ 200

Query: 298 LLASLPS-NRQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAESKIS--ENLEMLFLSTK 353
           ++  LP+ +RQ++LFSAT  + + D A+  L   P+ + + +E   S  E LE  ++   
Sbjct: 201 IIKILPNEDRQSMLFSATQTTKVEDLARISLRAGPLFINVVSEKDNSTVEGLEQGYVVCD 260

Query: 354 NDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXX 413
           +D+R   L   L+         + Q++K                                
Sbjct: 261 SDKRFLLLFSFLK---------RNQKKKI------------------------------- 280

Query: 414 ERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRT 473
                          I+F+ + + V+Y ++LL      +  ++G   Q  R    + F  
Sbjct: 281 ---------------IVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCN 325

Query: 474 GLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
               ILV TDVAARG+DIP +  +I F  P   + +IHRVGRTAR G +G   S++
Sbjct: 326 AERGILVSTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GAKGKGKSLM 380

>Suva_13.480 Chr13 complement(832037..833554) [1518 bp, 505 aa] {ON}
           YMR290C (REAL)
          Length = 505

 Score =  173 bits (439), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 119/408 (29%), Positives = 201/408 (49%), Gaps = 67/408 (16%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F    LS+  +  I K GF   T +Q +TIP +L  RD++G A+TGSGKT AF++P I 
Sbjct: 43  TFAELNLSEPTLKAIEKMGFTTMTSVQSRTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIE 102

Query: 191 KIKTHSSKI----GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGM 246
            +  HS K     G   ++++P+RELA+Q   V +E  +       ++ GG +   +   
Sbjct: 103 LL--HSLKFKPRNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEK 160

Query: 247 MMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS- 304
           +M   +++IATPGR L HL+       K+++  + DEADR+ E+GF+D++ +++  LP+ 
Sbjct: 161 LMKGVNMLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMRQIIKILPND 220

Query: 305 NRQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAES--KISENLEMLFLSTKNDEREANL 361
           +RQ++LFSAT  + + D A+  L   P+ + +  E+    ++ LE  ++   +D R   L
Sbjct: 221 DRQSMLFSATQTTKVEDLARISLRPGPLFINVVPETDNSTADGLEQGYVVCDSDNRFLLL 280

Query: 362 LYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 421
              L+         + Q++K                                        
Sbjct: 281 FSFLK---------RNQKKKI--------------------------------------- 292

Query: 422 LPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVV 481
                  I+F+ + + V+Y ++LL      +  ++G   Q  R    + F      IL+ 
Sbjct: 293 -------IVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILIC 345

Query: 482 TDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           TDVAARG+DIP +  ++ F  P   + +IHRVGRTAR G +G   S++
Sbjct: 346 TDVAARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 392

>Smik_13.506 Chr13 complement(832760..834277) [1518 bp, 505 aa] {ON}
           YMR290C (REAL)
          Length = 505

 Score =  173 bits (439), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 124/420 (29%), Positives = 205/420 (48%), Gaps = 74/420 (17%)

Query: 119 TTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGS 178
           TT +EK       F    LS+  +  I K GF   T +Q +TIP +L  RD++G A+TGS
Sbjct: 38  TTYVEK-------FEELKLSQPTLKAIEKMGFTTMTSVQSRTIPPLLAGRDVLGAAKTGS 90

Query: 179 GKTAAFILPMIRKIKTHSSKI----GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLL 234
           GKT AF++P I  +  HS K     G   ++++P+RELA+Q   V +E  +       ++
Sbjct: 91  GKTLAFLIPAIELL--HSLKFKPRNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIV 148

Query: 235 TGGDSLEDQFGMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQD 293
            GG +   +   +M   +++IATPGR L HL+       K+++  + DEADR+ E+GF+D
Sbjct: 149 IGGANRRQEAEKLMKGVNMLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFED 208

Query: 294 QLNELLASLPS-NRQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAES--KISENLEMLF 349
           ++ +++  LP+ +RQ++LFSAT  + + D A+  L   P+ + +  E+    ++ LE  +
Sbjct: 209 EMRQIIKILPNEDRQSMLFSATQTTKVEDLARISLRPGPLFINVVPETDNSTADGLEQGY 268

Query: 350 LSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXX 409
           +   +D R   L   L+         + Q++K                            
Sbjct: 269 VVCDSDNRFLLLFSFLK---------RNQKKKI--------------------------- 292

Query: 410 XXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLY 469
                              I+F+ + + V+Y ++LL      +  ++G   Q  R    +
Sbjct: 293 -------------------IVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFF 333

Query: 470 NFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
            F      IL+ TDVAARG+DIP +  +I F  P   + +IHRVGRTAR G +G   S++
Sbjct: 334 EFCNAERGILICTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 392

>KNAG0D02780 Chr4 complement(504774..506204) [1431 bp, 476 aa] {ON}
           Anc_5.40 YMR290C
          Length = 476

 Score =  172 bits (436), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 119/407 (29%), Positives = 201/407 (49%), Gaps = 67/407 (16%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F S  LS   +  I K GF + T +Q +TIP +L  +D++G A+TGSGKT AF++P I  
Sbjct: 11  FSSLELSAPTMKAIEKMGFTKMTTVQERTIPPLLAGKDVLGAAKTGSGKTLAFLIPAIET 70

Query: 192 IKTHSSKI----GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
           +  H+ K     G   ++++P+RELA+Q   V +E  +       ++ GG +   +   +
Sbjct: 71  L--HALKFKPRNGTGVIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEKL 128

Query: 248 MNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-N 305
               +++IATPGR L HL+       K+++  V DEADR+ E+GF+D++ +++  LP+  
Sbjct: 129 AKGVNILIATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQIIRILPNEE 188

Query: 306 RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAES--KISENLEMLFLSTKNDEREANLL 362
           RQ++LFSAT  + + D A+  L   P+ + +  E+    ++ LE  ++  ++D+R   L 
Sbjct: 189 RQSMLFSATQTTKVEDLARISLRKGPLFINVVPETDHSTADGLEQGYVVCESDKRFLLLF 248

Query: 363 YLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 422
             L+         + Q++K                                         
Sbjct: 249 SFLK---------RNQKKK----------------------------------------- 258

Query: 423 PSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 482
                 I+F+ + + V+Y ++LL      +  ++G   Q  R    + F      ILV T
Sbjct: 259 -----VIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCT 313

Query: 483 DVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           DVAARG+DIP +  ++ F  P   + +IHRVGRTAR G +G   S++
Sbjct: 314 DVAARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 359

>Skud_13.463 Chr13 complement(823646..825163) [1518 bp, 505 aa] {ON}
           YMR290C (REAL)
          Length = 505

 Score =  173 bits (438), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 120/407 (29%), Positives = 200/407 (49%), Gaps = 67/407 (16%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F    LS+  +  I K GF   T +Q +TIP +L  RD++G A+TGSGKT AF++P I  
Sbjct: 44  FEELKLSQPTLKAIEKLGFTTMTSVQSRTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIEL 103

Query: 192 IKTHSSKI----GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
           +  HS K     G   ++++P+RELA+Q   V +E  +       ++ GG +   +   +
Sbjct: 104 L--HSLKFKPRNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKL 161

Query: 248 MNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-N 305
           M   +++IATPGR L HL+       K+++  + DEADR+ E+GF+D++ +++  LP+ +
Sbjct: 162 MKGVNMLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMRQIIKILPNED 221

Query: 306 RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAES--KISENLEMLFLSTKNDEREANLL 362
           RQ++LFSAT  + + D A+  L   P+ + +  E+    ++ LE  ++   +D+R   L 
Sbjct: 222 RQSMLFSATQTTKVEDLARISLRPGPLFINVVPETDNSTADGLEQGYVVCDSDDRFLLLF 281

Query: 363 YLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 422
             L+         + Q++K                                         
Sbjct: 282 SFLK---------RNQKKKI---------------------------------------- 292

Query: 423 PSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 482
                 I+F+ + + V+Y ++LL      +  ++G   Q  R    + F      IL+ T
Sbjct: 293 ------IVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICT 346

Query: 483 DVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           DVAARG+DIP +  +I F  P   + +IHRVGRTAR G  G   S++
Sbjct: 347 DVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTEGKGKSLM 392

>TDEL0E04210 Chr5 complement(786151..788373) [2223 bp, 740 aa] {ON}
           Anc_5.208 YLL008W
          Length = 740

 Score =  176 bits (446), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 97/247 (39%), Positives = 149/247 (60%), Gaps = 4/247 (1%)

Query: 123 EKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTA 182
           + +K     F S  LS+ ++  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTA
Sbjct: 212 QATKQVHNDFNSLSLSRPVLKGLGDLGYTRPSPIQSATIPIALLGKDIIAGAVTGSGKTA 271

Query: 183 AFILPMIRKIKTHSSKIGA-RAVILSPSRELAMQTHNVFKEFSKGTQ-LRSVLLTGGDSL 240
           AF++P+I ++    +KI + R ++L+P+RELA+Q  +V K+  K    L   L  GG +L
Sbjct: 272 AFMIPIIERLLYKPAKIASTRVIVLTPTRELAIQVSDVAKKLGKYVSGLTFGLAVGGLNL 331

Query: 241 EDQFGMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELL 299
             Q   +   PD+++ATPGRF+ H++   S ++ S+E  V DEADR+ E GFQ++LNE+L
Sbjct: 332 RQQEQSLKARPDIVVATPGRFIDHIRNSASFNVDSVEVLVIDEADRMLEEGFQEELNEIL 391

Query: 300 ASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLST-KNDERE 358
           + LPS RQTLLFSAT+ S +       L  PV V +D   + +  L   F+   K D  +
Sbjct: 392 SLLPSKRQTLLFSATMNSKIKQLVSLTLKRPVRVMIDPPKQAASKLTQEFVRIRKRDHLK 451

Query: 359 ANLLYLL 365
            ++L+ L
Sbjct: 452 PSVLFHL 458

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 65/105 (61%)

Query: 425 EKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 484
           +K  ++FV  +     +  +L   G  +  ++G+L Q  R + +  F++    ILV TD+
Sbjct: 467 QKRMVVFVARKEMAHRLRIILGLLGISVGELHGSLSQEQRLQSVNQFKSLEVPILVCTDL 526

Query: 485 AARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           A+RG+DIP +  VIN+ +P + ++++HRVGRTARAG  G + S+V
Sbjct: 527 ASRGLDIPKIEVVINYDMPKNYEVYLHRVGRTARAGREGRSVSLV 571

>NCAS0A01550 Chr1 complement(302857..305103) [2247 bp, 748 aa] {ON}
           Anc_5.208
          Length = 748

 Score =  175 bits (443), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 147/244 (60%), Gaps = 4/244 (1%)

Query: 126 KHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           K    +F S  LS+ ++  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF+
Sbjct: 222 KQTYANFNSLSLSRPVLKGLATLGYTKPSPIQSATIPVALSGKDIIAGAVTGSGKTAAFM 281

Query: 186 LPMIRKIKTHSSKIGA-RAVILSPSRELAMQTHNVFKEFSKGTQ-LRSVLLTGGDSLEDQ 243
           +P+I ++   S+KI A R ++L+P+RELA+Q  +V K+  K    +   L  GG +L  Q
Sbjct: 282 IPVIERLLFKSAKIAATRVIVLTPTRELAIQISDVGKKIGKFINGITFGLAVGGLNLRQQ 341

Query: 244 FGMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASL 302
              +   PD++IATPGRF+ H++   S ++ S+E  V DEADR+ E GFQ++LNE++  L
Sbjct: 342 EQELKARPDIVIATPGRFIDHIRNSASFNVDSVEILVIDEADRMLEEGFQEELNEIMQLL 401

Query: 303 PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTK-NDEREANL 361
           P+ RQTLLFSAT+ S +       L  PV + +D   + +  L   F+  +  D  +  L
Sbjct: 402 PNKRQTLLFSATMNSKIKQLVSLSLRKPVRIMIDPPKQAASRLTQEFVRIRARDHLKPAL 461

Query: 362 LYLL 365
           L+ L
Sbjct: 462 LFNL 465

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 64/105 (60%)

Query: 425 EKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 484
           +K  ++FV  +     +  +L   G  ++ ++G+L Q  R   +  F++    +L+ TD+
Sbjct: 474 QKRMVVFVSRKEMAHRLRIILGLLGMNVAELHGSLSQEQRLESVTKFKSLEIPVLICTDL 533

Query: 485 AARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           A+RG+DIP +  VIN+ +P S +I++HRVGRTARAG  G + S V
Sbjct: 534 ASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVSFV 578

>Skud_15.210 Chr15 complement(374410..375858) [1449 bp, 482 aa] {ON}
           YOR046C (REAL)
          Length = 482

 Score =  170 bits (431), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 128/409 (31%), Positives = 198/409 (48%), Gaps = 71/409 (17%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFILPM 188
           SF   GL+  ++  I    F++P+ IQ + +PL+L N  R+++  +++G+GKTAAF L M
Sbjct: 93  SFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTM 152

Query: 189 IRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMM 248
           + ++    +    +A+ L+PSRELA QT +V +E  K T++ S L+   DS E    +  
Sbjct: 153 LTRVNPEDA--SPQAICLAPSRELARQTLDVIQEMGKFTEITSQLIVP-DSFEKNKQI-- 207

Query: 249 NNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF-EMGFQDQLNELLASLPSNRQ 307
            N  VI+ TPG  L L     + L+ I+  V DEAD +  + G  DQ   +   LP + Q
Sbjct: 208 -NAQVIVGTPGTVLDLMRRKLVQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDAQ 266

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQD 367
            +LFSAT   ++  +AK               KI  N   L L T     E N+     D
Sbjct: 267 LVLFSATFAEAVRQYAK---------------KIVPNANTLELQT----NEVNV-----D 302

Query: 368 VIK-IPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 426
            IK + +  K +  KF                               E L     L +  
Sbjct: 303 AIKQLYMDCKNEADKF-------------------------------EVLTELYGLMTIG 331

Query: 427 ATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 486
           ++I+FV T+     +   LK+ G+ +S ++G L    R R + +FR G + +L+ T+V A
Sbjct: 332 SSIIFVATKKTANVLYGKLKNEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLA 391

Query: 487 RGVDIPMLANVINFSLP------ASSKIFIHRVGRTARAGNRGWAYSIV 529
           RG+DIP ++ V+N+ LP      A    +IHR+GRT R G +G A S V
Sbjct: 392 RGIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFV 440

>SAKL0A06204g Chr1 complement(560276..562807) [2532 bp, 843 aa] {ON}
           similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237W PRP5 RNA helicase in the DEAD-box family
          Length = 843

 Score =  175 bits (444), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 93/245 (37%), Positives = 156/245 (63%), Gaps = 10/245 (4%)

Query: 132 FPSFGLSKIIVTNITKR-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +   GL+  I+  ITK   F  PTPIQ + IP I+  RD+VG+++TGSGKT +F+LP++R
Sbjct: 252 WSQLGLTTDIMDLITKEFKFVTPTPIQAQAIPAIMSGRDVVGISKTGSGKTVSFLLPLLR 311

Query: 191 KIKTH----SSKIGARAVILSPSRELAMQTHNVFKEFSKGT-QLRSVLLTGGDSLEDQFG 245
           +IK       ++ G   +IL+P+RELA+Q +    +F+ G+  +RS+  TGG  L+ Q  
Sbjct: 312 QIKAQRPLSKTETGPMGLILAPTRELAVQIYEEVVKFTTGSGSIRSICCTGGSELKQQIN 371

Query: 246 MMMNNPDVIIATPGRFLHLKVEMS---LDLKSIEYAVFDEADRLFEMGFQDQLNELLASL 302
            +    +V++ATPGRF+ L    S   L  + I + V DEADRLF++GF+ Q+ +++ ++
Sbjct: 372 DLKKGVEVVVATPGRFIDLLTLNSGRLLSTERITFVVMDEADRLFDLGFEPQITQIMKAV 431

Query: 303 PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEM-LFLSTKNDEREANL 361
             ++Q +LFSAT P+ L +FA   L  P+ + ++++S I+EN+E  L +   ++E+ A +
Sbjct: 432 RPDKQCVLFSATFPNKLKNFALKILQKPISITINSKSLINENIEQRLKIFQTDNEKFAAM 491

Query: 362 LYLLQ 366
           L +L+
Sbjct: 492 LEVLE 496

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 56/102 (54%)

Query: 428 TILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 487
           TI+FV ++   + I   L + GY+   I+     + R   L  F+     IL+ T+V +R
Sbjct: 522 TIVFVSSQQICDLIYNRLLEHGYVTYAIHAGKPYNERASNLEKFKNTPNGILLCTEVLSR 581

Query: 488 GVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           G+++P ++ VI ++   +   ++H  GRTAR  N+G A +++
Sbjct: 582 GLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGTNKGVALTML 623

>KAFR0E01160 Chr5 (232985..234202) [1218 bp, 405 aa] {ON} Anc_3.249
           YDR021W
          Length = 405

 Score =  167 bits (424), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 108/410 (26%), Positives = 199/410 (48%), Gaps = 65/410 (15%)

Query: 130 GSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMI 189
            SF S  L+ +++  I   GF  P+ IQ + I  I+  RD++  A++G+GKTA F + M+
Sbjct: 23  ASFESMQLNPLLLQGIYSNGFEAPSAIQSRAITQIISGRDVIAQAQSGTGKTATFTIGML 82

Query: 190 RKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSL------EDQ 243
           +     SS++  + +ILSP+RELA Q + V         ++S+ + GG +       ++ 
Sbjct: 83  QVCNFKSSEL--QCLILSPTRELASQINQVVCNIGDYLNVKSMAVVGGKTSASSSKNKND 140

Query: 244 FGMMMNNPDVIIA-TPGRFLHLKVEMSLDLKSIEYAVFDEADRLF--EMGFQDQLNELLA 300
             ++ NN   I++ TPGR L L     ++ K ++  V DEAD L    +GF+ Q+ ++  
Sbjct: 141 LNLLRNNKCHIVSGTPGRVLDLIKRQVINTKKVKILVLDEADELLAESLGFKQQIYDIFT 200

Query: 301 SLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREAN 360
            LP   Q ++ SAT+   +++  K  L +PV + +  +    E ++   ++   +E + +
Sbjct: 201 KLPKTCQVVVVSATMNKDIIEVTKKFLNDPVKILVKQDQISLEGIKQYHVNVDKEEWKFD 260

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
            L  L D + I                                                N
Sbjct: 261 TLCDLYDSLTI------------------------------------------------N 272

Query: 421 QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480
           Q       ++F  T+  V+++S  L  + + +  ++G + Q  R + + +FR+G + +L+
Sbjct: 273 QC------VIFCNTKKKVDWLSSKLLQANFSVVSMHGDMKQEERDKIMNDFRSGHSRVLI 326

Query: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
            TDV ARG+D+  ++ VIN+ LP + + +IHR+GR+ R G +G A + V+
Sbjct: 327 STDVWARGIDVQQVSLVINYDLPENMENYIHRIGRSGRFGRKGVAINFVT 376

>KAFR0C06420 Chr3 complement(1286002..1288221) [2220 bp, 739 aa]
           {ON} Anc_5.208 YLL008W
          Length = 739

 Score =  174 bits (440), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 98/246 (39%), Positives = 148/246 (60%), Gaps = 8/246 (3%)

Query: 126 KHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           K    +F +  LS+ ++  ++  GF +P+PIQ  TIP+ L  +DIV  A TGSGKTAAF+
Sbjct: 210 KQTHTTFNTLNLSRPVLKGLSSLGFTKPSPIQSATIPIALLGKDIVAGAVTGSGKTAAFM 269

Query: 186 LPMIRKIKTHSSKIGA-RAVILSPSRELAMQTHNVFKE---FSKGTQLRSVLLTGGDSLE 241
           +P+I ++    +K+ + R VIL+P+RELA+Q  +V K+   F  G  L   L  GG +L 
Sbjct: 270 IPIIERLLYKPAKVASTRVVILTPTRELAIQISDVAKKIGHFVNG--LTFGLAVGGLNLR 327

Query: 242 DQFGMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLA 300
            Q  ++ + PD++IATPGRF+ H++   S  +  +E  V DEADR+ E GFQD+L+E++ 
Sbjct: 328 QQEQILKSRPDIVIATPGRFIDHVRNSASFSVDRVEILVLDEADRMLEEGFQDELSEIMT 387

Query: 301 SLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLST-KNDEREA 359
            LP+ RQ LLFSAT+ S +       L  PV + +D   + ++ L   F+   K D  + 
Sbjct: 388 LLPTRRQNLLFSATMNSKIKQLVSLSLKKPVRIMIDPPKQAADRLVQEFVRIRKRDHLKP 447

Query: 360 NLLYLL 365
            LLY L
Sbjct: 448 ALLYNL 453

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 64/105 (60%)

Query: 425 EKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 484
           +K  ++FV  +     +  +L   G  ++ ++G+L Q  R   +  F++    +L+ TD+
Sbjct: 462 QKRIVVFVSRKEVAHRLRIILGLLGMGVAELHGSLSQEQRLDSVNKFKSLDVPVLICTDL 521

Query: 485 AARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           A+RG+DIP +  VIN+ +P S +I++HRVGRTARAG  G + + V
Sbjct: 522 ASRGLDIPKIEIVINYDMPKSYEIYLHRVGRTARAGREGRSVTFV 566

>Suva_8.98 Chr8 complement(177272..178720) [1449 bp, 482 aa] {ON}
           YOR046C (REAL)
          Length = 482

 Score =  169 bits (428), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 128/409 (31%), Positives = 197/409 (48%), Gaps = 71/409 (17%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFILPM 188
           SF   GL+  ++  I    F++P+ IQ + +PL+L N  R+++  +++G+GKTAAF L M
Sbjct: 93  SFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPARNMIAQSQSGTGKTAAFSLTM 152

Query: 189 IRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMM 248
           + ++    +    +A+ L+PSRELA QT  V +E  K T++ S L+   DS E    +  
Sbjct: 153 LTRVNPEDA--SPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVP-DSFEKNKQI-- 207

Query: 249 NNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF-EMGFQDQLNELLASLPSNRQ 307
            N  VI+ TPG  L L     + L+ I+  V DEAD +  + G  DQ   +   LP + Q
Sbjct: 208 -NAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQ 266

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQD 367
            +LFSAT   ++  +AK               KI  N   L L T     E N+     D
Sbjct: 267 LVLFSATFADAVRQYAK---------------KIVPNANTLELQT----NEVNV-----D 302

Query: 368 VIK-IPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 426
            IK + +  K +  KF                               E L     L +  
Sbjct: 303 AIKQLYMDCKNEADKF-------------------------------EVLTELYGLMTIG 331

Query: 427 ATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 486
           ++I+FV T+     +   LK+ G+ +S ++G L    R R + +FR G + +L+ T+V A
Sbjct: 332 SSIIFVATKKTANVLYGKLKNEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLA 391

Query: 487 RGVDIPMLANVINFSLP------ASSKIFIHRVGRTARAGNRGWAYSIV 529
           RG+DIP ++ V+N+ LP      A    +IHR+GRT R G +G A S V
Sbjct: 392 RGIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFV 440

>NCAS0A01400 Chr1 (274080..276368) [2289 bp, 762 aa] {ON} Anc_5.241
          Length = 762

 Score =  173 bits (439), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 120/416 (28%), Positives = 194/416 (46%), Gaps = 69/416 (16%)

Query: 121 NLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGK 180
           N +    K   F    +S   +  +++  F + T IQR++IP+ L+  D++G A+TGSGK
Sbjct: 32  NYDPKTAKTTFFKDLPISNATLKGLSEAAFLKLTDIQRESIPVSLKGYDVLGSAKTGSGK 91

Query: 181 TAAFILPMIRKI--KTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGD 238
           T AF++P++ K+  +  +   G  A+I+SP+RELAMQ + V  +    T   + L+ GG 
Sbjct: 92  TLAFLIPVLEKLYRERWTEFDGLGALIISPTRELAMQIYEVLIKIGSHTSFSAGLVIGGK 151

Query: 239 SLEDQFGMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNE 297
            ++ +   + +  +++I TPGR L HL   + L+  +++  V DEADR  +MGF+  L+ 
Sbjct: 152 DVKFELERI-SRINILIGTPGRILQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDA 210

Query: 298 LLASLPSNRQTLLFSATLPSSLVDFAK--------AGLTNPVLVRLDAESKISENLEMLF 349
           ++ +LP +RQTLLFSAT   SL D A+         G  +    + DAE+     LE  +
Sbjct: 211 IVGNLPPSRQTLLFSATQSQSLADLARLSLTDYKSVGTMDKANEKSDAEAATPATLEQSY 270

Query: 350 LSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXX 409
           +  +     A+ L +L   IK  L  K                                 
Sbjct: 271 IEVEL----ADKLDVLFSFIKTHLKAK--------------------------------- 293

Query: 410 XXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLK--DSGYLISYIYGTLDQHARKRQ 467
                              I+F+ +   V ++ +  +    G  + +++G   Q AR   
Sbjct: 294 ------------------MIVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQKARTET 335

Query: 468 LYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRG 523
           L  F       L  TDV ARG+D P +  VI    P  +  +IHRVGR+AR G +G
Sbjct: 336 LDKFSRAQQVCLFATDVVARGIDFPSVDWVIQLDCPEDADTYIHRVGRSARYGKKG 391

>Smik_15.224 Chr15 complement(380539..381972) [1434 bp, 477 aa] {ON}
           YOR046C (REAL)
          Length = 477

 Score =  168 bits (425), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 126/409 (30%), Positives = 197/409 (48%), Gaps = 71/409 (17%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFILPM 188
           SF   GL+  ++  I    F++P+ IQ + +PL+L N  R+++  +++G+GKTAAF L M
Sbjct: 88  SFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTM 147

Query: 189 IRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMM 248
           + ++    +    +A+ L+PSRELA QT  V +E  K T++ S L+   DS E    +  
Sbjct: 148 LTRVNPEDA--SPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVP-DSFEKNKQI-- 202

Query: 249 NNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF-EMGFQDQLNELLASLPSNRQ 307
            N  +I+ TPG  L L     + L+ I+  V DEAD +  + G  DQ   +   LP + Q
Sbjct: 203 -NSQIIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQ 261

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQD 367
            +LFSAT   ++  +AK               KI  N   L L T     E N+     D
Sbjct: 262 LVLFSATFADAVRQYAK---------------KIVPNANTLELQT----NEVNV-----D 297

Query: 368 VIK-IPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 426
            IK + +  K +  KF                               + L     L +  
Sbjct: 298 AIKQLYMDCKNEADKF-------------------------------DVLTELYGLMTIG 326

Query: 427 ATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 486
           ++I+FV T+     +   LK+ G+ +S ++G L    R R + +FR G + +L+ T+V A
Sbjct: 327 SSIIFVATKKTANVLYGKLKNEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLA 386

Query: 487 RGVDIPMLANVINFSLP------ASSKIFIHRVGRTARAGNRGWAYSIV 529
           RG+DIP ++ V+N+ LP      A    +IHR+GRT R G +G A S V
Sbjct: 387 RGIDIPTVSMVVNYDLPTLANGKADPATYIHRIGRTGRFGRKGVAISFV 435

>YOR046C Chr15 complement(414459..415907) [1449 bp, 482 aa] {ON}
           DBP5Cytoplasmic ATP-dependent RNA helicase of the
           DEAD-box family; involved in mRNA export from the
           nucleus; involved in translation termination; ATP/ADP
           cycling is regulated by Gle1p and Nup159p
          Length = 482

 Score =  168 bits (425), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 127/409 (31%), Positives = 196/409 (47%), Gaps = 71/409 (17%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFILPM 188
           SF   GL+  ++  I    F++P+ IQ + +PL+L N  R+++  +++G+GKTAAF L M
Sbjct: 93  SFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTM 152

Query: 189 IRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMM 248
           + ++    +    +A+ L+PSRELA QT  V +E  K T++ S L+   DS E    +  
Sbjct: 153 LTRVNPEDA--SPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVP-DSFEKNKQI-- 207

Query: 249 NNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF-EMGFQDQLNELLASLPSNRQ 307
            N  VI+ TPG  L L     + L+ I+  V DEAD +  + G  DQ   +   LP + Q
Sbjct: 208 -NAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQ 266

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQD 367
            +LFSAT   ++  +AK               KI  N   L L T     E N+     D
Sbjct: 267 LVLFSATFADAVRQYAK---------------KIVPNANTLELQT----NEVNV-----D 302

Query: 368 VIK-IPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 426
            IK + +  K +  KF+                                L     L +  
Sbjct: 303 AIKQLYMDCKNEADKFD-------------------------------VLTELYGLMTIG 331

Query: 427 ATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 486
           ++I+FV T+     +   LK  G+ +S ++G L    R R + +FR G + +L+ T+V A
Sbjct: 332 SSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLA 391

Query: 487 RGVDIPMLANVINFSLP------ASSKIFIHRVGRTARAGNRGWAYSIV 529
           RG+DIP ++ V+N+ LP      A    +IHR+GRT R G +G A S V
Sbjct: 392 RGIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFV 440

>KLLA0F10505g Chr6 complement(966736..969174) [2439 bp, 812 aa] {ON}
           similar to uniprot|Q754U8 Ashbya gossypii AFL027C PRP5
           Pre-mRNA-processing ATP-dependent RNA helicase PRP5 and
           weakly similar to YBR237W uniprot|P21372 Saccharomyces
           cerevisiae PRP5 RNA helicase in the DEAD-box family
          Length = 812

 Score =  173 bits (438), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 89/223 (39%), Positives = 137/223 (61%), Gaps = 8/223 (3%)

Query: 132 FPSFGLSKIIVTNITKR-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +   GLS  I+  I+    F   TPIQ + IP I+  RD++G+++TGSGKT AF+LP++R
Sbjct: 247 WSQLGLSSEIMDLISNELQFVTLTPIQCQAIPAIMSGRDVIGISKTGSGKTVAFLLPLVR 306

Query: 191 KIKTHS----SKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGM 246
           +IK        + G   +IL+P+RELA+Q      +F KG+ + S+   GG  L+ Q   
Sbjct: 307 QIKAQPPLAPDETGPIGLILTPTRELAVQIQEEALKFCKGSGISSICCVGGSELKQQINE 366

Query: 247 MMNNPDVIIATPGRFLHLKVEMSLDLKS---IEYAVFDEADRLFEMGFQDQLNELLASLP 303
           +    D+I+ATPGRF+ L    S  L S   I + V DEADRLF++GF  Q+N+++  + 
Sbjct: 367 LKRGVDIIVATPGRFIDLMTLNSGHLLSPTRISFVVMDEADRLFDLGFGPQVNQIMGCIR 426

Query: 304 SNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLE 346
            ++Q +LFSAT PS L  FA   L NP+ + ++++S I+EN++
Sbjct: 427 PDKQCVLFSATFPSKLKHFASRTLKNPIQITINSKSLINENIQ 469

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 54/105 (51%)

Query: 425 EKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 484
           ++ TI+FV ++   + +   L  +G     I+       R R L  F+     IL+ T+V
Sbjct: 500 DEKTIIFVGSQQLCDLLYDELLLNGITTFPIHAGKPSAERLRNLQKFKETDNGILICTEV 559

Query: 485 AARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
            +RG+++P ++ VI ++   +   ++H VGRT R  N G A S V
Sbjct: 560 LSRGLNVPEVSLVIIYNAAKTIAQYVHTVGRTGRGTNNGVALSFV 604

>NDAI0C02490 Chr3 complement(570276..572591) [2316 bp, 771 aa] {ON}
           Anc_5.208
          Length = 771

 Score =  172 bits (435), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 94/248 (37%), Positives = 153/248 (61%), Gaps = 9/248 (3%)

Query: 126 KHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           K    SF +  LS+ ++  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF+
Sbjct: 245 KQTHTSFNTLSLSRPVLKGLANLGYNKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFM 304

Query: 186 LPMIRKIKTHSSKIGA-RAVILSPSRELAMQTHNVFKEFSKGTQ-LRSVLLTGGDSLEDQ 243
           +P+I ++    +K+ + R ++L+P+RELA+Q  +V K+  K    L   L  GG +L  Q
Sbjct: 305 IPIIERLLFKPAKVSSTRVIVLTPTRELAIQIADVAKKIGKFVNGLTFGLAVGGLNLRQQ 364

Query: 244 FGMMMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASL 302
             ++   PD++IATPGRF+ H++   S ++ S+E  V DEADR+ E GFQ++LNE++  L
Sbjct: 365 EQILKQRPDIVIATPGRFIDHVRNSASFNVDSVEILVMDEADRMLEEGFQEELNEIMQLL 424

Query: 303 PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLD----AESKISENLEMLFLSTKNDERE 358
           P+ RQT+LFSAT+ S +       L  PV + ++    A SK+++  E + + T++  + 
Sbjct: 425 PTKRQTMLFSATMNSKIKQLINLSLKKPVRIMINPPKQAASKLTQ--EFVRIRTRDHLKP 482

Query: 359 ANLLYLLQ 366
           A L  L++
Sbjct: 483 ALLFNLIK 490

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 67/109 (61%), Gaps = 6/109 (5%)

Query: 424 SEKATILFVP---TRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480
           S+K  ++FV    T H +  I  LL   G  ++ ++G+L Q  R   +  F++    +L+
Sbjct: 496 SQKRMVVFVARKETAHKLRIILGLL---GMNVAELHGSLTQEQRLESVTKFKSLEIPVLI 552

Query: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
            TD+A+RG+DIP +  VIN+ +P S  I++HRVGRTARAG  G + S+V
Sbjct: 553 CTDLASRGLDIPKIEVVINYDMPKSYDIYLHRVGRTARAGREGRSVSLV 601

>KAFR0C06090 Chr3 complement(1208993..1210417) [1425 bp, 474 aa]
           {ON} Anc_5.643 YOR046C
          Length = 474

 Score =  167 bits (422), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 121/410 (29%), Positives = 194/410 (47%), Gaps = 71/410 (17%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFILPM 188
           SF   GL+  ++  +    F++P+ +Q + +PL+L N  R+++  +++G+GKTAAF L M
Sbjct: 85  SFDELGLAPELLKGVYAMKFQKPSKVQERALPLLLSNPPRNMIAQSQSGTGKTAAFSLAM 144

Query: 189 IRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMM 248
           + ++ T     G +A+ L+PSRELA QT  V +E  K T++ + L+     + D F    
Sbjct: 145 LSRVNTEID--GTQAICLAPSRELARQTLEVIQEMGKFTKITTQLI-----VPDSFPKNE 197

Query: 249 N-NPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFE-MGFQDQLNELLASLPSNR 306
           +    +I+ TPG  L L     L L S++  V DEAD + +  G  DQ   +   LP   
Sbjct: 198 HIKAQIIVGTPGTVLDLMRRKLLTLNSVKVFVLDEADNMLDKQGLGDQCIRVKRFLPKTT 257

Query: 307 QTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQ 366
           Q +LFSAT   ++  +AK  +                              EAN L L +
Sbjct: 258 QLVLFSATFADAVRQYAKKVVP-----------------------------EANTLELQR 288

Query: 367 DVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 426
           + + +  A K+     ND+                            E L     L +  
Sbjct: 289 NEVNVS-AIKQLYMDCNDE------------------------QHKYEVLCELYGLLTIG 323

Query: 427 ATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 486
           ++I+FV T++    +   LK  G+ +S ++G L    R R + +FR G + +L+ T+V A
Sbjct: 324 SSIIFVATKNTANLLYGKLKQEGHQVSILHGDLQSQERDRLIDDFREGRSKVLITTNVLA 383

Query: 487 RGVDIPMLANVINFSLP------ASSKIFIHRVGRTARAGNRGWAYSIVS 530
           RG+DIP ++ V+N+ LP      A    +IHR+GRT R G  G A S VS
Sbjct: 384 RGIDIPTVSMVVNYDLPTLPNGLADPATYIHRIGRTGRFGRTGVAISFVS 433

>Kpol_1058.43 s1058 complement(121252..123075) [1824 bp, 607 aa]
           {ON} complement(121252..123075) [1824 nt, 608 aa]
          Length = 607

 Score =  168 bits (426), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 124/405 (30%), Positives = 188/405 (46%), Gaps = 78/405 (19%)

Query: 149 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKI------KTHSSKIGAR 202
           GF   TP+Q  TIPL  +N+D+V  + TGSGKT +F++P+  KI       T   K    
Sbjct: 26  GFENMTPVQAATIPLFARNKDVVVDSVTGSGKTVSFVIPIFEKIVQEEANTTKMKKGHFH 85

Query: 203 AVILSPSRELAMQTHNVFKEFSKGTQ-----LRSVLLTGGDS---LEDQFGMMMNNPDVI 254
           ++I+SP++ELA Q H+VF+ F +        +RS LL G +     +D    M N P ++
Sbjct: 86  SLIVSPTKELAKQIHSVFESFLEHYPENLYPIRSQLLVGTNVKTVRDDVSDFMENKPQIL 145

Query: 255 IATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQTLLFSAT 314
           I TPGR L      S+        + DEADRL ++ F   +  ++  LP  R+T LFSAT
Sbjct: 146 IGTPGRILDFLKIPSVKTSMCSMVILDEADRLLDVSFLKDMENIMNILPKQRRTGLFSAT 205

Query: 315 LPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDVIKIPLA 374
           + S+  +  K GL NPV V ++++S+   +L++     + D++       L+ VI I   
Sbjct: 206 ITSAGDNIFKTGLRNPVKVTVNSKSQAPSSLKIDCAVVETDKK-------LEQVISII-- 256

Query: 375 TKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKATILFVPT 434
                 KF                                           K  I + PT
Sbjct: 257 ---NNYKF-------------------------------------------KKCIAYFPT 270

Query: 435 RHHVEYIS---QLLKDSGYL-----ISYIYGTLDQHARKRQLYNFRTGLT-SILVVTDVA 485
            H V Y     Q L   G +     I  ++G L   AR + L  F   ++ ++L+ TDVA
Sbjct: 271 CHSVTYFYSFMQYLLKKGIIKEEIQIYSLHGKLQTSARIKTLETFTETISNAVLLTTDVA 330

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           ARG+DIP +  V+    P   ++F+HR GRT RA   G A + ++
Sbjct: 331 ARGIDIPDVDLVLQLDPPTDPEVFLHRCGRTGRANKLGKAITFLT 375

>KLTH0A02244g Chr1 (190077..191873) [1797 bp, 598 aa] {ON} similar
           to uniprot|P25808 Saccharomyces cerevisiae YFL002C SPB4
           involved in the maturation of 25S ribosomal RNA
           ATP-dependent RNA helicase
          Length = 598

 Score =  168 bits (425), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 120/410 (29%), Positives = 198/410 (48%), Gaps = 62/410 (15%)

Query: 135 FGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKI-- 192
           + L   I T I   GF   TP+Q  TIP+   N+D+V  + TGSGKT AF +P++ K+  
Sbjct: 12  YELQPWIRTAIDAMGFEIMTPVQASTIPMFSGNKDVVVESVTGSGKTIAFTIPILEKVVK 71

Query: 193 KTHSSKIGAR----AVILSPSRELAMQTHNVFKEF-----SKGTQLRSVLLTGGDSL--- 240
           +  S     R    ++I+SP+REL+ Q  +V + F     S+   ++S L+ G  S    
Sbjct: 72  EVLSGSPLKRGHFYSLIISPTRELSKQIQDVVEAFLAYYPSESCPIKSQLIVGTSSCSVR 131

Query: 241 EDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLA 300
           +D    + N P ++I TPGR L      ++   S    V DEADRL ++ F+  +  +L 
Sbjct: 132 DDVSKFLENAPQILIGTPGRVLDFMKASTVKTSSCGVVVLDEADRLLDVSFEKDVESILG 191

Query: 301 SLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREAN 360
            LP  R+T LFSAT+ S+     + G+ NPV + + ++ +  E+L++ ++  K +E+  +
Sbjct: 192 MLPKQRRTGLFSATISSAGNQIYRTGMRNPVKIAVKSKVQNPESLQINYIVVKPEEKLHH 251

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
           LL ++ ++         + RK                                       
Sbjct: 252 LLNIINNM---------RYRKC------------------------------------IV 266

Query: 421 QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGL-TSIL 479
             P+ +A   F     H+  IS+   D    +  ++G L  ++R   L  F T L  ++L
Sbjct: 267 YFPTCQAVTYFYSFLKHLSDISKTRDD--LEVYSLHGKLQTNSRIGTLAKFSTSLNIAVL 324

Query: 480 VVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           + TDVAARG+DIP +  V+ F  P ++++F+HR GRT RA   G A + +
Sbjct: 325 LTTDVAARGIDIPEVDLVLQFDPPTNAEMFLHRCGRTGRANRAGKAITFI 374

>TBLA0D03520 Chr4 (873710..876379) [2670 bp, 889 aa] {ON} Anc_6.148
           YBR237W
          Length = 889

 Score =  171 bits (432), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 91/246 (36%), Positives = 151/246 (61%), Gaps = 11/246 (4%)

Query: 131 SFPSFGLSKIIVTNITK-RGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMI 189
           ++   GLS + +  IT+   F  PTPIQ + IP I+  +DI+G+++TGSGKT A+ILP++
Sbjct: 290 NWAQLGLSSLTMNYITQILKFETPTPIQAQAIPAIMSGKDIIGISKTGSGKTIAYILPLL 349

Query: 190 RKIKTHS----SKIGARAVILSPSRELAMQTHNVFKEF--SKGTQLRSVLLTGGDSLEDQ 243
           R ++       ++ G  A++L+P+RELA+Q ++    F  +   QL S+   GG  L  Q
Sbjct: 350 RHVRAQKPLSRNETGPIALVLAPTRELAIQINDEINNFLSNDNYQLNSICCAGGSDLRGQ 409

Query: 244 FGMMMNNPDVIIATPGRFL---HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLA 300
             ++     +I+ATPGR++    L     L+ K I + V DEADRLF++GF+ Q+++++ 
Sbjct: 410 INIIKKGVSIIVATPGRYIDLLTLNGGNLLNTKRISFIVMDEADRLFDLGFEPQISQIMK 469

Query: 301 SLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKND-EREA 359
           ++  ++  +LFSAT P  L  FA   L +P+ + +D+E+ I+EN+E  F   K+D E+  
Sbjct: 470 TIRPDKHGVLFSATFPKKLRSFALKALNSPITITIDSENMINENIEQKFKICKSDNEKFN 529

Query: 360 NLLYLL 365
           NLL +L
Sbjct: 530 NLLDIL 535

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 59/106 (55%)

Query: 424 SEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 483
           ++K  I+FV ++   E I   L+++G+    I+     + R + L NFR    SIL+ T+
Sbjct: 556 NDKKIIIFVSSQQISELIYNKLENNGFSPFLIHAGKPYNERVQNLENFRRAKNSILLCTE 615

Query: 484 VAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           V +RG+++P  + VI ++   +   ++H  GRT R   RG A S++
Sbjct: 616 VLSRGLNVPETSLVIIYNAVKAFAQYVHTTGRTGRGIYRGVAISLL 661

>TDEL0B01670 Chr2 (297786..299525) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  167 bits (422), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 111/403 (27%), Positives = 195/403 (48%), Gaps = 79/403 (19%)

Query: 150 FRQPTPIQRKTIPLILQ--NRDIVGMARTGSGKTAAFILPMIRKIKTHSSKI-------G 200
           +++PTPIQR  IP I +  +RD +G+A TGSGKT AF++P++ K+ +   +        G
Sbjct: 186 YKEPTPIQRIAIPNICKRGSRDFLGVASTGSGKTLAFVIPILIKMISSEPRPPALKSIEG 245

Query: 201 ARAVILSPSRELAMQTHNVFKEFSK-------GTQLRSVLLTGGDSLEDQFGMMMNNPDV 253
            +A+IL+P+RELA Q     ++ +K           R V + GG SLE+    +    D+
Sbjct: 246 PKALILAPTRELAQQIQAESEKITKLWNVKNPEYSCRVVSVVGGHSLEETTYNLQKGCDI 305

Query: 254 IIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNR-----QT 308
           ++ATPGR +       L +K +E  V DEADR+ ++GF++Q+ ++   L S       Q 
Sbjct: 306 LVATPGRLIDSLESHILTIKQVETLVLDEADRMIDLGFEEQVTKIFNILESTSEQGKIQK 365

Query: 309 LLFSATLPSSLVDFAKAGLTNPVLVRLD-AESKISENLEMLFLSTKNDEREANLLYLLQD 367
           L+F+AT+  S+   A   L  P    +   E  I +  ++++ S   + R   +  LL+ 
Sbjct: 366 LMFTATMSGSIERIANGYLQKPSYATIGRGEGSIPQIQQLVYYSGSEERRFRRVKSLLE- 424

Query: 368 VIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKA 427
                                                         + +PP         
Sbjct: 425 ----------------------------------------------QYMPP--------- 429

Query: 428 TILFVPTRHHVEYISQLL-KDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 486
            I+FV  +   +++ Q   +++ + ++ ++G+  Q  R+  L   R+G   +++ T+VAA
Sbjct: 430 IIVFVTYKKTADWLVQKFNQETSFRVTVLHGSKSQDQREHSLQLLRSGKAQVMIATNVAA 489

Query: 487 RGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           RG+DIP ++ V+NF +    + +IHR+GRT RAG +G A + +
Sbjct: 490 RGLDIPNVSLVVNFQISKQFEDYIHRIGRTGRAGMKGTAITFL 532

>Ecym_8358 Chr8 (719978..721687) [1710 bp, 569 aa] {ON} similar to
           Ashbya gossypii ADL024C
          Length = 569

 Score =  165 bits (417), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 119/419 (28%), Positives = 202/419 (48%), Gaps = 80/419 (19%)

Query: 130 GSFPS----FGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           GSF      F L K ++ N+ +  F  PTPIQ + I + L  RDI+  A TGSGKT AF+
Sbjct: 112 GSFEDLITRFELDKRLLNNMIQNYFTNPTPIQCEAISMCLNERDIIACAPTGSGKTLAFL 171

Query: 186 LPMIRK-IKTHSSKIGARAVILSPSRELAMQ--------THNVFKEFSKGTQLRSVLLTG 236
           +P+I++ I       G + +I+SP++ELA Q        +H +F E  K   L   LL+ 
Sbjct: 172 IPLIQQVISAGEVDSGVKGLIISPTKELASQIFTECSKLSHRIFLE--KRRPLNVALLSK 229

Query: 237 GDSLEDQFGMMMNNP------DVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMG 290
             S     G + N        D+I++TP R + L  E +LDL  +++ +FDEAD+LF+  
Sbjct: 230 SLS-----GKLKNKVVSDKKYDIIVSTPLRLIDLVKERALDLSCVKHLIFDEADKLFDKT 284

Query: 291 FQDQLNELLASLPSNR-QTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLF 349
           F +Q +++L+S  +N+ Q  +FSAT+PS + + A++ + +P+ + +  +   + N+E   
Sbjct: 285 FLEQTDDILSSCSNNKLQKSMFSATIPSHVEEIAQSIMMDPIRIIIGHKEAANTNIEQKL 344

Query: 350 LSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXX 409
           +   N+  E  L+ + Q +++                                       
Sbjct: 345 VFCGNE--EGKLIAIRQLIME--------------------------------------- 363

Query: 410 XXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLY 469
               E  PP          I+F+ +    + +   L      +  I+    Q  R + + 
Sbjct: 364 ---GEFRPP---------VIIFLESITRAKALFHELVYDKLNVDVIHAERTQMQRDKIIE 411

Query: 470 NFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSI 528
            F++G    L+ TDV ARGVD   +  VIN+ +P S++ ++HR+GRT R G +G A ++
Sbjct: 412 RFKSGDLWCLICTDVLARGVDFKGVNLVINYDIPRSAQAYVHRIGRTGRGGMKGKAVTL 470

>CAGL0L08976g Chr12 complement(981008..982861) [1854 bp, 617 aa]
           {ON} highly similar to uniprot|P25808 Saccharomyces
           cerevisiae YFL002c SPB4
          Length = 617

 Score =  164 bits (416), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 127/415 (30%), Positives = 190/415 (45%), Gaps = 78/415 (18%)

Query: 135 FGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKT 194
           + L   I   I   GF   TP+Q  TIP+  +N+D+V  + TGSGKT AF++P++ KI +
Sbjct: 12  YELQPWIKKAINVSGFDSMTPVQASTIPMFAKNKDVVVESVTGSGKTIAFVIPILEKIIS 71

Query: 195 HS------SKIGARAVILSPSRELAMQTHNVFKEF-----SKGTQLRSVLLTGGD--SLE 241
                    K    ++IL+P+REL+MQ  NV   F          +RS L+ G +  S+ 
Sbjct: 72  EGINNSKFKKGHFYSLILAPTRELSMQIQNVVSSFLEHYPEDQYPIRSQLVVGTNEKSVR 131

Query: 242 DQFGMMMNN-PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLA 300
           D    +++  P ++I TPGR L      S+   S    V DEADRL ++ F   + ++L 
Sbjct: 132 DDVNTLLDERPQILIGTPGRVLDFLQSPSVKTSSCGMVVLDEADRLLDVSFFKDVEKILN 191

Query: 301 SLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREAN 360
            LP  R+T LFSAT+ S+     K GL NPV + ++++ K +     LF S    E +  
Sbjct: 192 VLPKQRRTGLFSATISSAGTLIFKTGLRNPVKITVNSQGKNAPTTLNLFYSVMKPEEK-- 249

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
               LQ++I I                                                N
Sbjct: 250 ----LQNLIHI-----------------------------------------------MN 258

Query: 421 QLPSEKATILF---VPTRHHVEYISQL------LKDSGYLISYIYGTLDQHARKRQLYNF 471
            +  +K  + F   V      +Y+  L      L++   +IS I+G L   +R++ L  F
Sbjct: 259 NIRFKKCIVYFSTCVSVTFFYQYLKYLQQTDKTLREDLQVIS-IHGKLTTQSRRKALSTF 317

Query: 472 RTGLT-SILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWA 525
              L+  IL+ TDVAARG+DIP +  V+    P  + IF+HR GRT RA   G A
Sbjct: 318 TESLSDCILLTTDVAARGIDIPDVDLVLQIDPPTDADIFLHRCGRTGRANKIGRA 372

>Kpol_165.1 s165 complement(441..1766) [1326 bp, 441 aa] {ON}
           complement(441..1766) [1326 nt, 442 aa]
          Length = 441

 Score =  160 bits (406), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 102/363 (28%), Positives = 171/363 (47%), Gaps = 56/363 (15%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF   G    ++  +   GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 114 SFDEAGFPDYVLEEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 173

Query: 191 KIKTH---SSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            I      S   G   ++L+P+RELA+Q      +F   +++R+  + GG     Q   +
Sbjct: 174 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGSSSRIRNSCVYGGVPRGQQIREL 233

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +  +RQ
Sbjct: 234 SRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ESKISENLEMLFLSTKNDEREANLLYLLQ 366
           TL++SAT P  +   A   L +P+ V++ + E   S N+  L     + E+   LL  L+
Sbjct: 294 TLMWSATWPKEVKQLAHDYLNDPIQVQIGSLELSASHNITQLVEVVSDFEKRDRLLKHLE 353

Query: 367 DVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 426
                  A++++  K                                             
Sbjct: 354 ------TASEDKDSKI-------------------------------------------- 363

Query: 427 ATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 486
             ++F  T+   + +++ L++ G+    I+G  DQ  R   L  FR G + I+V TDVAA
Sbjct: 364 --LVFASTKRTCDEVTKYLREDGWPALAIHGDKDQRERDWVLQEFREGRSPIMVATDVAA 421

Query: 487 RGV 489
           RG+
Sbjct: 422 RGI 424

>Kwal_26.8470 s26 complement(798445..799722) [1278 bp, 425 aa] {ON}
           YBR237W (PRP5) - RNA helicase homolog [contig 61] FULL
          Length = 425

 Score =  160 bits (404), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 101/365 (27%), Positives = 176/365 (48%), Gaps = 56/365 (15%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF   G  + +++ +   GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 113 SFDEAGFPEYVLSEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 172

Query: 191 KIKTH---SSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            I      S   G   ++LSP+RELA+Q      +F K +++R+  + GG     Q   +
Sbjct: 173 HINAQPLLSPGDGPIVLVLSPTRELAVQIQTECSKFGKSSRIRNTCVYGGVPRGHQIREL 232

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +  +RQ
Sbjct: 233 SRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 292

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ESKISENLEMLFLSTKNDEREANLLYLLQ 366
           TL++SAT P  +   A+  L +P+ V + + E   S N++ +       ++   LL  L+
Sbjct: 293 TLMWSATWPKEVQQLARDYLHDPIQVNVGSLELAASHNIKQVVEVVSEMDKRDRLLKHLE 352

Query: 367 DVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 426
                  A++++  K                                             
Sbjct: 353 ------TASEDKDSKI-------------------------------------------- 362

Query: 427 ATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 486
             ++F  T+   + ++++L+  G+    I+G   Q+ R   L  FR+G + I+V TDVAA
Sbjct: 363 --LIFASTKRTCDEVTRVLRQDGWPALAIHGDKAQNERDWVLQEFRSGNSPIMVATDVAA 420

Query: 487 RGVDI 491
           RG+ +
Sbjct: 421 RGIGM 425

>Skud_6.72 Chr6 complement(140844..142664) [1821 bp, 606 aa] {ON}
           YFL002C (REAL)
          Length = 606

 Score =  163 bits (413), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 127/419 (30%), Positives = 190/419 (45%), Gaps = 78/419 (18%)

Query: 135 FGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKT 194
           F L   I T +   GF   TP+Q  TIP++  N+D+V  + TGSGKTAAF++P++ KI  
Sbjct: 12  FSLLPWIRTGLDVMGFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPILEKIVK 71

Query: 195 HSS------KIGARAVILSPSRELAMQTHNVFKEF-----SKGTQLRSVLLTGGD--SLE 241
             +      K    ++I++P+REL+ Q   V   F     S    ++  LL G +  S+ 
Sbjct: 72  EEANTFKFKKAHFHSLIIAPTRELSRQIETVVLSFLEHYPSDLFPVKCQLLVGTNEGSVR 131

Query: 242 DQFGMMMNN-PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLA 300
           D   + + N P +++ TPGR L      ++   +    + DEADRL +M F   +  +L 
Sbjct: 132 DDVSIFLENRPQILVGTPGRVLDFLQMPAVKTSACSMVILDEADRLLDMSFIKDIERILR 191

Query: 301 SLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREAN 360
            LP  R+T LFSAT+ S+  D  K GL NPV + ++++ +   +L++       D    N
Sbjct: 192 LLPKQRRTGLFSATMRSAGSDIFKTGLRNPVRITVNSKHQAPSSLKL-------DYCVVN 244

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
            L  LQ ++ I                                                N
Sbjct: 245 PLEKLQLLVSI-----------------------------------------------LN 257

Query: 421 QLPSEKATILFVPTRHHVEYIS---QLLKDSGYLIS-----YIYGTLDQHARKRQLYNFR 472
               +K  + F PT   V Y     Q L     LIS      ++G L   AR + L +F 
Sbjct: 258 NYKFKKCIVYF-PTCVSVSYFYSFIQRLSKKNILISELEVFSLHGKLQTSARTKTLASFT 316

Query: 473 TGL-TSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
             L  S+L  TDVAARG+DIP +  VI    P +S +F+HR GRT RA   G A + ++
Sbjct: 317 ESLNNSVLFTTDVAARGIDIPEVDLVIQLDPPTNSDMFMHRCGRTGRANRIGKAITFLN 375

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 83/334 (24%), Positives = 134/334 (40%), Gaps = 57/334 (17%)

Query: 426 KATILFVPTRHHVEYIS---QLLKDSGYLIS-----YIYGTLDQHARKRQLYNFRTGLT- 476
           K  I++ PT   V Y     Q L     LIS      ++G L   AR + L +F   L  
Sbjct: 262 KKCIVYFPTCVSVSYFYSFIQRLSKKNILISELEVFSLHGKLQTSARTKTLASFTESLNN 321

Query: 477 SILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAG---------NRGWAYS 527
           S+L  TDVAARG+DIP +  VI    P +S +F+HR GRT RA          NRG    
Sbjct: 322 SVLFTTDVAARGIDIPEVDLVIQLDPPTNSDMFMHRCGRTGRANRIGKAITFLNRGREED 381

Query: 528 IVSXXXXXXXXXXXXXXGKKIMLTPMYDSLCEIMKNKWIAEGNDE-SSFVNPKIAYTDRL 586
            V                 K M+   YD   E     W+ E  D     V   +A+    
Sbjct: 382 FVPFMQVKNVELEEADLKVKGMVKNFYDIFKE-----WVLEDRDRYDKGVRAYVAFIK-- 434

Query: 587 ILGSAPRLEVEGLGDLYKNMMQNN-FELKLIKDVAMKAEKLYFRTRTSASPESLK----- 640
                           Y N   N+ F L+ +  V +   K+Y   R    PE  K     
Sbjct: 435 ---------------YYSNHSANSIFRLQSLDYVGIA--KMYGLFRLPLMPEITKYLITE 477

Query: 641 RSKEIIASGW-DEQNVLFGKNQEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRR 699
           + +EI    W  +  ++  + + K+K       +  + ++   +     +D+  +  + +
Sbjct: 478 KQEEIFPGNWLVDPPIIMDEYRYKDK-------KREKQRQEALKNINLINDKKKLKSELK 530

Query: 700 RRQLAPIQRKARERKELLQMEKMAGLTHSVEDEI 733
           R+ LA   + + + ++L + EKM+    ++E+E+
Sbjct: 531 RKNLAWSDKTSTKEQKLKRKEKMSLKRKAIEEEL 564

>Smik_2.380 Chr2 (678057..680609) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score =  166 bits (419), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 85/242 (35%), Positives = 150/242 (61%), Gaps = 10/242 (4%)

Query: 135 FGLSKIIVTNITKR-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIK 193
            GLS   +T IT++  F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++R++K
Sbjct: 260 LGLSTDTMTLITEKLRFESLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVK 319

Query: 194 TH----SSKIGARAVILSPSRELAMQTHNVFKEFSKGTQL-RSVLLTGGDSLEDQFGMMM 248
                   + G   +IL+P+RELA+Q H   ++F+    L RSV  TGG  ++ Q   + 
Sbjct: 320 AQRPLSKHETGPLGLILAPTRELALQIHEEVRKFTGAEALIRSVCCTGGSEMKKQITDLK 379

Query: 249 NNPDVIIATPGRF---LHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSN 305
              ++++ATPGRF   L L     L  K I + + DEADRLF++GF+ Q+ +++ ++  +
Sbjct: 380 RGAEIVVATPGRFIDILTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMKTVRPD 439

Query: 306 RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLF-LSTKNDEREANLLYL 364
           +Q +LFSAT P+ L  FA   L +P+ + ++++  ++EN++  F +   +DE+  NL+ +
Sbjct: 440 KQCVLFSATFPNKLRSFAVRVLRSPISITINSKGLVNENVKQKFKICNSDDEKFDNLVQI 499

Query: 365 LQ 366
           + 
Sbjct: 500 VH 501

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 57/101 (56%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+FV ++   ++IS+ L+++G +   I+       R   L  F+    S+L+ T+V +RG
Sbjct: 529 IIFVSSQQICDFISKKLQNAGIITCAIHAGKPYQERLMNLEKFKREKNSVLLCTEVLSRG 588

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           +++P ++ VI ++   +   ++H  GRTAR    G A +++
Sbjct: 589 LNVPEVSLVIIYNAVKTFAQYVHTTGRTARGSRSGTAITLL 629

>ZYRO0E02530g Chr5 (197126..198796) [1671 bp, 556 aa] {ON} highly
           similar to uniprot|P45818 Saccharomyces cerevisiae
           YGL171W ROK1 ATP-dependent RNA helicase of the DEAD box
           family required for 18S rRNA synthesis
          Length = 556

 Score =  161 bits (408), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 113/410 (27%), Positives = 201/410 (49%), Gaps = 65/410 (15%)

Query: 130 GSFPS----FGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           GSF      F   K ++ N+    F +PTPIQ + IPL L  RD++  A TGSGKT AF+
Sbjct: 116 GSFEDLISRFSFDKRLLNNLIDNDFTEPTPIQCEGIPLALHGRDLLSCAPTGSGKTLAFL 175

Query: 186 LPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFS------KGTQLRSVLLTGGDS 239
           +P++++I       G + +I+SP++ELA QT     + S      K   L+  +L+   S
Sbjct: 176 IPLLQQIIDSKDVQGLKGLIISPTKELASQTFVECVKLSRKIFLDKKRPLQVAILSKSLS 235

Query: 240 LEDQFGMMMNNP-DVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNEL 298
            + +  ++ +   D+II+TP R + L    +LDL ++ + VFDEAD+LF+  F +Q +++
Sbjct: 236 AKLRNKVVSDKKYDIIISTPLRLIDLVKNEALDLSNVRHLVFDEADKLFDKTFVEQTDDI 295

Query: 299 LASLPSNR-QTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDER 357
           L++    R +  +FSAT+PS++ + A++ +T+PV V +  +   + N++   +   N+E 
Sbjct: 296 LSACSDPRLRKSMFSATIPSNVEEIAQSIMTDPVRVIIGHKEGANANIDQRLVYCGNEEG 355

Query: 358 EANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLP 417
           +         +I I    +E + K                                   P
Sbjct: 356 K---------LIAIRRMVQEGEFK-----------------------------------P 371

Query: 418 PANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTS 477
           P          I+F+ +    + +   L   G  +  ++    Q  R + +  F+TG   
Sbjct: 372 P---------VIIFLESITRAKALYHELMYDGLNVDVLHAERTQMQRDKIIERFKTGDLW 422

Query: 478 ILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYS 527
            L+ TDV ARG+D   +  V+N+ +P +++ ++HR+GRT R   +G A +
Sbjct: 423 CLICTDVLARGIDFKGINLVVNYDVPQTAQAYVHRIGRTGRNNRQGKAVT 472

>ZYRO0F04312g Chr6 complement(366863..368671) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P25808 Saccharomyces
           cerevisiae YFL002C SPB4 involved in the maturation of
           25S ribosomal RNA ATP-dependent RNA helicase
          Length = 602

 Score =  161 bits (407), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 114/397 (28%), Positives = 190/397 (47%), Gaps = 61/397 (15%)

Query: 149 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKI-----KTHSSKIGA-R 202
           GF   TP+Q  TIP+  +N+D+V  + TGSGKT AF++P++ KI      T + K G   
Sbjct: 26  GFDTMTPVQTSTIPMFARNKDVVVESVTGSGKTVAFVIPILEKIIAEEANTPNLKKGHFH 85

Query: 203 AVILSPSRELAMQTHNVFKEFSKGTQ-----LRSVLLTGGD--SLEDQFG-MMMNNPDVI 254
           ++I++P+REL+ Q  +V + F +        +RS LL G +  S+ D     + N P ++
Sbjct: 86  SLIVTPTRELSNQIQSVIQSFLEHYPDDEHPIRSQLLVGTNQSSVRDDLANFLQNRPQIL 145

Query: 255 IATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQTLLFSAT 314
           + TPGR L      ++  KS    V DEADRL ++ F   + ++L +LP  R+T LFSAT
Sbjct: 146 VGTPGRVLDFLQMSAVQTKSCSVLVLDEADRLLDLSFFGDIEKILKTLPKQRRTGLFSAT 205

Query: 315 LPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDVIKIPLA 374
           + S+     K GL NPV + + +++K   +L + +   + + +   LL ++ +       
Sbjct: 206 IGSAGSQIFKTGLRNPVKITVSSKTKAPTSLGLFYTVIEPEAKIQQLLSIMNNY------ 259

Query: 375 TKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKATILFVPT 434
                 KF                                        P+  +   F   
Sbjct: 260 ------KFKKCIVY---------------------------------FPTCISVTYFYSF 280

Query: 435 RHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGL-TSILVVTDVAARGVDIPM 493
             +++   +LL +     S ++G L   +R++ L +F      ++L  TDVAARG+DIP 
Sbjct: 281 MQYLQRDKKLLDEEVEFFS-LHGKLQTSSRQKTLDSFGKSFGKAVLFTTDVAARGIDIPD 339

Query: 494 LANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           +  VI    P+ + +F+HR GRT RA   G A + ++
Sbjct: 340 VDLVIQLDPPSDTTMFLHRCGRTGRANKEGRAITFLN 376

>TBLA0H03240 Chr8 complement(787863..790166) [2304 bp, 767 aa] {ON}
           Anc_8.402 YDR194C
          Length = 767

 Score =  163 bits (412), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 121/425 (28%), Positives = 206/425 (48%), Gaps = 49/425 (11%)

Query: 137 LSKIIVTNITKRGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFILPMIRKIKT 194
           + K + T + + GF+  TP+Q+KTI  IL++   D++  A+TG+GKT AF+LP+ +K+  
Sbjct: 170 IDKKLFTAVHRLGFKSLTPVQQKTIKPILKDSGNDVIARAKTGTGKTFAFLLPLFQKLIE 229

Query: 195 HSSKIGARAVILSPSRELAMQTHN----VFKEFSKGTQLRSVLLTGGDSLEDQFG-MMMN 249
             +    ++VI++P+R+LA+Q       ++K  S   Q   + + GG +       +   
Sbjct: 230 SPNSAMVKSVIMAPTRDLALQIEQEILKLYKNNSALRQYNCLSIVGGTNYSYSLQRLHRE 289

Query: 250 NPDVIIATPGRFLHLKVEMSLDLKS-IEYAVFDEADRLFEMGFQDQLNELLASLPS---- 304
            P++I+ATPGR L +  +      S +++ V DEADRL E+GF++ L  +  SL S    
Sbjct: 290 RPNIIVATPGRMLAVLSDFGDKFFSEVDFKVLDEADRLLEIGFKEDLVAISNSLDSVNSN 349

Query: 305 ---NRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDA----ESKISENLEMLFLSTKNDER 357
              + +TLLFSATL   +   A   +     + LD     E +  EN+    + +  D  
Sbjct: 350 GADHIRTLLFSATLDDKVQTLANDIMNKEECLFLDTIDKNEPEAHENINQNLVVS--DAF 407

Query: 358 EANLLYLLQDV------IKIPLA--TKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXX 409
             ++  +++ +       ++P+A  T E++ K                            
Sbjct: 408 SHSIYAVIEHIRSRLHPTELPIAEVTTEEETKVEAGVESVEETEVITKATK--------- 458

Query: 410 XXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKD----SGYLISYIYGTLDQHARK 465
                  P           ILF PT    +++SQL+K      G  I   +G +DQ+ R 
Sbjct: 459 -------PFDKHDTQNYKAILFTPTVKCTKFLSQLIKREFQIEGIPIYEFHGKIDQNRRT 511

Query: 466 RQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWA 525
           R +  F+   + ILV TDV ARG+D P +  V+   +P+    ++HR+GRTARAG +G +
Sbjct: 512 RIVEKFKRANSGILVCTDVGARGMDFPNVQEVLQLGVPSELSNYVHRIGRTARAGKKGIS 571

Query: 526 YSIVS 530
            + +S
Sbjct: 572 TAFLS 576

>TPHA0D01990 Chr4 complement(411607..413103) [1497 bp, 498 aa] {ON}
           Anc_5.337 YHR065C
          Length = 498

 Score =  158 bits (399), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 132/241 (54%), Gaps = 4/241 (1%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF    L   ++       F +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 76  SFNELDLVPELIQACHNLNFSKPTPIQSKSIPPALEGHDIIGLAQTGSGKTAAFAIPILN 135

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
           K+          A IL+P+RELA Q    F        +RSV + GG ++ DQ   +M  
Sbjct: 136 KLWEDQQPY--YACILAPTRELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQSRELMRK 193

Query: 251 PDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-NRQT 308
           P +IIATPGR + HL+      L+ +++ V DEADRL +M F   L+ +L  +P+ +R T
Sbjct: 194 PHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQDRTT 253

Query: 309 LLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDV 368
            LFSAT+ S +    +A LTNPV   +  + +  E L    +      +   L+YLL + 
Sbjct: 254 YLFSATMTSKIEKLQRASLTNPVKCAVSNKYQTVETLVQTLMVVPGGLKNTYLIYLLNEF 313

Query: 369 I 369
           I
Sbjct: 314 I 314

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 70/123 (56%)

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K+ I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+ G   ILV  DVA
Sbjct: 316 KSIIVFTRTKANAERLSALSNLLEFSSTALHGDLNQNQRTGALDLFKAGKRQILVAIDVA 375

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 545
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG  G + S+VS              G
Sbjct: 376 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 435

Query: 546 KKI 548
           KK+
Sbjct: 436 KKL 438

>CAGL0F05577g Chr6 (559705..561705) [2001 bp, 666 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194c
           MSS116
          Length = 666

 Score =  159 bits (403), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 127/420 (30%), Positives = 208/420 (49%), Gaps = 80/420 (19%)

Query: 137 LSKIIVTNITKRGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFILPMIRKIKT 194
           +S+ +  +I++ GF Q TP+Q+KTI  I+ N   DI+  A+TG+GKT AF+LP+ + +  
Sbjct: 166 ISRDLYDSISRMGFEQLTPVQQKTIEPIITNSDSDIIARAKTGTGKTFAFLLPIFQHLLN 225

Query: 195 H--SSKIGARAVILSPSRELAMQTHN-VFKEFSKGTQLRS---VLLTGGDSLEDQFGMMM 248
               S+   ++VI++P+R+LA+Q  + V K  SK  +L++   V L GG + +     + 
Sbjct: 226 TKIDSQNKVKSVIVAPTRDLALQIEDEVRKIHSKNRKLKAFECVSLVGGTNFDRSIRYIE 285

Query: 249 N-NPDVIIATPGRFLHLKVEMSLD-LKSIEYAVFDEADRLFEMGFQDQL---NELLASLP 303
             +P ++I TPGR + +  +      K +++ V DEADRL E+GF++ L   N++L +L 
Sbjct: 286 KVSPSIVIGTPGRLIDVMEKFGNKFFKDVDFKVLDEADRLLEIGFKEDLSYINKMLNTLN 345

Query: 304 SNR----QTLLFSATLPSSLVDFAKAGLTNPVLVRLD--------AESKISENLEMLFLS 351
           +N     +TLLFSATL   +   +   +     + +D        A  KI + L +    
Sbjct: 346 TNSTEHIRTLLFSATLDHKVQSLSNDIMNKEECLYIDTIDENEPQAHEKIDQTLVV---- 401

Query: 352 TKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXX 411
               E  A+ LY          A  E  R+F                             
Sbjct: 402 ---GETFADNLY----------AAIEHIREF----------------------------- 419

Query: 412 XXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISY-IYGTLDQHARKRQLYN 470
                    + P+ K+ ILF+PT    ++++ +LK    L  Y  +G +DQ  R R +  
Sbjct: 420 -------GTKTPNYKS-ILFLPTVKFTKFMATILKRQVKLPIYEFHGQIDQKKRTRIVNE 471

Query: 471 FRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           F+T    +LV TDV ARG+D P +  V+   LP+    +IHR+GRTAR+G  G + + +S
Sbjct: 472 FKTMKKGLLVCTDVGARGMDFPNITEVLQIGLPSEIPNYIHRIGRTARSGKEGSSVTFIS 531

>KAFR0D04630 Chr4 complement(909161..910624) [1464 bp, 487 aa] {ON}
           Anc_5.337 YHR065C
          Length = 487

 Score =  155 bits (392), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 88/239 (36%), Positives = 130/239 (54%), Gaps = 4/239 (1%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF    L   ++       + +PTPIQ K+IP  L  +DI+G+A+TGSGKTAAF +P++ 
Sbjct: 68  SFTELNLVPELIQACKNLNYEKPTPIQSKSIPPALNGKDIIGLAQTGSGKTAAFAIPILN 127

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
            +     ++   A ILSP+RELA Q    F        +R+V + GG ++ DQ   +M  
Sbjct: 128 SL--WHDQLPYYACILSPTRELAQQIKETFDSLGSLMGVRTVCIVGGMNMMDQARDLMRK 185

Query: 251 PDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-NRQT 308
           P +IIATPGR + HL+      L+ + Y V DEADRL +M F   L+ +L  LP+  R T
Sbjct: 186 PHIIIATPGRLMDHLENTRGFSLRKLRYLVMDEADRLLDMEFGPVLDRILKILPTEGRTT 245

Query: 309 LLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQD 367
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YLL +
Sbjct: 246 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNE 304

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 71/123 (57%)

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K  I+F  T+ + E I+ L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 308 KTFIIFTRTKANAERIAGLANLLEFNATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 367

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 545
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG  G + S+VS              G
Sbjct: 368 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 427

Query: 546 KKI 548
           KK+
Sbjct: 428 KKL 430

>ADL024C Chr4 complement(657270..658979) [1710 bp, 569 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL171W
           (ROK1)
          Length = 569

 Score =  157 bits (396), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 122/403 (30%), Positives = 202/403 (50%), Gaps = 74/403 (18%)

Query: 130 GSFPS----FGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           GSF      F L K +++N+ +  F +PTPIQ + IP+ LQNRDIV  A TGSGKT AF+
Sbjct: 119 GSFEDLVTRFKLDKRLLSNLIENNFTEPTPIQCEAIPISLQNRDIVACAPTGSGKTLAFL 178

Query: 186 LPMIRK-IKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQ---------LRSVLLT 235
           +P++++ I   +   G + +I+SP++ELA Q   +F E SK  Q         L   LL+
Sbjct: 179 IPLLQQVISDKAVGTGVKGLIISPTKELANQ---IFDECSKLAQRIFLEKKRPLSVALLS 235

Query: 236 G--GDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQD 293
                 L++Q  +     D+II+TP R + +    SLDL +++Y +FDEAD+LF+  F +
Sbjct: 236 KSLAAKLKNQI-VSDKKYDIIISTPLRLIDIVKSESLDLSAVKYLIFDEADKLFDKTFVE 294

Query: 294 QLNELLASLP-SNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLST 352
           Q +++L++    N   +LFSATLPSS+ + A++ +T+PV V +  +   + N+E   +  
Sbjct: 295 QTDDILSACSHPNISKVLFSATLPSSVEELAQSIMTDPVRVIIGHKEAANTNIEQKLVFC 354

Query: 353 KNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXX 412
            N+  E  L+ + Q +         Q+  F                              
Sbjct: 355 GNE--EGKLVAIRQLI---------QEGMFR----------------------------- 374

Query: 413 XERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFR 472
               PP          I+F+ +    + +   L      +  I+    Q  R++ +  F+
Sbjct: 375 ----PP---------VIIFLESITRAKALFHELLYDKLNVDVIHAERTQVQREKIIERFK 421

Query: 473 TGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGR 515
           +G    L+ TDV ARG+D   +  VIN+ +P S++ ++HR+GR
Sbjct: 422 SGDLWCLICTDVLARGIDFKGINLVINYDVPRSAQAYVHRIGR 464

>KNAG0B04660 Chr2 complement(900857..902341) [1485 bp, 494 aa] {ON}
           Anc_5.337 YHR065C
          Length = 494

 Score =  155 bits (391), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 129/222 (58%), Gaps = 4/222 (1%)

Query: 150 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPS 209
           + +PTPIQ ++IP  L+ +DI+G+A+TGSGKTAAF +P++  +  H  +    A ILSP+
Sbjct: 94  YSKPTPIQSRSIPPALKGKDIIGLAQTGSGKTAAFAIPILNSL-WHDQQ-PYYACILSPT 151

Query: 210 RELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFL-HLKVEM 268
           RELA Q    F        +RSV + GG ++ DQ   +M  P +II TPGR + HL+   
Sbjct: 152 RELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQARDLMRKPHIIIGTPGRLMDHLENTR 211

Query: 269 SLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-NRQTLLFSATLPSSLVDFAKAGL 327
              L++++Y V DEADRL +M F   L+ +L  +P+  R T LFSAT+ S +    +A L
Sbjct: 212 GFSLRNLKYLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRASL 271

Query: 328 TNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDVI 369
           TNPV   +  + +  + L    +      ++  L+YLL + I
Sbjct: 272 TNPVKCAVSTKYQTVDTLVQTLMVVPGGVKDTYLVYLLNEFI 313

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 72/123 (58%)

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K+ I+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 315 KSMIIFTRTKANAERISGLANLLQFSATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 374

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 545
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG  G + S+VS              G
Sbjct: 375 ARGLDIPSVDVVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 434

Query: 546 KKI 548
           KK+
Sbjct: 435 KKL 437

>TPHA0D00940 Chr4 complement(186966..188678) [1713 bp, 570 aa] {ON}
           Anc_8.124 YGL171W
          Length = 570

 Score =  156 bits (395), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 115/414 (27%), Positives = 203/414 (49%), Gaps = 73/414 (17%)

Query: 130 GSFPS----FGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           GSF      F   K ++ N+ +  F +PTP+Q + IPL L  RD++  A TGSGKT AF+
Sbjct: 120 GSFEDLISRFSFDKRLLRNLLENHFTEPTPVQSECIPLALHTRDMLACAPTGSGKTLAFL 179

Query: 186 LPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQ---------LRSVLLTG 236
           +P+++++     +IG + +I+SP++ELA Q   +F E +K            L+  LL+ 
Sbjct: 180 IPLLQQVIEQKEEIGLKGLIISPTKELADQ---IFLECTKLANRLYLDKKRPLQIALLSK 236

Query: 237 GDSLEDQFGMMMNNP-DVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQL 295
             S + +  ++ +   D+II+TP R + +    +LDL ++++ +FDEAD+LF+  F +Q 
Sbjct: 237 SLSSKLKNKVISDKKYDIIISTPLRLIDVVKNEALDLSTVKHLIFDEADKLFDKTFVEQT 296

Query: 296 NELLASL--PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTK 353
           +++L S   PS R+  +FSAT+PS++ + A+  + +P+ V +  +   + N+E   +   
Sbjct: 297 DDILNSCSDPSLRKA-MFSATIPSNVEEIAQTIMMDPIRVIIGHKEAANANIEQKLIFCG 355

Query: 354 NDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXX 413
           N+  E  L+ + Q V         QQ +F                               
Sbjct: 356 NE--EGKLIAIKQLV---------QQGEFR------------------------------ 374

Query: 414 ERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRT 473
              PP          I+F+ +    + +   L      +  I+       R + +  F+T
Sbjct: 375 ---PPV---------IIFLESITRAKALYHELMYDNLNVDVIHAERTPIQRNKIIEKFKT 422

Query: 474 GLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYS 527
           G    L+ TDV ARG+D   +  VIN+ +P +++ ++HR+GRT R    G A +
Sbjct: 423 GELWCLITTDVLARGIDFKGVNLVINYDVPRTAQAYVHRIGRTGRGNRSGKAVT 476

>ZYRO0C14234g Chr3 complement(1116350..1117834) [1485 bp, 494 aa]
           {ON} highly similar to uniprot|Q75EW9 Ashbya gossypii
           AAL041C RRP3 ATP-dependent rRNA helicase RRP3 and
           similar to YHR065C uniprot|P38712 Saccharomyces
           cerevisiae YHR065C RRP3 Required for maturation of the
           35S primary transcript of pre-rRNA and is required for
           cleavages leading to mature 18S RNA RRP3 is a DEAD box
           gene homologous to eIF- 4a which encodes an
           RNA-dependent ATPase possessing helicase activity which
           is not specific for RNA
          Length = 494

 Score =  155 bits (391), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 87/241 (36%), Positives = 133/241 (55%), Gaps = 4/241 (1%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF    L   ++       F +PTPIQ + IP  L+ RDI+G+A+TGSGKTAAF +P++ 
Sbjct: 73  SFNDLNLVPELIEACKNLNFDKPTPIQARAIPPALEGRDIIGLAQTGSGKTAAFAIPILN 132

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
           ++     K    A +L+P+RELA QT   F        +RS  + GG ++ DQ   +M  
Sbjct: 133 RL--WEDKQPYYACVLAPTRELAQQTKETFDSLGALMGVRSTCIVGGMNMMDQARELMRK 190

Query: 251 PDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-NRQT 308
           P +IIATPGR + HL+      L+ + + V DEADRL +M F   L+++L  +P+ +R T
Sbjct: 191 PHIIIATPGRLMDHLENTKGFSLRKLRFLVMDEADRLLDMEFGPVLDKILKVIPTQDRTT 250

Query: 309 LLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDV 368
            LFSAT+ S +    +A LT PV   +  + +  + L    +   +  +   L+YLL + 
Sbjct: 251 YLFSATMTSKIDKLQRASLTEPVKCAVSNKYQTVDTLVQTLMVVPSGLKNTYLIYLLNEN 310

Query: 369 I 369
           I
Sbjct: 311 I 311

 Score = 95.9 bits (237), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 71/123 (57%)

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K  I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 313 KTVIIFTRTKANAERLSALCNLLEFNATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 372

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 545
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG  G + S+VS              G
Sbjct: 373 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 432

Query: 546 KKI 548
           KK+
Sbjct: 433 KKL 435

>KLTH0H15686g Chr8 complement(1353647..1354725,1354841..1355081)
           [1320 bp, 439 aa] {ON} similar to uniprot|Q07478
           Saccharomyces cerevisiae YDL084W SUB2 Suppresses the
           cold-sensitive snRNP biogenesis brr1-1 mutation RNA
           helicase
          Length = 439

 Score =  153 bits (387), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 106/410 (25%), Positives = 188/410 (45%), Gaps = 64/410 (15%)

Query: 127 HKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFIL 186
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 53  HSTG-FKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 111

Query: 187 PMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT-QLRSVLLTGGDSLEDQFG 245
             ++++     ++    V++  +RELA Q  N +  FSK    +++ +  GG  +     
Sbjct: 112 STLQQLDPVPGEVS--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPITKDAE 169

Query: 246 MMMNN---PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF-EMGFQDQLNELLAS 301
           ++ N    P +++ATPGR   L  +  +DL S++  V DE D++  E+G +  + ++  +
Sbjct: 170 LLKNKETAPHIVVATPGRLKALVRDKIIDLSSVKNFVIDECDKVLEELGMRKDVQDIFRA 229

Query: 302 LPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFLSTKNDEREAN 360
            P ++Q ++FSATL   +    +  L NP+ + +D E+K++   L+  ++  +  E+   
Sbjct: 230 TPRDKQVMMFSATLSQEMRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRK 289

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
           L  LL D+            +FN                                     
Sbjct: 290 LAQLLDDL------------EFNQ------------------------------------ 301

Query: 421 QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480
                   I+FV + +    +++LL  S +    ++G + Q  R  +   F+     I V
Sbjct: 302 -------VIIFVKSTNRANELTKLLNASNFPAITVHGGMKQEERIARYKAFKEFEKRICV 354

Query: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
            TDV  RG+DI  +   IN+ LP+ +  ++HRVGR  R G +G A S V+
Sbjct: 355 STDVFGRGIDIERINLAINYDLPSEADQYLHRVGRAGRFGTKGLAISFVA 404

>NDAI0C04250 Chr3 (968216..969730) [1515 bp, 504 aa] {ON} Anc_5.337
          Length = 504

 Score =  155 bits (391), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 132/241 (54%), Gaps = 4/241 (1%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F    L   ++       + +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 85  TFSELNLVPELIQACKNLNYSKPTPIQSKSIPPALKGHDIIGLAQTGSGKTAAFAIPILN 144

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
            +  H  +    A IL+P+RELA Q    F        +RSV + GG ++ DQ   +M  
Sbjct: 145 SL-WHDQQ-PYYACILAPTRELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQARDLMRK 202

Query: 251 PDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-NRQT 308
           P VIIATPGR + HL+      L+ ++Y V DEADRL +M F   L+ +L  LP+  R T
Sbjct: 203 PHVIIATPGRLMDHLENTKGFSLRKLKYLVMDEADRLLDMEFGPVLDRILKILPTQGRTT 262

Query: 309 LLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDV 368
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YLL + 
Sbjct: 263 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLIVVPGGLKNTFLIYLLNEY 322

Query: 369 I 369
           I
Sbjct: 323 I 323

 Score = 96.7 bits (239), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 73/123 (59%)

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K+TI+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+ G  +ILV TDVA
Sbjct: 325 KSTIIFTRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRKTILVATDVA 384

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 545
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG  G + S+VS              G
Sbjct: 385 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 444

Query: 546 KKI 548
           KK+
Sbjct: 445 KKL 447

>Suva_6.59 Chr6 complement(110278..112098) [1821 bp, 606 aa] {ON}
           YFL002C (REAL)
          Length = 606

 Score =  157 bits (396), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 122/419 (29%), Positives = 187/419 (44%), Gaps = 78/419 (18%)

Query: 135 FGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKT 194
           + L   I T +   GF   TP+Q  TIP++  N+D+V  + TGSGKTAAF++P++ KI  
Sbjct: 12  YSLLPWIRTGLDVMGFESMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPILEKIVQ 71

Query: 195 HSS------KIGARAVILSPSRELAMQTHNVFKEF-----SKGTQLRSVLLTGGDSL--- 240
             +      K    ++I++P+REL+ Q  +V   F     S    ++  LL G +     
Sbjct: 72  EEANSPKFKKAHFHSLIIAPTRELSRQIESVVLSFLEHYPSDSFSIKCQLLIGTNEATVR 131

Query: 241 EDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLA 300
           +D    + N P ++I TPGR L      ++   +    + DEADRL ++ F     ++L 
Sbjct: 132 DDVSSFLQNRPQILIGTPGRVLDFLQMPAVKSSACSMVILDEADRLLDVSFIKDTEKILR 191

Query: 301 SLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREAN 360
            LP  R+T LFSAT+ S+  D  K GL NPV + ++++ +   +L++ +          N
Sbjct: 192 LLPKQRRTGLFSATMRSAGSDIFKTGLRNPVRITVNSKHQAPSSLKLNYCV-------VN 244

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
            L  LQ ++ I                                                N
Sbjct: 245 PLEKLQLLVSI-----------------------------------------------LN 257

Query: 421 QLPSEKATILFVPTRHHVEY---ISQLLKDSGYLIS-----YIYGTLDQHARKRQLYNFR 472
               +K  + F PT   V Y     Q L     L S      ++G L   AR + L  F 
Sbjct: 258 NYKFKKCIVYF-PTCVSVSYFYSFVQYLSKKNILTSELEVFSLHGKLQTSARMKTLAAFT 316

Query: 473 TGL-TSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
             L  ++L  TDVAARG+DIP +  VI    P +S +F+HR GRT RA   G A + ++
Sbjct: 317 DSLNNAVLFTTDVAARGIDIPEVDLVIQLDPPTNSDMFMHRCGRTGRANRVGKAITFLN 375

>SAKL0H13574g Chr8 (1161196..1163202) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194C
           MSS116 DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns presumed RNA
           helicase due to DEAD-box motif
          Length = 668

 Score =  156 bits (395), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 121/417 (29%), Positives = 194/417 (46%), Gaps = 84/417 (20%)

Query: 137 LSKIIVTNITKRGFRQPTPIQRKTI-PLILQNRDIVGMARTGSGKTAAFILPMIRKIKTH 195
           +  ++  +I + GF   TP+Q+KTI P++    D++  A+TG+GKT AF++PM   +  +
Sbjct: 127 IDNMLYKSIDRMGFPALTPVQQKTIKPILATTNDVIARAKTGTGKTLAFLIPMFEHLLAN 186

Query: 196 --SSKIGARAVILSPSRELAMQTHNVFKEFSKGT----QLRSVLLTGGDSLEDQFGMMMN 249
              S+   + V+++P+R+LA+Q  +  ++  K      + +SV L GG + +     M  
Sbjct: 187 RTDSQYMVKCVVVAPTRDLALQIDSEIQKIHKNNYGLQKFKSVCLIGGTNFDSSIKKMFK 246

Query: 250 N-PDVIIATPGRFLHLKVEMSLD-LKSIEYAVFDEADRLFEMGF-QD------QLNELLA 300
             P++I+ATPGR   +  + S    K +++ + DEADRL E+GF QD      QLN +  
Sbjct: 247 ERPNIIVATPGRLQDVMSKFSGKFFKFVDFKILDEADRLLEIGFKQDLENISSQLNSINE 306

Query: 301 SLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLD--------AESKISENLEMLFLST 352
             P + +TLLFSATL   + + A   +     + LD        A  KI ++L +     
Sbjct: 307 KGPEHIRTLLFSATLDDRVQELANDIMNREECLFLDTVDKNEPEAHEKIDQHLVI----- 361

Query: 353 KNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXX 412
              E+ A+ LY   + IK  LA  E  +                                
Sbjct: 362 --SEKFAHNLYAPIEEIKSQLAENENLK-------------------------------- 387

Query: 413 XERLPPANQLPSEKATILFVPTRHHVEY----ISQLLKDSGYLISYIYGTLDQHARKRQL 468
                           ILFVPT    ++    + Q+L D  + I   +G ++Q  R R +
Sbjct: 388 ---------------AILFVPTVKFAKFFCRSLEQILPD--FPILEFHGKIEQRRRTRIV 430

Query: 469 YNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWA 525
             F+     +LV TDV ARG+D P +  V    +P+    +IHR+GRTAR G  G A
Sbjct: 431 QEFKRAKRGLLVSTDVGARGMDFPNIDEVFQIGVPSELANYIHRIGRTARGGKEGRA 487

>ZYRO0C04378g Chr3 complement(342717..344762) [2046 bp, 681 aa] {ON}
           similar to uniprot|P15424 Saccharomyces cerevisiae
           YDR194C MSS116 DEAD-box protein required for efficient
           splicing of mitochondrial Group I and II introns
           presumed RNA helicase due to DEAD-box motif
          Length = 681

 Score =  156 bits (395), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 134/417 (32%), Positives = 195/417 (46%), Gaps = 89/417 (21%)

Query: 145 ITKRGFRQPTPIQRKTIPLILQNR--DIVGMARTGSGKTAAFILPMIRK-IKTHSSKIGA 201
           I   GF   TP+Q+K I  IL+N+  D++  A+TG+GKT AF++PM +  I T      A
Sbjct: 93  IVNIGFTGLTPVQQKAIRPILENQSQDVITRAKTGTGKTFAFLIPMFQHLINTKRENPSA 152

Query: 202 -RAVILSPSRELAMQ----------THNVFKEFSKGTQLRSVLLTGGDSLEDQFG-MMMN 249
            + VI++P+R+LA+Q           H V K F       S+ L GG +       ++  
Sbjct: 153 VKYVIVAPTRDLALQIEMETRRIQAAHPVLKRF------HSLTLVGGTNFAASVTDLIRR 206

Query: 250 NPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASL------- 302
            P V+IATPGR L +        K ++  V DEADRL E+GFQ  L ++ + L       
Sbjct: 207 KPQVVIATPGRLLDILQRYEKHFKQVDVKVLDEADRLLEIGFQQDLEKISSILNKINETG 266

Query: 303 PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLST--KND----E 356
           P + +TLLFSATL + + D +++               I    E LFL T  KN+    E
Sbjct: 267 PDHIRTLLFSATLDAKVQDLSQS---------------IMGKDECLFLDTVDKNEPQAHE 311

Query: 357 REANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERL 416
           + +    + +++    LAT +                                    +R 
Sbjct: 312 KISQSAVIAENLGHSILATMDH----------------------------------VKRQ 337

Query: 417 PPANQLPSEKATILFVPTRHHVEYISQLL---KDSGYLISYIYGTLDQHARKRQLYNFRT 473
             AN  P+ KA ILF PT      IS+LL   +D    I   +G   Q+ R + +  F+ 
Sbjct: 338 VLAN--PNYKA-ILFTPTIKCTTLISELLHAQQDVAVPILEFHGKKTQNVRTKMVQKFKR 394

Query: 474 GLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
             + ILV TDVAARG+D P +  V+   +PA    +IHR+GRTARAG  G A   +S
Sbjct: 395 DRSGILVCTDVAARGLDFPDVGEVLQIGVPAIMSQYIHRIGRTARAGKTGKAVLFMS 451

>KLLA0C14608g Chr3 (1276354..1277817) [1464 bp, 487 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 487

 Score =  152 bits (385), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 86/222 (38%), Positives = 127/222 (57%), Gaps = 4/222 (1%)

Query: 150 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPS 209
           + +PTPIQ K IP  L+  DI+G+A+TGSGKTAAF +P++ ++  H  +    A IL+P+
Sbjct: 87  YNKPTPIQSKAIPPALKGSDIIGLAQTGSGKTAAFAIPILNQL-WHDQQ-PYYACILAPT 144

Query: 210 RELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFL-HLKVEM 268
           RELA Q    F        +RS  + GG S+ DQ   +M  P +IIATPGR + HL+   
Sbjct: 145 RELAQQIKETFDSLGSLMGVRSTCIVGGMSMMDQARDLMRKPHIIIATPGRLMDHLENTK 204

Query: 269 SLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-NRQTLLFSATLPSSLVDFAKAGL 327
             +L+ ++Y V DEADRL +M F   L+ +L  +P+  R T LFSAT+ S +    +A L
Sbjct: 205 GFNLRKLKYLVMDEADRLLDMEFGPVLDRILNIIPTQGRTTYLFSATMTSKIDKLQRASL 264

Query: 328 TNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDVI 369
           TNPV   +  + +  + L    +      +   L+YLL + I
Sbjct: 265 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEFI 306

 Score = 98.6 bits (244), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 73/123 (59%)

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K+TI+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 308 KSTIVFTRTKANAERISNLCNLLEFSATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 367

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 545
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG  G + S+VS              G
Sbjct: 368 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 427

Query: 546 KKI 548
           KK+
Sbjct: 428 KKL 430

>Ecym_3217 Chr3 complement(411925..413385) [1461 bp, 486 aa] {ON}
           similar to Ashbya gossypii AAL041C
          Length = 486

 Score =  152 bits (385), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 86/222 (38%), Positives = 126/222 (56%), Gaps = 4/222 (1%)

Query: 150 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPS 209
           F +PTPIQ K IP  LQ  DI+G+A+TGSGKTAAF +P++ ++  H  +    A IL+P+
Sbjct: 86  FTKPTPIQSKAIPPALQGNDIIGLAQTGSGKTAAFAIPILNQL-WHDQQ-PYYACILAPT 143

Query: 210 RELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFL-HLKVEM 268
           RELA Q    F        +RS  + GG ++ DQ   +M  P +IIATPGR + HL+   
Sbjct: 144 RELAQQIKETFDSLGSLMGVRSTCIMGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 203

Query: 269 SLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-NRQTLLFSATLPSSLVDFAKAGL 327
              L+ + + V DEADRL +M F   L+ +L ++P+  R T LFSAT+ S +    +A L
Sbjct: 204 GFSLRKLRFLVIDEADRLLDMEFGAVLDRILKNIPTKGRTTYLFSATMTSKIDKLQRASL 263

Query: 328 TNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDVI 369
           TNPV   +  + +  + L    +      +   L+YLL + I
Sbjct: 264 TNPVKCSVSNKYQTVDTLIQTLMVVPGGLKNTYLIYLLNEFI 305

 Score = 98.2 bits (243), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 73/123 (59%)

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K+TI+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 307 KSTIVFTRTKANAERISGLCNLLEFSATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 366

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 545
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG  G + S+VS              G
Sbjct: 367 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 426

Query: 546 KKI 548
           KK+
Sbjct: 427 KKL 429

>TPHA0G02050 Chr7 (420332..421648) [1317 bp, 438 aa] {ON} Anc_2.384
           YDL084W
          Length = 438

 Score =  151 bits (382), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 106/410 (25%), Positives = 187/410 (45%), Gaps = 64/410 (15%)

Query: 127 HKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFIL 186
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 52  HSTG-FKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 110

Query: 187 PMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT-QLRSVLLTGGDSLEDQFG 245
             ++++     ++    V++  +RELA Q  N +  FSK   ++++ +  GG  +++   
Sbjct: 111 STLQQLDPVPGEVS--VVVICNARELAYQIRNEYLRFSKYMPEVKTAVFYGGTPIKNDAD 168

Query: 246 MMMNN---PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF-EMGFQDQLNELLAS 301
           ++ N    P +I+ATPGR   L  +  +DL  ++  V DE D++  E+  +  + ++  +
Sbjct: 169 LLKNKETAPQIIVATPGRLKALVRDKLIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRA 228

Query: 302 LPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFLSTKNDEREAN 360
            P ++Q ++FSATL   +    +  L NP+ + +D E+K++   L+  ++  +  E+   
Sbjct: 229 TPRDKQVMMFSATLSEDIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKIEEREKNRK 288

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
           L  LL D+            +FN                                     
Sbjct: 289 LAQLLDDL------------EFN------------------------------------- 299

Query: 421 QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480
                   I+FV +      +++LL DS +    ++G + Q  R  +   F+     I V
Sbjct: 300 ------QVIIFVKSTKRANELTKLLNDSNFPAITVHGHMKQAERIARYKAFKDFEKRICV 353

Query: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
            TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S VS
Sbjct: 354 STDVFGRGIDIERINLAINYDLTTEADQYLHRVGRAGRFGTKGLAVSFVS 403

>SAKL0G09328g Chr7 (797795..799312) [1518 bp, 505 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 505

 Score =  152 bits (385), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 131/241 (54%), Gaps = 4/241 (1%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF    L   ++      GF +PTPIQ K IP  L+  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 86  SFSDLNLVPELIEACKNLGFSKPTPIQAKAIPPALEGSDIIGLAQTGSGKTAAFAIPILN 145

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
           ++  H  +    A IL+P+RELA Q    F        +R+  + GG ++ DQ   +M  
Sbjct: 146 RL-WHDQQ-PYYACILAPTRELAQQIKETFDSLGALMGVRATCIVGGMNMMDQARDLMRK 203

Query: 251 PDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-NRQT 308
           P +IIATPGR + HL+      L+ + + V DEADRL +M F   L+ +L  +P+  R T
Sbjct: 204 PHIIIATPGRLMDHLENTRGFSLRKLRFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTT 263

Query: 309 LLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDV 368
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YLL + 
Sbjct: 264 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEF 323

Query: 369 I 369
           I
Sbjct: 324 I 324

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 71/123 (57%)

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K  I+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 326 KTVIVFTRTKANAERISTLCNLLEFSATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 385

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 545
           ARG+DIP +  V+N+ +P  SK +IHRVGRTARAG  G + S+VS              G
Sbjct: 386 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 445

Query: 546 KKI 548
           KK+
Sbjct: 446 KKL 448

>Ecym_6049 Chr6 (94618..95934) [1317 bp, 438 aa] {ON} similar to
           Ashbya gossypii ADR260C
          Length = 438

 Score =  151 bits (381), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 105/410 (25%), Positives = 187/410 (45%), Gaps = 64/410 (15%)

Query: 127 HKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFIL 186
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 52  HSTG-FKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 110

Query: 187 PMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT-QLRSVLLTGGDSLEDQFG 245
             ++++   + ++    V+L  +RELA Q  N +  FSK    +++ +  GG        
Sbjct: 111 STLQQLDPVAGEVS--VVVLCNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTDTRKDIE 168

Query: 246 MMMNN---PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF-EMGFQDQLNELLAS 301
           ++ N    P +++ATPGR   L  + ++DL  ++  V DE D++  E+  +  + ++  +
Sbjct: 169 LLKNKETAPHIVVATPGRLKALVRDNNIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRA 228

Query: 302 LPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFLSTKNDEREAN 360
            P ++Q ++FSATL   +    +  L NP+ + +D E+K++   L+  ++  +  E+   
Sbjct: 229 TPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRK 288

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
           L  LL D+            +FN                                     
Sbjct: 289 LAQLLDDL------------EFNQ------------------------------------ 300

Query: 421 QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480
                   I+FV +      +++LL  S +    ++G + Q  R  +   F+     I V
Sbjct: 301 -------VIIFVKSTLRANELTKLLNASNFPAITVHGHMKQEKRIARYKAFKEFEKRICV 353

Query: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
            TDV  RG+DI  +   IN+ +P+ +  ++HRVGR  R G +G A S+VS
Sbjct: 354 STDVFGRGIDIERINLAINYDMPSEADQYLHRVGRAGRFGTKGLAISLVS 403

>TPHA0G02585 Chr7 (535997..537313) [1317 bp, 438 aa] {ON}
          Length = 438

 Score =  150 bits (380), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 106/410 (25%), Positives = 187/410 (45%), Gaps = 64/410 (15%)

Query: 127 HKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFIL 186
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 52  HSTG-FKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 110

Query: 187 PMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT-QLRSVLLTGGDSLEDQFG 245
             ++++     ++    V++  +RELA Q  N +  FSK   ++++ +  GG  +++   
Sbjct: 111 STLQQLDPVPGEVS--VVVICNARELAYQIRNEYLRFSKYMPEVKTAVFYGGTPIKNDAD 168

Query: 246 MMMNN---PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF-EMGFQDQLNELLAS 301
           ++ N    P +I+ATPGR   L  +  +DL  ++  V DE D++  E+  +  + ++  +
Sbjct: 169 LLKNKETAPQIIVATPGRLKALVRDKLIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRA 228

Query: 302 LPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFLSTKNDEREAN 360
            P ++Q ++FSATL   +    +  L NP+ + +D E+K++   L+  ++  +  E+   
Sbjct: 229 TPRDKQVMMFSATLSEDIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKIEEREKNRK 288

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
           L  LL D+            +FN                                     
Sbjct: 289 LAQLLDDL------------EFN------------------------------------- 299

Query: 421 QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480
                   I+FV +      +++LL DS +    ++G + Q  R  +   F+     I V
Sbjct: 300 ------QVIIFVKSTKRANELTKLLNDSNFPAITVHGHMKQAERIARYKAFKDFEKRICV 353

Query: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
            TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S VS
Sbjct: 354 STDVFGRGIDIERINLAINYDLTTEADQYLHRVGRAGRFGTKGLAVSFVS 403

>KNAG0A05850 Chr1 (873957..875306) [1350 bp, 449 aa] {ON} Anc_2.384
           YDL084W
          Length = 449

 Score =  151 bits (381), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 109/412 (26%), Positives = 191/412 (46%), Gaps = 68/412 (16%)

Query: 127 HKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFIL 186
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 63  HSTG-FKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 121

Query: 187 PMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT-QLRSVLLTGGDSLEDQFG 245
             ++++     ++    V++  +RELA Q  N +  FSK    +++ +  GG  +     
Sbjct: 122 STLQQLDPIPGEVS--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPINKDAE 179

Query: 246 MMMN---NPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF-EMGFQDQLNELLAS 301
           ++ N   +P +++ATPGR   L  +  +DL  ++  V DE D++  E+  +  + ++  +
Sbjct: 180 LLKNKETSPHIVVATPGRLKALVRDKMIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRA 239

Query: 302 LPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFLSTKNDEREAN 360
            P ++Q ++FSATL   +    +  L NP+ + +D E+K++   L+  +  TK +ERE N
Sbjct: 240 TPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYY--TKLEEREKN 297

Query: 361 --LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPP 418
             L  LL D+            +FN                                   
Sbjct: 298 RKLAQLLDDL------------EFN----------------------------------- 310

Query: 419 ANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSI 478
                     I+FV + +    +++LL +S +    ++G + Q  R  +   F+     I
Sbjct: 311 --------QVIIFVKSTNRANELTKLLNESNFPAITVHGHMKQEERIARYKAFKDFEKRI 362

Query: 479 LVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
            V TDV  RG+DI  +   IN+ LP+ +  ++HRVGR  R G +G A S +S
Sbjct: 363 CVSTDVFGRGIDIERINLAINYDLPSEADQYLHRVGRAGRFGTKGLAISFIS 414

>NCAS0F02790 Chr6 (561303..562811) [1509 bp, 502 aa] {ON} Anc_5.337
          Length = 502

 Score =  152 bits (384), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 132/241 (54%), Gaps = 4/241 (1%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF    L   ++       + +PTPIQ ++IP  L+  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 83  SFSELDLVPELLQACKNLNYTKPTPIQSRSIPPALKGNDIIGLAQTGSGKTAAFAIPILN 142

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
            +  H  +    A IL+P+RELA Q    F        +RS  + GG ++ DQ   +M  
Sbjct: 143 SL-WHDQQ-PYYACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRK 200

Query: 251 PDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-NRQT 308
           P +IIATPGR + HL+      L+ ++Y V DEADRL +M F   L+ +L  LP+  R T
Sbjct: 201 PHIIIATPGRLMDHLENTKGFSLRKLKYLVMDEADRLLDMEFGPVLDRILKILPTQGRTT 260

Query: 309 LLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDV 368
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      ++  L+YLL + 
Sbjct: 261 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLIVVPGGLKDTYLVYLLNEF 320

Query: 369 I 369
           I
Sbjct: 321 I 321

 Score = 97.4 bits (241), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 72/123 (58%)

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K TI+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 323 KTTIIFTRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRKSILVATDVA 382

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 545
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG  G + S+VS              G
Sbjct: 383 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 442

Query: 546 KKI 548
           KK+
Sbjct: 443 KKL 445

>YGL171W Chr7 (182390..184084) [1695 bp, 564 aa] {ON}
           ROK1RNA-dependent ATPase; involved in pre-rRNA
           processing at sites A0, A1, and A2, and in control of
           cell cycle progression; contains two upstream open
           reading frames (uORFs) in 5' untranslated region which
           regulate translation
          Length = 564

 Score =  153 bits (387), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 109/396 (27%), Positives = 194/396 (48%), Gaps = 69/396 (17%)

Query: 130 GSFPS----FGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           GSF      F   K ++ N+ + GF +PTPIQ + IP+ L NRD++    TGSGKT AF+
Sbjct: 118 GSFEDLISRFSFDKRLLNNLIENGFTEPTPIQCECIPVALNNRDVLACGPTGSGKTLAFL 177

Query: 186 LPMIRKIKTHSSKIGARAVILSPSRELAMQ--------THNVFKEFSKGTQLRSVLLTGG 237
           +P++++I       G + +I+SP++ELA Q        ++ +F E  +  Q+  +  + G
Sbjct: 178 IPLVQQIIDDKQTAGLKGLIISPTKELANQIFIECFKLSYKIFLEKKRPLQVALLSKSLG 237

Query: 238 DSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNE 297
             L+++  +     D+II+TP R + +    +LDL  +++ +FDEAD+LF+  F +Q ++
Sbjct: 238 AKLKNKV-VSDKKYDIIISTPLRLIDVVKNEALDLSKVKHLIFDEADKLFDKTFVEQSDD 296

Query: 298 LLASL--PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKND 355
           +L++   PS R+  +FSAT+PS++ + A++ + +PV V +  +   + N+E   +   N+
Sbjct: 297 ILSACREPSLRKA-MFSATIPSNVEEIAQSIMMDPVRVIIGHKEAANTNIEQKLIFCGNE 355

Query: 356 EREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXER 415
             E  L+ + Q V         Q+ +F                                 
Sbjct: 356 --EGKLIAIRQLV---------QEGEFK-------------------------------- 372

Query: 416 LPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGL 475
            PP          I+F+ +    + +   L      +  I+       R R +  F+TG 
Sbjct: 373 -PP---------IIIFLESITRAKALYHELMYDRINVDVIHAERTALQRDRIIERFKTGE 422

Query: 476 TSILVVTDVAARGVDIPMLANVINFSLPASSKIFIH 511
              L+ TDV ARG+D   +  VIN+ +P SS+ ++H
Sbjct: 423 LWCLICTDVLARGIDFKGVNLVINYDVPGSSQAYVH 458

>Kpol_1005.11 s1005 complement(18157..19677) [1521 bp, 506 aa] {ON}
           complement(18157..19677) [1521 nt, 507 aa]
          Length = 506

 Score =  152 bits (384), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 87/241 (36%), Positives = 132/241 (54%), Gaps = 4/241 (1%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF    L   ++       F +PTPIQ ++IP  LQ  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 87  SFSDLDLVPELIEACKNLNFAKPTPIQARSIPPALQGHDIIGLAQTGSGKTAAFAIPILN 146

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
           ++  H  +    A IL+P+RELA Q    F        +RS  + GG ++ DQ   +M  
Sbjct: 147 RL-WHDQQ-PYYACILAPTRELAQQIKETFDSLGSLMGVRSACIVGGMNMMDQARDLMRK 204

Query: 251 PDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-NRQT 308
           P +IIATPGR + HL+      L+ +++ V DEADRL +M F   L+ +L  +P+  R T
Sbjct: 205 PHIIIATPGRLMDHLENTRGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTT 264

Query: 309 LLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDV 368
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YL+ + 
Sbjct: 265 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLIVVPGGLKNTYLIYLMNEF 324

Query: 369 I 369
           I
Sbjct: 325 I 325

 Score = 93.6 bits (231), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 67/105 (63%)

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K  I+F  T+ + E I+ L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 327 KTIIVFTRTKANAERITTLANLLEFSATALHGDLNQNQRTGSLDLFKAGRRSILVATDVA 386

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG  G + S+VS
Sbjct: 387 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVS 431

>CAGL0K02387g Chr11 (216795..218492) [1698 bp, 565 aa] {ON} highly
           similar to uniprot|P45818 Saccharomyces cerevisiae
           YGL171w ATP-dependent RNA helicase
          Length = 565

 Score =  153 bits (387), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 112/395 (28%), Positives = 189/395 (47%), Gaps = 67/395 (16%)

Query: 130 GSFPS----FGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           GSF      F L K ++ N+ +  F +PTPIQ + IPL L  RD++  A TGSGKT AF+
Sbjct: 120 GSFEDLISRFSLDKRLLNNLIENHFTEPTPIQCEAIPLCLNGRDLLACAPTGSGKTLAFL 179

Query: 186 LPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFG 245
           +P++++I    +  G + +I+SP++ELA Q  N   + SK   L          L    G
Sbjct: 180 IPLLQQIIEEKNFSGVKGLIISPTKELATQIFNECVKLSKRIYLDKKRPLQVAILSKSLG 239

Query: 246 MMMNNP-------DVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNEL 298
             + N        D+II+TP R + +    +LDL ++++ +FDEAD+LF+  F +Q +++
Sbjct: 240 AKLRNKVISDKKYDLIISTPLRLIDVVKNEALDLSNVKHLIFDEADKLFDKTFIEQTDDI 299

Query: 299 LASL--PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDE 356
           L S   PS R++ +FSAT+PSS+ + A + + +PV V +  +   + N+E   +   N+ 
Sbjct: 300 LNSCTDPSMRKS-MFSATIPSSVEETANSIMNDPVRVIIGHKEAANTNIEQKLIFCGNE- 357

Query: 357 REANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERL 416
            E  L+ + Q V         QQ +F                                  
Sbjct: 358 -EGKLIAIRQLV---------QQGEFK--------------------------------- 374

Query: 417 PPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLT 476
           PP          I+F+ +    + +   L      +  I+       R++ +  F+TG  
Sbjct: 375 PP---------IIIFLESIARAKALYHELMYDRINVDVIHAERTAIQREKIIERFKTGEL 425

Query: 477 SILVVTDVAARGVDIPMLANVINFSLPASSKIFIH 511
             L+ TDV ARG+D   +  VIN+ +P +++ ++H
Sbjct: 426 WCLICTDVLARGIDFKGVNLVINYDVPTTAQAYVH 460

>AGL112C Chr7 complement(495879..497855) [1977 bp, 658 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR194C
           (MSS116)
          Length = 658

 Score =  154 bits (389), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 119/403 (29%), Positives = 191/403 (47%), Gaps = 62/403 (15%)

Query: 137 LSKIIVTNITKRGFRQPTPIQRKTIPLILQN-RDIVGMARTGSGKTAAFILPMIRKIKTH 195
           LS  +   +  RGF + TP+Q+KT+  ILQ   D+V  A+TG+GKT AF++P+ +++   
Sbjct: 133 LSNELYEMLQSRGFDKLTPVQQKTLKPILQTEHDVVARAKTGTGKTLAFLMPLFQRLLEG 192

Query: 196 SSKIGARAVILSPSRELAMQTHNVFKEFSKGT----QLRSVLLTGGDSLEDQF-GMMMNN 250
                 +AV+++P+R+LA Q  N   E         +  +V++ GG S  + F  +    
Sbjct: 193 PPSENVKAVVIAPTRDLAAQIFNEINEMRNANRKLRRFNAVVMMGGSSRTETFRSLERRR 252

Query: 251 PDVIIATPGRFLH-LKVEMSLDLKSIEYAVFDEADRLFEMGFQ---DQLNELLASL---- 302
           P++++ATPGR +  L+         +++ V DEAD L E+GF+   +Q+N++L  L    
Sbjct: 253 PNIVVATPGRLIDMLEACGPKYFTEVDFKVLDEADTLLEIGFKQALEQINDILNQLNQKG 312

Query: 303 PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLL 362
            ++ +TLL SATL   +   A +               I  + + LF+ T +   +A   
Sbjct: 313 TTHIRTLLVSATLDDKVQSLANS---------------IMNHAKCLFIDTVDPNEQATNE 357

Query: 363 YLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 422
            + Q V+          + F D                                  A+  
Sbjct: 358 NIAQKVVI--------SKDFADNITASLYKIREE----------------------ASAN 387

Query: 423 PSEKATILFVPTRHHVEYISQLLKDS--GYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480
           P  KA I+F+PT   VEY  +LL+    G  +   +G L Q  R   +  FR   + ILV
Sbjct: 388 PKLKA-IVFMPTIVAVEYWGELLQSQCRGTPVLLFHGGLSQGRRNSTMKRFRAMDSGILV 446

Query: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRG 523
            TDVAARG+D+  + +V    +P S   +IHR+GRT RAG +G
Sbjct: 447 CTDVAARGMDVSDVQHVYQVGVPTSPDNYIHRIGRTGRAGRKG 489

>YHR065C Chr8 complement(227532..229037) [1506 bp, 501 aa] {ON}
           RRP3Protein involved in rRNA processing; required for
           maturation of the 35S primary transcript of pre-rRNA and
           for cleavage leading to mature 18S rRNA; homologous to
           eIF-4a, which is a DEAD box RNA-dependent ATPase with
           helicase activity
          Length = 501

 Score =  151 bits (382), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 87/241 (36%), Positives = 131/241 (54%), Gaps = 4/241 (1%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF    L   ++       + +PTPIQ K IP  L+  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 82  SFSELNLVPELIQACKNLNYSKPTPIQSKAIPPALEGHDIIGLAQTGSGKTAAFAIPILN 141

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
           ++  H  +    A IL+P+RELA Q    F        +RS  + GG ++ DQ   +M  
Sbjct: 142 RL-WHDQE-PYYACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRK 199

Query: 251 PDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSN-RQT 308
           P +IIATPGR + HL+      L+ +++ V DEADRL +M F   L+ +L  +P+  R T
Sbjct: 200 PHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTT 259

Query: 309 LLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDV 368
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YLL + 
Sbjct: 260 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEF 319

Query: 369 I 369
           I
Sbjct: 320 I 320

 Score = 94.0 bits (232), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 71/123 (57%)

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K  I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 322 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGSLDLFKAGKRSILVATDVA 381

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 545
           ARG+DIP +  V+N+ +P  SK +IHRVGRTARAG  G + S+VS              G
Sbjct: 382 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 441

Query: 546 KKI 548
           KK+
Sbjct: 442 KKL 444

>NCAS0A03950 Chr1 (799925..801265) [1341 bp, 446 aa] {ON} Anc_2.384
          Length = 446

 Score =  150 bits (378), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 106/410 (25%), Positives = 185/410 (45%), Gaps = 64/410 (15%)

Query: 127 HKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFIL 186
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 60  HSTG-FKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 118

Query: 187 PMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT-QLRSVLLTGGDSLEDQFG 245
             ++++     ++    V++  +RELA Q  N +  FSK    +++ +  GG  +     
Sbjct: 119 STLQQMDPVPGEVS--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPIAKDAE 176

Query: 246 MMMNN---PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF-EMGFQDQLNELLAS 301
           ++ N    P +++ATPGR   L  +  +DL  ++  V DE D++  E+  +  + E+  +
Sbjct: 177 LLKNKDTAPHIVVATPGRLKALVRDKLIDLSHVKNFVIDECDKVLEELNMRRDVQEIFRA 236

Query: 302 LPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFLSTKNDEREAN 360
            P ++Q ++FSATL   +    +  L NP+ + +D E+K++   L+  ++  +  E+   
Sbjct: 237 TPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIRLEEREKNRK 296

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
           L  LL D+            +FN                                     
Sbjct: 297 LAQLLDDL------------EFNQ------------------------------------ 308

Query: 421 QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480
                   I+FV + +    +++LL DS +    ++G + Q  R  +   F+     I V
Sbjct: 309 -------VIIFVKSTNRANELTKLLNDSNFPAITVHGHMKQEERIARYKAFKDFEKRICV 361

Query: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
            TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S VS
Sbjct: 362 STDVFGRGIDIERINLAINYDLTTEADQYLHRVGRAGRFGTKGLAISFVS 411

>Smik_8.136 Chr8 complement(202825..204330) [1506 bp, 501 aa] {ON}
           YHR065C (REAL)
          Length = 501

 Score =  151 bits (381), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 86/241 (35%), Positives = 132/241 (54%), Gaps = 4/241 (1%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F    L   ++       + +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 82  TFSELNLVPELIQACKNLNYSKPTPIQSKSIPPALEGHDIIGLAQTGSGKTAAFAIPILN 141

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
           ++  H  +    A IL+P+RELA Q    F        +RS  + GG ++ DQ   +M  
Sbjct: 142 RL-WHDQE-PYYACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRK 199

Query: 251 PDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSN-RQT 308
           P +IIATPGR + HL+      L+ +++ V DEADRL +M F   L+ +L  +P+  R T
Sbjct: 200 PHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTT 259

Query: 309 LLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDV 368
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YLL + 
Sbjct: 260 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEF 319

Query: 369 I 369
           I
Sbjct: 320 I 320

 Score = 93.6 bits (231), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 71/123 (57%)

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K  I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 322 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGALDLFKAGKRSILVATDVA 381

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 545
           ARG+DIP +  V+N+ +P  SK +IHRVGRTARAG  G + S+VS              G
Sbjct: 382 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 441

Query: 546 KKI 548
           KK+
Sbjct: 442 KKL 444

>KLTH0F08382g Chr6 (724794..726767) [1974 bp, 657 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194C
           MSS116 DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns presumed RNA
           helicase due to DEAD-box motif
          Length = 657

 Score =  153 bits (387), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 114/404 (28%), Positives = 190/404 (47%), Gaps = 73/404 (18%)

Query: 145 ITKRGFRQPTPIQRKTI-PLILQNRDIVGMARTGSGKTAAFILPMIR---KIKTHSSKIG 200
           +++  F   TP+Q+KTI P++    D++  A+TG+GKT AF++P+     K +T S  + 
Sbjct: 118 VSRMNFESLTPVQQKTIKPILETEHDVIARAKTGTGKTLAFLVPIFEHLIKTRTESPSM- 176

Query: 201 ARAVILSPSRELAMQTHNVFKEFSKGT----QLRSVLLTGGDSLEDQFGMMM-NNPDVII 255
            + VI++P+R+LA+Q  +  ++  K      + +S+ L GG + +     M  + P++++
Sbjct: 177 VKCVIVAPTRDLALQIDSEIEKLHKNNHALRKFKSIALIGGSNFQVAIKRMFKDTPNIVV 236

Query: 256 ATPGRFLHLKVEMSLDL-KSIEYAVFDEADRLFEMGFQDQ-------LNELLASLPSNRQ 307
           ATPGR + +  + S    K +++ V DEADRL E+GF +        LN + A+ P + +
Sbjct: 237 ATPGRLMDVMSKFSDKFFKHVDFKVLDEADRLLEIGFDEDLRDISKTLNSINATGPEHIR 296

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA----ESKISENLEMLFLSTKNDEREANLLY 363
           TLLFSATL  ++   A   +     + LD     E +  E ++   + ++N    A+ LY
Sbjct: 297 TLLFSATLGDNVQKLAAGIMNRKESLFLDTVDVNEPEAHEKIDQRLVISEN---FASNLY 353

Query: 364 LLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLP 423
                IK  LAT  +  K                                          
Sbjct: 354 APISAIKNRLATNNEPFK------------------------------------------ 371

Query: 424 SEKATILFVPTRHHVEYISQLLKD--SGYLISYIYGTLDQHARKRQLYNFRTGLTSILVV 481
                ILFVPT    ++   +L+       +   +G +DQ  R + +  F+     I V 
Sbjct: 372 ----AILFVPTVKFTKFYCTILERLFPSLPVYEFHGKIDQRKRTKMVGLFKRAHEGIFVC 427

Query: 482 TDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWA 525
           TDV ARG+D P +  V+   +P+    +IHR+GRTAR G  G A
Sbjct: 428 TDVGARGMDFPGVEEVLQLGVPSELSNYIHRIGRTARGGKEGKA 471

>TDEL0E02890 Chr5 (550708..552213) [1506 bp, 501 aa] {ON} Anc_5.337
           YHR065C
          Length = 501

 Score =  150 bits (380), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 125/222 (56%), Gaps = 4/222 (1%)

Query: 150 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPS 209
           F +PTPIQ K IP  L+ +DI+G+A+TGSGKTAAF LP++ ++    S     A ILSP+
Sbjct: 101 FTKPTPIQAKAIPPALEGKDIIGLAQTGSGKTAAFALPILNRLWHDQSPY--YACILSPT 158

Query: 210 RELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFL-HLKVEM 268
           RELA Q    F         R+  + GG ++ DQ   +M  P +IIATPGR + HL+   
Sbjct: 159 RELAQQIKETFDSLGTIMGARTTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 218

Query: 269 SLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-NRQTLLFSATLPSSLVDFAKAGL 327
              L+ +++ V DEADRL +M F   L+ +L  +P+  R T LFSAT+ S +    +A L
Sbjct: 219 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRASL 278

Query: 328 TNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDVI 369
           T+PV   +  + +  + L    +      +   L+YLL + I
Sbjct: 279 TDPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEFI 320

 Score = 97.4 bits (241), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 72/123 (58%)

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K TI+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 322 KTTIIFTRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 381

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 545
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG  G + S+VS              G
Sbjct: 382 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 441

Query: 546 KKI 548
           KK+
Sbjct: 442 KKL 444

>ADR260C Chr4 complement(1152257..1153573) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL084W
           (SUB2)
          Length = 438

 Score =  149 bits (377), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 105/410 (25%), Positives = 186/410 (45%), Gaps = 64/410 (15%)

Query: 127 HKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFIL 186
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 52  HSTG-FKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 110

Query: 187 PMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT-QLRSVLLTGGDSLEDQFG 245
             ++++     ++    V+L  +RELA Q  N +  FSK    +++ +  GG        
Sbjct: 111 STLQQLDPVPGEVS--VVVLCNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTDTRKDIE 168

Query: 246 MMMNN---PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF-EMGFQDQLNELLAS 301
           ++ N    P +++ATPGR   L  + ++DL  ++  V DE D++  E+  +  + ++  +
Sbjct: 169 LLKNKDTAPHIVVATPGRLKALVRDNNIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRA 228

Query: 302 LPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFLSTKNDEREAN 360
            P ++Q ++FSATL   +    +  L NP+ + +D E+K++   L+  ++  +  E+   
Sbjct: 229 TPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIRLEEREKNRK 288

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
           L  LL D+            +FN                                     
Sbjct: 289 LAQLLDDL------------EFN------------------------------------- 299

Query: 421 QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480
                   I+FV +      +++LL  S +    ++G + Q  R  +   F+     I V
Sbjct: 300 ------QVIIFVKSTLRANELTKLLNASNFPAITVHGHMRQEERIARYKAFKEFEKRICV 353

Query: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
            TDV  RG+DI  +   IN+ +P+ +  ++HRVGR  R G +G A S+VS
Sbjct: 354 STDVFGRGIDIERINLAINYDMPSEADQYLHRVGRAGRFGTKGLAISLVS 403

>Smik_7.100 Chr7 (177395..179068) [1674 bp, 557 aa] {ON} YGL171W
           (REAL)
          Length = 557

 Score =  152 bits (383), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 105/396 (26%), Positives = 194/396 (48%), Gaps = 69/396 (17%)

Query: 130 GSFPS----FGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           GSF      F   K ++ N+ + GF +PTPIQ + IP+ L NRD++    TGSGKT AF+
Sbjct: 118 GSFEDLISRFSFDKRLLNNLVENGFTEPTPIQSECIPVALNNRDVLACGPTGSGKTLAFL 177

Query: 186 LPMIRKIKTHSSKIGARAVILSPSRELAMQ--------THNVFKEFSKGTQLRSVLLTGG 237
           +P++++I       G + +I+SP++ELA Q        +H +F E  +  Q+  +  + G
Sbjct: 178 IPLVQQIINDKQTTGLKGLIISPTKELANQIFIECFKLSHKIFLEKKRPLQVALLSKSLG 237

Query: 238 DSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNE 297
             L+++  +     D+II+TP R + +    +LDL  +++ +FDEAD+LF+  F +Q ++
Sbjct: 238 AKLKNKV-VGDKKYDIIISTPLRLIDVVKNEALDLSKVKHLIFDEADKLFDKTFVEQSDD 296

Query: 298 LLASL--PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKND 355
           +L++   P+ R+  +FSAT+PS++ + A++ + +P+ + +  +   + N++   +   N+
Sbjct: 297 ILSACKEPALRKA-MFSATIPSNVEEIAQSIMMDPIRIIIGHKEAANTNIDQKLIFCGNE 355

Query: 356 EREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXER 415
             E  L+ + Q V         Q+ +F                                 
Sbjct: 356 --EGKLIAIRQLV---------QEGEFK-------------------------------- 372

Query: 416 LPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGL 475
            PP          I+F+ +    + +   L      +  I+       R R +  F++G 
Sbjct: 373 -PP---------IIIFLESITRAKALYHELMYDRINVDVIHAERTALQRDRIIERFKSGE 422

Query: 476 TSILVVTDVAARGVDIPMLANVINFSLPASSKIFIH 511
              L+ TDV ARG+D   +  VIN+ +P SS+ ++H
Sbjct: 423 LWCLICTDVLARGIDFKGVNLVINYDVPGSSQAYVH 458

>CAGL0J10912g Chr10 (1063600..1065081) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065c RRP3
          Length = 493

 Score =  150 bits (379), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 129/241 (53%), Gaps = 4/241 (1%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF    L   ++       F +PTPIQ + IP  L   D++G+A+TGSGKTAAF +P++ 
Sbjct: 74  SFAQLNLVPELIQACQNLNFTKPTPIQARAIPPALAGSDVIGLAQTGSGKTAAFAIPILN 133

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
           K+          A +L+P+RELA Q    F        +R+  + GG ++ DQ   +M  
Sbjct: 134 KLWEDQQPY--YACVLAPTRELAQQIKETFDSLGSLMGVRTTCIVGGMNMMDQARDLMRK 191

Query: 251 PDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-NRQT 308
           P +IIATPGR + HL+      LK++++ V DEADRL +M F   L+ +L  +P+  R T
Sbjct: 192 PHIIIATPGRLMDHLENTKGFSLKNLKFLVMDEADRLLDMEFGPVLDRILKIIPTKGRTT 251

Query: 309 LLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDV 368
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YLL + 
Sbjct: 252 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEF 311

Query: 369 I 369
           I
Sbjct: 312 I 312

 Score = 94.4 bits (233), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 71/123 (57%)

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K  I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 314 KTVIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 373

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 545
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG  G + S+VS              G
Sbjct: 374 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 433

Query: 546 KKI 548
           KK+
Sbjct: 434 KKL 436

>KLLA0E21935g Chr5 (1959770..1961083) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|Q07478 Saccharomyces cerevisiae
           YDL084W SUB2 Suppresses the cold-sensitive snRNP
           biogenesis brr1-1 mutation RNA helicase
          Length = 437

 Score =  149 bits (375), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 109/432 (25%), Positives = 192/432 (44%), Gaps = 71/432 (16%)

Query: 113 INAYFSTTNLEKSKHKKGS--------FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLI 164
           +NA  +  +  K   KKGS        F  F L   +   I   GF  P+ +Q+ TIP  
Sbjct: 28  VNAEGNGESQAKDSDKKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQS 87

Query: 165 LQNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFS 224
           +   D++  A++G GKTA F+L  ++++     ++    V+L  +RELA Q  N +  FS
Sbjct: 88  IHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVQGEVS--VVVLCNARELAYQIRNEYLRFS 145

Query: 225 KGT-QLRSVLLTGGDSLEDQFGMMMNN---PDVIIATPGRFLHLKVEMSLDLKSIEYAVF 280
           K    +++ +  GG   ++   ++      P +I+ATPGR   L  +  +DL  ++  V 
Sbjct: 146 KYMPDVKTAVFYGGTEYKNDIDLLSKKETVPHIIVATPGRLKALVRDKHIDLSHVKNFVI 205

Query: 281 DEADRLF-EMGFQDQLNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAES 339
           DE D++  E+  +  + ++  + P ++Q ++FSATL   +    +  L NP+ + +D E+
Sbjct: 206 DECDKVLEELDMRRDVQDIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEA 265

Query: 340 KIS-ENLEMLFLSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXX 398
           K++   L+  ++     E+   L  LL D+            +FN               
Sbjct: 266 KLTLHGLQQYYIKLNEKEKNRKLAQLLDDL------------EFN--------------- 298

Query: 399 XXXXXXXXXXXXXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGT 458
                                         I+FV +      +++LL  S +    ++G 
Sbjct: 299 ----------------------------QVIIFVKSTVRANELTKLLNASNFPAITVHGH 330

Query: 459 LDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTAR 518
           + Q  R  +   F+     I V TDV  RG+DI  +   IN+ +P  +  ++HRVGR  R
Sbjct: 331 MKQEERIARYKAFKEFEKRICVSTDVFGRGIDIERINLAINYDMPNEADQYLHRVGRAGR 390

Query: 519 AGNRGWAYSIVS 530
            G +G A S++S
Sbjct: 391 FGTKGLAISMIS 402

>Skud_8.122 Chr8 complement(200848..202359) [1512 bp, 503 aa] {ON}
           YHR065C (REAL)
          Length = 503

 Score =  150 bits (378), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 87/241 (36%), Positives = 132/241 (54%), Gaps = 4/241 (1%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF    L   ++       + +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 84  SFNELNLVPELIQACKNLNYSKPTPIQSKSIPPALKGHDIIGLAQTGSGKTAAFAIPILN 143

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
           ++  H  +    A IL+P+RELA Q    F        +RS  + GG ++ DQ   +M  
Sbjct: 144 RL-WHDQE-PYYACILAPTRELAQQIKEAFDSLGSLMGVRSTCIVGGMNMMDQARDLMRK 201

Query: 251 PDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSN-RQT 308
           P +IIATPGR + HL+      L+ +++ V DEADRL +M F   L+ +L  +P+  R T
Sbjct: 202 PHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTT 261

Query: 309 LLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDV 368
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YLL + 
Sbjct: 262 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQALMVVPGGLKNTYLIYLLNES 321

Query: 369 I 369
           I
Sbjct: 322 I 322

 Score = 92.8 bits (229), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 67/105 (63%)

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K  I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 324 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGALDLFKAGKRSILVATDVA 383

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           ARG+DIP +  V+N+ +P  SK +IHRVGRTARAG  G + S+VS
Sbjct: 384 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVS 428

>Suva_4.163 Chr4 (294691..296031) [1341 bp, 446 aa] {ON} YDL084W
           (REAL)
          Length = 446

 Score =  149 bits (375), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 106/410 (25%), Positives = 184/410 (44%), Gaps = 64/410 (15%)

Query: 127 HKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFIL 186
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 60  HSTG-FKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 118

Query: 187 PMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT-QLRSVLLTGGDSLEDQFG 245
             ++++     ++    V++  +RELA Q  N +  FSK    +++ +  GG  +     
Sbjct: 119 STLQQLDPVPGEVA--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPISKDAE 176

Query: 246 MMMNN---PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF-EMGFQDQLNELLAS 301
           ++ N    P +++ATPGR   L  E  +DL  ++  V DE D++  E+  +  + E+  +
Sbjct: 177 LLKNKDTAPHIVVATPGRLKALVREKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRA 236

Query: 302 LPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFLSTKNDEREAN 360
            P ++Q ++FSATL   +    +  L NP+ + +D E+K++   L+  ++  +  E+   
Sbjct: 237 TPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRK 296

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
           L  LL D+            +FN                                     
Sbjct: 297 LAQLLDDL------------EFNQ------------------------------------ 308

Query: 421 QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480
                   I+FV + +    +++LL  S +    ++G + Q  R  +   F+     I V
Sbjct: 309 -------VIIFVKSTNRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICV 361

Query: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
            TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S VS
Sbjct: 362 STDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVS 411

>TBLA0C03500 Chr3 complement(835236..836756) [1521 bp, 506 aa] {ON}
           Anc_5.337 YHR065C
          Length = 506

 Score =  150 bits (378), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 131/241 (54%), Gaps = 4/241 (1%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF    L   +V       + +PTPIQ + IP  L+ +DI+G+A+TGSGKTAAF +P++ 
Sbjct: 87  SFSELKLVPELVEACKNLNYEKPTPIQSRAIPPALEGKDIIGLAQTGSGKTAAFAIPILN 146

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
           K+          A I++P+RELA Q    F        +RSV + GG ++ DQ   +M  
Sbjct: 147 KLWEDQQPY--YACIMAPTRELAQQIKEQFDSLGALMGVRSVCIVGGMNMMDQARDLMRK 204

Query: 251 PDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-NRQT 308
           P +IIATPGR + HL+      L+ +++ V DEADRL ++ F   L+ +L  LP+  R T
Sbjct: 205 PHIIIATPGRLMDHLENTRGFSLRKLKFLVMDEADRLLDLEFGPVLDRILKILPTQGRTT 264

Query: 309 LLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDV 368
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YL+ + 
Sbjct: 265 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLIQTLMVVPGGLKNTYLIYLINEF 324

Query: 369 I 369
           +
Sbjct: 325 V 325

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 71/123 (57%)

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K+ I+F  T+ + E +S L     +    ++G L+Q+ R   L  F+ G  SIL+ TDVA
Sbjct: 327 KSIIIFTRTKANAERLSLLSNTLEFDAIALHGDLNQNQRTGALDLFKAGKKSILIATDVA 386

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 545
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG  G + S+VS              G
Sbjct: 387 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 446

Query: 546 KKI 548
           KK+
Sbjct: 447 KKL 449

>Suva_7.92 Chr7 (178376..180052) [1677 bp, 558 aa] {ON} YGL171W
           (REAL)
          Length = 558

 Score =  150 bits (380), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 110/397 (27%), Positives = 195/397 (49%), Gaps = 71/397 (17%)

Query: 130 GSFPS----FGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           GSF      F   K ++ N+ + GF +PTPIQ + IP+ L NRD++    TGSGKT AF+
Sbjct: 119 GSFEDLISRFSFDKRLLNNLVENGFTEPTPIQSECIPIALNNRDVLACGPTGSGKTLAFL 178

Query: 186 LPMIRKIKTHSSKIGARAVILSPSRELAMQ--------THNVFKEFSKGTQLRSVLLTGG 237
           +P++++I       G + +I+SP++ELA Q        +H +F E  K   L+  LL+  
Sbjct: 179 IPLVQQIIDDKHTPGLKGLIISPTKELANQIFIECFKLSHKIFLE--KKRPLQIALLSKS 236

Query: 238 DSLEDQFGMMMNNP-DVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLN 296
            S + +  ++ +   D+II+TP R + +    +LDL  +++ +FDEAD+LF+  F +Q +
Sbjct: 237 LSAKLKNKVISDKKYDIIISTPLRLIDVVKNEALDLSKVKHLIFDEADKLFDKTFVEQSD 296

Query: 297 ELLASL--PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKN 354
           ++L++   P+ R+  +FSAT+PSS+ + A++ + +PV V +  +   + ++E   +   N
Sbjct: 297 DILSACKEPALRKA-MFSATIPSSVEEIAQSIMMDPVRVIIGHKEAANTDIEQKLVFCGN 355

Query: 355 DEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXE 414
           +  E  L+ + Q V         Q+ +F                                
Sbjct: 356 E--EGKLIAIRQLV---------QEGEFK------------------------------- 373

Query: 415 RLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTG 474
             PP          I+F+ +    + +   L      +  I+       R R +  F++G
Sbjct: 374 --PP---------IIIFLESITRAKALYHELMYDRINVDVIHAERTALQRDRIIERFKSG 422

Query: 475 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIH 511
               L+ TDV ARG+D   +  VIN+ +P SS+ ++H
Sbjct: 423 ELWCLICTDVLARGIDFKGVNLVINYDVPGSSQAYVH 459

>Kpol_1058.53 s1058 complement(136863..138191) [1329 bp, 442 aa]
           {ON} complement(136863..138191) [1329 nt, 443 aa]
          Length = 442

 Score =  148 bits (373), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 107/423 (25%), Positives = 190/423 (44%), Gaps = 67/423 (15%)

Query: 118 STTNLEKSKHKKG----SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGM 173
           +TT+ EK     G     F  F L   +   I   GF  P+ +Q+ TIP  +   D++  
Sbjct: 42  ATTDSEKKGSYVGIHSTGFKDFLLKPELARAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQ 101

Query: 174 ARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT-QLRSV 232
           A++G GKTA F+L  ++++     ++    V++  +RELA Q  N +  FSK    +++ 
Sbjct: 102 AKSGLGKTAVFVLSTLQQLDPVPGEVS--VVVICNARELAYQIRNEYLRFSKYMPDVKTA 159

Query: 233 LLTGGDSLEDQFGMMMNN---PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF-E 288
           +  GG  +     ++ N    P +++ATPGR   L  +  +DL  ++  V DE D++  E
Sbjct: 160 VFYGGTPITKDAELLKNKETAPHIVVATPGRLKALVRDKLIDLSHVKNFVIDECDKVLEE 219

Query: 289 MGFQDQLNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKIS-ENLEM 347
           +  +  + ++  + P ++Q ++FSATL   +    +  L NP+ + +D E+K++   L+ 
Sbjct: 220 LDMRRDVQDIFRATPRDKQVMMFSATLSEEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQ 279

Query: 348 LFLSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXX 407
            ++  + +E+   L  LL D+            +FN                        
Sbjct: 280 YYIKLQENEKNRKLAQLLDDL------------EFNQ----------------------- 304

Query: 408 XXXXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQ 467
                                I+FV +      +++LL +S +    ++G + Q  R  +
Sbjct: 305 --------------------VIIFVKSTKRANELTKLLNESNFPAITVHGNMKQAERIAR 344

Query: 468 LYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYS 527
              F+     I V TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S
Sbjct: 345 YKAFKEFEKRICVSTDVFGRGIDIERINLAINYDLTTEADQYLHRVGRAGRFGTKGLAIS 404

Query: 528 IVS 530
            VS
Sbjct: 405 FVS 407

>Kpol_2001.67 s2001 (185153..186607) [1455 bp, 484 aa] {ON}
           (185153..186607) [1455 nt, 485 aa]
          Length = 484

 Score =  149 bits (375), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 120/208 (57%), Gaps = 2/208 (0%)

Query: 128 KKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILP 187
           K  +F  F L + ++  I + GF +P+PIQ ++IP+ L  RDI+  A+ G+GKTAAF++P
Sbjct: 32  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEESIPVALAGRDILARAKNGTGKTAAFVIP 91

Query: 188 MIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            + K+K+  +KI  +A+I+ P+RELA+QT  V +   K   +  ++ TGG +L D    +
Sbjct: 92  TLEKVKSKHNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 149

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
                +++ TPGR L L      DL      + DEAD++    F+  + ++L  LP N Q
Sbjct: 150 NETVHILVGTPGRVLDLASRKVADLSECNLFIMDEADKMLSRDFKSIIEQILVFLPKNHQ 209

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRL 335
           +LLFSAT P S+ +F    L  P  + L
Sbjct: 210 SLLFSATFPLSVKEFMVNHLHKPYEINL 237

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 60/102 (58%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+F  + + VE +++ + D GY   Y +  + Q  R R  + FR G    LV +D+  RG
Sbjct: 275 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 334

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 335 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 376

>YDL084W Chr4 (305237..306577) [1341 bp, 446 aa] {ON}  SUB2Component
           of the TREX complex required for nuclear mRNA export;
           member of the DEAD-box RNA helicase superfamily and is
           involved in early and late steps of spliceosome
           assembly; homolog of the human splicing factor hUAP56
          Length = 446

 Score =  147 bits (372), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 106/410 (25%), Positives = 183/410 (44%), Gaps = 64/410 (15%)

Query: 127 HKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFIL 186
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 60  HSTG-FKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 118

Query: 187 PMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT-QLRSVLLTGGDSLEDQFG 245
             ++++     ++    V++  +RELA Q  N +  FSK    +++ +  GG  +     
Sbjct: 119 STLQQLDPVPGEVA--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPISKDAE 176

Query: 246 MMMNN---PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF-EMGFQDQLNELLAS 301
           ++ N    P +++ATPGR   L  E  +DL  ++  V DE D++  E+  +  + E+  +
Sbjct: 177 LLKNKDTAPHIVVATPGRLKALVREKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRA 236

Query: 302 LPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFLSTKNDEREAN 360
            P ++Q ++FSATL   +    +  L NP+ + +D E+K++   L+  ++  +  E+   
Sbjct: 237 TPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRK 296

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
           L  LL D+            +FN                                     
Sbjct: 297 LAQLLDDL------------EFNQ------------------------------------ 308

Query: 421 QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480
                   I+FV +      +++LL  S +    ++G + Q  R  +   F+     I V
Sbjct: 309 -------VIIFVKSTTRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICV 361

Query: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
            TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S VS
Sbjct: 362 STDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVS 411

>NCAS0A14060 Chr1 (2765451..2766983) [1533 bp, 510 aa] {ON}
           Anc_7.336
          Length = 510

 Score =  149 bits (376), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 122/208 (58%), Gaps = 2/208 (0%)

Query: 128 KKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILP 187
           K  +F  F L + ++  I + GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 41  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEESIPIAITGRDILARAKNGTGKTAAFVIP 100

Query: 188 MIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            + KIK   +KI  +A+I+ P+RELA+QT  V +   K   +  ++ TGG +L D    +
Sbjct: 101 TLEKIKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 158

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
             +  V++ TPGR L L      DL   +  + DEAD++    F+  + ++L  LP   Q
Sbjct: 159 NESVHVLVGTPGRVLDLASRKVADLSDCQLFIMDEADKMLSRDFKTIIEQILIFLPKKHQ 218

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRL 335
           +LLFSAT P ++ +F    LTNP  + L
Sbjct: 219 SLLFSATFPLTVKEFMVKHLTNPYEINL 246

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 60/102 (58%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+F  + + VE +++ + D GY   Y +  + Q  R R  + FR G    LV +D+  RG
Sbjct: 284 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 343

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           +DI  +  VINF  P +S+ ++HR+GR+ R G+ G A ++++
Sbjct: 344 IDIQAVNVVINFDFPKTSETYLHRIGRSGRFGHLGLAINLIN 385

>TDEL0F05260 Chr6 complement(983324..985291) [1968 bp, 655 aa] {ON}
           Anc_8.402 YDR194C
          Length = 655

 Score =  151 bits (382), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 120/418 (28%), Positives = 196/418 (46%), Gaps = 84/418 (20%)

Query: 137 LSKIIVTNITKRGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFILPMIRKI-- 192
           L K +  +I++  F   T +Q+KTI  I+Q+  +D++  A+TG+GKT AF++P+ + +  
Sbjct: 105 LDKTLHKSISRMNFTGLTSVQQKTIKPIVQSEEQDVIARAKTGTGKTFAFLIPIFQHLIN 164

Query: 193 KTHSSKIGARAVILSPSRELAMQ----THNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMM 248
               S+   + VI++P+R+LA+Q     H + +      +   V L GG +    FG  M
Sbjct: 165 TRRDSQYMVKCVIVAPTRDLALQIETEVHKIHEHNYALKKFGCVSLVGGTN----FGSAM 220

Query: 249 NN-----PDVIIATPGRFLHLKVEMSLD--LKSIEYAVFDEADRLFEMGFQ-------DQ 294
                  P+++IATPGR + + ++   D   K +++ + DEADRL E+GF+       D 
Sbjct: 221 RKMSSVRPNIVIATPGRLMAV-LDQYADRYFKFVDFKILDEADRLLEIGFKEDLESISDT 279

Query: 295 LNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDA----ESKISENLEMLFL 350
           LNE+    P + +TLLFSATL   +   A   +     V LD     E +  E +E   +
Sbjct: 280 LNEINDKSPDHIRTLLFSATLDDKVQKLASKIMNKDECVFLDTVDKNEPEAHEKIEQSMV 339

Query: 351 STKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXX 410
            +   ER A+ +Y   D IK  + ++                                  
Sbjct: 340 IS---ERMAHSIYAAVDHIKQKMVSE---------------------------------- 362

Query: 411 XXXERLPPANQLPSEKATILFVPTRHHVEYISQLLK---DSGYLISYIYGTLDQHARKRQ 467
                       P+ KA ILF PT     ++S +L+    S   +   +G +DQ  R   
Sbjct: 363 ------------PNYKA-ILFTPTVKFTRFLSAILRRELRSKLPVLEFHGQIDQRRRTNL 409

Query: 468 LYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWA 525
           +  F+   + +LV TDV ARG+D P +  V+   +P+    +IHR+GRTAR G  G +
Sbjct: 410 VNQFKRDKSGLLVCTDVGARGMDFPNVTEVLQIGVPSELANYIHRIGRTARGGQEGSS 467

>Smik_4.152 Chr4 (281728..283068) [1341 bp, 446 aa] {ON} YDL084W
           (REAL)
          Length = 446

 Score =  147 bits (372), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 106/410 (25%), Positives = 183/410 (44%), Gaps = 64/410 (15%)

Query: 127 HKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFIL 186
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 60  HSTG-FKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 118

Query: 187 PMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT-QLRSVLLTGGDSLEDQFG 245
             ++++     ++    V++  +RELA Q  N +  FSK    +++ +  GG  +     
Sbjct: 119 STLQQLDPVPGEVA--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPISKDAE 176

Query: 246 MMMNN---PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF-EMGFQDQLNELLAS 301
           ++ N    P +++ATPGR   L  E  +DL  ++  V DE D++  E+  +  + E+  +
Sbjct: 177 LLKNKDTAPHIVVATPGRLKALVREKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRA 236

Query: 302 LPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFLSTKNDEREAN 360
            P ++Q ++FSATL   +    +  L NP+ + +D E+K++   L+  ++  +  E+   
Sbjct: 237 TPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRK 296

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
           L  LL D+            +FN                                     
Sbjct: 297 LAQLLDDL------------EFNQ------------------------------------ 308

Query: 421 QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480
                   I+FV +      +++LL  S +    ++G + Q  R  +   F+     I V
Sbjct: 309 -------VIIFVKSTTRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICV 361

Query: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
            TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S VS
Sbjct: 362 STDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVS 411

>Skud_4.171 Chr4 (300716..302056) [1341 bp, 446 aa] {ON} YDL084W
           (REAL)
          Length = 446

 Score =  147 bits (372), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 106/410 (25%), Positives = 183/410 (44%), Gaps = 64/410 (15%)

Query: 127 HKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFIL 186
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 60  HSTG-FKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 118

Query: 187 PMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT-QLRSVLLTGGDSLEDQFG 245
             ++++     ++    V++  +RELA Q  N +  FSK    +++ +  GG  +     
Sbjct: 119 STLQQLDPVPGEVA--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPISKDAE 176

Query: 246 MMMNN---PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF-EMGFQDQLNELLAS 301
           ++ N    P +++ATPGR   L  E  +DL  ++  V DE D++  E+  +  + E+  +
Sbjct: 177 LLKNKDTAPHIVVATPGRLKALVREKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRA 236

Query: 302 LPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFLSTKNDEREAN 360
            P ++Q ++FSATL   +    +  L NP+ + +D E+K++   L+  ++  +  E+   
Sbjct: 237 TPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRK 296

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
           L  LL D+            +FN                                     
Sbjct: 297 LAQLLDDL------------EFNQ------------------------------------ 308

Query: 421 QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480
                   I+FV +      +++LL  S +    ++G + Q  R  +   F+     I V
Sbjct: 309 -------VIIFVKSTTRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICV 361

Query: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
            TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S VS
Sbjct: 362 STDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVS 411

>Suva_15.254 Chr15 complement(429201..430712) [1512 bp, 503 aa] {ON}
           YHR065C (REAL)
          Length = 503

 Score =  149 bits (375), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 84/222 (37%), Positives = 126/222 (56%), Gaps = 4/222 (1%)

Query: 150 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPS 209
           + +PTPIQ K+IP  L   DI+G+A+TGSGKTAAF +P++ ++  H  +    A IL+P+
Sbjct: 103 YSKPTPIQSKSIPPALAGHDIIGLAQTGSGKTAAFAIPILNRL-WHDQE-PYYACILAPT 160

Query: 210 RELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFL-HLKVEM 268
           RELA Q    F        +RS  + GG ++ DQ   +M  P +IIATPGR + HL+   
Sbjct: 161 RELAQQIKEAFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 220

Query: 269 SLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSN-RQTLLFSATLPSSLVDFAKAGL 327
              L+ +++ V DEADRL +M F   L+ +L  +P+  R T LFSAT+ S +    +A L
Sbjct: 221 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTTYLFSATMTSKIDKLQRASL 280

Query: 328 TNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDVI 369
           TNPV   +  + +  + L    +      +   L+YLL + I
Sbjct: 281 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEFI 322

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 71/123 (57%)

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K  I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+ G  +ILV TDVA
Sbjct: 324 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGALDLFKAGKRAILVATDVA 383

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 545
           ARG+DIP +  V+N+ +P  SK +IHRVGRTARAG  G + S+VS              G
Sbjct: 384 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSVSLVSQYDLELILRIEEVLG 443

Query: 546 KKI 548
           KK+
Sbjct: 444 KKL 446

>CAGL0L06908g Chr12 complement(779554..780873) [1320 bp, 439 aa]
           {ON} highly similar to uniprot|Q07478 Saccharomyces
           cerevisiae YDL084w SUB2
          Length = 439

 Score =  147 bits (371), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 106/410 (25%), Positives = 183/410 (44%), Gaps = 64/410 (15%)

Query: 127 HKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFIL 186
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 53  HSTG-FKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 111

Query: 187 PMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT-QLRSVLLTGGDSLEDQFG 245
             ++++     ++    V++  +RELA Q  N +  FSK    +R+ +  GG  +     
Sbjct: 112 STLQQLDPVPGEVS--VVVICNARELAYQIRNEYLRFSKYMPDVRTAVFYGGTPIAKDAE 169

Query: 246 MMMNN---PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF-EMGFQDQLNELLAS 301
           ++ N    P +++ATPGR   L  +  +DL  ++  V DE D++  E+  +  + E+  +
Sbjct: 170 LLKNKDTAPHIVVATPGRLKALVRDKMIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRA 229

Query: 302 LPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFLSTKNDEREAN 360
            P ++Q ++FSATL   +    +  L NP+ + +D E+K++   L+  ++  +  E+   
Sbjct: 230 TPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRK 289

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
           L  LL D+            +FN                                     
Sbjct: 290 LAQLLDDL------------EFNQ------------------------------------ 301

Query: 421 QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480
                   I+FV +      +++LL  S +    ++G + Q  R  +   F+     I V
Sbjct: 302 -------VIIFVKSTSRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICV 354

Query: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
            TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S VS
Sbjct: 355 STDVFGRGIDIERINLAINYDLLNEADQYLHRVGRAGRFGTKGLAISFVS 404

>Kwal_33.14325 s33 (619599..621101) [1503 bp, 500 aa] {ON} YHR065C
           (RRP3) - RRP3 is a DEAD box gene homologous to eIF-4a
           which encodes an RNA-dependent ATPase possessing
           helicase activity which is not specific for RNA [contig
           104] FULL
          Length = 500

 Score =  148 bits (373), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 132/241 (54%), Gaps = 4/241 (1%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF    L   ++       + +PTPIQ + IP  L+ +DI+G+A+TGSGKTAAF +P++ 
Sbjct: 80  SFSELKLVPELIEACENLKYSKPTPIQAEAIPPALEGKDIIGLAQTGSGKTAAFAIPILN 139

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
           ++  H  +    A +L+P+RELA Q    F        +R+  + GG ++ DQ   +M  
Sbjct: 140 QL-WHDQQ-PYYACVLAPTRELAQQIKETFDSLGGAMGVRTTCIVGGMNMIDQARDLMRK 197

Query: 251 PDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-NRQT 308
           P +IIATPGR + HL+      ++ ++Y V DEADRL +M F   L+ +L  +P+  R T
Sbjct: 198 PHIIIATPGRLMDHLENTKGFSMRKLKYLVMDEADRLLDMEFGPVLDRILKIIPTQGRTT 257

Query: 309 LLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDV 368
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YLL + 
Sbjct: 258 YLFSATMTSKIDKLQRASLTNPVKCAVSTKYQTVDTLIQTLMVVPGGLKNTFLIYLLNEF 317

Query: 369 I 369
           +
Sbjct: 318 L 318

 Score = 95.5 bits (236), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/105 (47%), Positives = 67/105 (63%)

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K  I+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 320 KTVIIFTRTKANAERISTLCNLLEFSSTALHGDLNQNQRTGALDLFKAGRRSILVATDVA 379

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG  G + S+VS
Sbjct: 380 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVS 424

>KNAG0C03820 Chr3 complement(748934..750475) [1542 bp, 513 aa] {ON}
           Anc_7.336 YDL160C
          Length = 513

 Score =  148 bits (374), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 123/213 (57%), Gaps = 2/213 (0%)

Query: 126 KHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           K K  +F  F L + ++  I + GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAF+
Sbjct: 30  KTKGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFV 89

Query: 186 LPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFG 245
           +P + K+K   +KI  +A+I+ P+RELA+QT  V +   K   +  ++ TGG +L D   
Sbjct: 90  IPTLEKVKPKLNKI--QALIMVPTRELALQTSQVVRSLGKHCGVSCMVTTGGTNLRDDIL 147

Query: 246 MMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSN 305
            + +   +++ TPGR L L      DL      V DEAD++    F+  + ++LA LP N
Sbjct: 148 RLNDTIHILVGTPGRVLDLASRKIADLSECGLFVMDEADKMLSRDFKTIIEQILAFLPKN 207

Query: 306 RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAE 338
            Q+LLFSAT P ++ +F +  L  P  + L  E
Sbjct: 208 HQSLLFSATFPLTVKEFMEKHLNKPYEINLMEE 240

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 60/102 (58%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+F  + + VE +++ + D GY   Y +  + Q  R R  + FR G    LV +D+  RG
Sbjct: 275 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 334

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 335 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 376

>Kpol_1041.33 s1041 complement(82855..84180) [1326 bp, 441 aa] {ON}
           complement(82855..84180) [1326 nt, 442 aa]
          Length = 441

 Score =  147 bits (370), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 104/410 (25%), Positives = 184/410 (44%), Gaps = 64/410 (15%)

Query: 127 HKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFIL 186
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 55  HSTG-FKDFLLKPELARAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 113

Query: 187 PMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT-QLRSVLLTGGDSLEDQFG 245
             ++++     ++    V++  +RELA Q  N +  FSK    +++ +  GG  +     
Sbjct: 114 STLQQLDPVPGEVS--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPINKDAE 171

Query: 246 MMMNN---PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF-EMGFQDQLNELLAS 301
           ++ N    P +++ATPGR   L  +  +DL  ++  V DE D++  E+  +  + ++  +
Sbjct: 172 LLKNKETAPHIVVATPGRLKALVRDKLIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRA 231

Query: 302 LPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFLSTKNDEREAN 360
            P ++Q ++FSATL   +    +  L NP+ + +D E+K++   L+  +   + +E+   
Sbjct: 232 TPRDKQVMMFSATLSEEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYTKLQENEKNRK 291

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
           L  LL D+            +FN                                     
Sbjct: 292 LAQLLDDL------------EFNQ------------------------------------ 303

Query: 421 QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480
                   I+FV +      +++LL +S +    ++G + Q  R  +   F+     I V
Sbjct: 304 -------VIIFVKSTKRANELTKLLNESNFPAITVHGHMKQAERIARYKAFKEFEKRICV 356

Query: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
            TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S VS
Sbjct: 357 STDVFGRGIDIERINLAINYDLTTEADQYLHRVGRAGRFGTKGLAISFVS 406

>Ecym_4646 Chr4 complement(1259564..1261036) [1473 bp, 490 aa] {ON}
           similar to Ashbya gossypii ACR197W
          Length = 490

 Score =  147 bits (372), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 122/209 (58%), Gaps = 4/209 (1%)

Query: 128 KKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILP 187
           K  +F  F L + ++  I + GF +P+PIQ + IP+ L  RDI+  A+ G+GKTAAF++P
Sbjct: 28  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPIALTRRDILARAKNGTGKTAAFVIP 87

Query: 188 MIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            +  +K   +KI  +A+I+ P+RELA+QT  V +   K   L  ++ TGG +L D   M 
Sbjct: 88  TLEIVKPKVNKI--QALIMVPTRELALQTSQVVRTLGKHCGLSCMVTTGGTNLRDDI-MR 144

Query: 248 MNNP-DVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNR 306
           +N P  V++ TPGR L L      DL      + DEAD++    F+  + ++L+ LPS+ 
Sbjct: 145 LNEPVHVLVGTPGRVLDLASRKVADLSECSLFIMDEADKMLSRDFKSLIEQILSFLPSSH 204

Query: 307 QTLLFSATLPSSLVDFAKAGLTNPVLVRL 335
           Q+LLFSAT P ++ +F    L  P  + L
Sbjct: 205 QSLLFSATFPLTVKEFMVKHLNKPYEINL 233

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 60/102 (58%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+F  + + VE +++ + D GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 271 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 330

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 331 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 372

>SAKL0F11088g Chr6 complement(866571..868064) [1494 bp, 497 aa] {ON}
           highly similar to uniprot|P39517 Saccharomyces
           cerevisiae YDL160C DHH1 Cytoplasmic DExD/H-box helicase
           stimulates mRNA decapping coordinates distinct steps in
           mRNA function and decay interacts with both the
           decapping and deadenylase complexes may have a role in
           mRNA export and translation
          Length = 497

 Score =  147 bits (372), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 78/208 (37%), Positives = 119/208 (57%), Gaps = 2/208 (0%)

Query: 128 KKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILP 187
           K  +F  F L + ++  I + GF +P+PIQ + IP+ L  RDI+  A+ G+GKTAAF++P
Sbjct: 27  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPIALAGRDILARAKNGTGKTAAFVIP 86

Query: 188 MIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            + KIK   +KI  +A+IL P+RELA+QT  V +   K   +  ++ TGG +L D    +
Sbjct: 87  TLEKIKPKVNKI--QALILVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDIMRL 144

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
                V++ TPGR L L      DL      V DEAD++    F+  + ++L+  P +RQ
Sbjct: 145 HEPVHVLVGTPGRVLDLASRKVADLSECPLFVMDEADKMLSRDFKSIIEQILSFFPQSRQ 204

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRL 335
           +LLFSAT P ++ +F    L  P  + L
Sbjct: 205 SLLFSATFPLTVKEFMVNHLNKPYEINL 232

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 60/102 (58%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+F  + + VE +++ + D GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 270 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 329

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 330 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 371

>KAFR0B00910 Chr2 complement(168186..169724) [1539 bp, 512 aa] {ON}
           Anc_7.336 YDL160C
          Length = 512

 Score =  147 bits (372), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 122/211 (57%), Gaps = 2/211 (0%)

Query: 128 KKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILP 187
           K  +F  F L + ++  I + GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 43  KGNTFEDFHLKRELLMGIFEAGFEKPSPIQEESIPVAITGRDILARAKNGTGKTAAFVIP 102

Query: 188 MIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            ++KIK   +KI  +A+I+ P+RELA+QT  V +   K   +  ++ TGG +L D    +
Sbjct: 103 TLQKIKPKVNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 160

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
            +   V++ TPGR L L      DL      + DEAD++    F+  + ++L  LP N Q
Sbjct: 161 NDTVHVLVGTPGRVLDLASRKIADLSECALFIMDEADKMLSRDFKTIIEQILIFLPKNHQ 220

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAE 338
           +LLFSAT P ++ +F    L  P  + L  E
Sbjct: 221 SLLFSATFPLTVKEFMVKHLNKPYEINLMEE 251

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 60/102 (58%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+F  + + VE +++ + D GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 286 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 345

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 346 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 387

>KLTH0F07106g Chr6 (618637..620214) [1578 bp, 525 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 525

 Score =  148 bits (373), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 82/241 (34%), Positives = 132/241 (54%), Gaps = 4/241 (1%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF    L   ++       + +PTPIQ + IP  L+ +DI+G+A+TGSGKTAAF +P++ 
Sbjct: 106 SFSELNLVPELIEACENLKYSKPTPIQAEAIPPALEGKDIIGLAQTGSGKTAAFAIPILN 165

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
           ++  H  +    A +L+P+RELA Q    F        +R+  + GG ++ DQ   +M  
Sbjct: 166 QL-WHDQQ-PYYACVLAPTRELAQQIKETFDSLGGAMGVRTTCIVGGMNMIDQARDLMRK 223

Query: 251 PDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-NRQT 308
           P +IIATPGR + HL+      ++ +++ V DEADRL +M F   L+ +L  +P+  R T
Sbjct: 224 PHIIIATPGRLMDHLENTKGFSMRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTT 283

Query: 309 LLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDV 368
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YLL + 
Sbjct: 284 YLFSATMTSKIDKLQRASLTNPVKCAVSTKYQTVDTLIQTLMVVPGGLKNTFLIYLLNEF 343

Query: 369 I 369
           +
Sbjct: 344 L 344

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 67/105 (63%)

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K  I+F  T+ + E I+ L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 346 KTAIVFTRTKANAERIATLCNLLEFSATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 405

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG  G + S+VS
Sbjct: 406 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVS 450

>TDEL0G03140 Chr7 (587922..589256) [1335 bp, 444 aa] {ON} Anc_2.384
           YDL084W
          Length = 444

 Score =  146 bits (368), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 105/410 (25%), Positives = 183/410 (44%), Gaps = 64/410 (15%)

Query: 127 HKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFIL 186
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 58  HSTG-FKDFLLEPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 116

Query: 187 PMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT-QLRSVLLTGGDSLEDQFG 245
             ++++     ++    V++  +RELA Q  N +  FSK    +++ +  GG  +     
Sbjct: 117 STLQQLDPVPGEVS--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPIAKDAE 174

Query: 246 MMMNN---PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF-EMGFQDQLNELLAS 301
           ++ N    P +++ATPGR   L  +  +DL  ++  V DE D++  E+  +  + E+  +
Sbjct: 175 LLKNKETAPHIVVATPGRLKALVRDKLIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRA 234

Query: 302 LPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFLSTKNDEREAN 360
            P ++Q ++FSATL   +    +  L NP+ + +D E+K++   L+  ++  +  E+   
Sbjct: 235 TPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRK 294

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
           L  LL D+            +FN                                     
Sbjct: 295 LAKLLDDL------------EFNQ------------------------------------ 306

Query: 421 QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480
                   I+FV +      +++LL  S +    ++G + Q  R  +   F+     I V
Sbjct: 307 -------VIIFVRSTSRANELTKLLNASNFPALTVHGHMKQEERIARYKAFKDFEKRICV 359

Query: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
            TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S VS
Sbjct: 360 STDVFGRGIDIERINLAINYDLTTEADQYLHRVGRAGRFGTKGLAISFVS 409

>CAGL0L10021g Chr12 complement(1076197..1077711) [1515 bp, 504 aa]
           {ON} highly similar to uniprot|P20449 Saccharomyces
           cerevisiae YOR046c DBP5 RNA helicase
          Length = 504

 Score =  147 bits (372), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 110/408 (26%), Positives = 190/408 (46%), Gaps = 69/408 (16%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFILPM 188
           SF   GLS  ++  I    F++P+ IQ + +PL+L N  R+++  +++G+GKTAAF L M
Sbjct: 115 SFDELGLSPELLKGIYAMKFQKPSKIQERALPLLLSNPPRNMIAQSQSGTGKTAAFSLTM 174

Query: 189 IRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMM 248
           + ++    ++   +A+ L+PSRELA QT  V +E  K T++ + L+   DS E    +  
Sbjct: 175 LSRV--DETQNVPQAICLAPSRELARQTLEVIQEMGKYTKITTQLIV-PDSFEKNTKI-- 229

Query: 249 NNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFE-MGFQDQLNELLASLPSNRQ 307
            N +V++ TPG  L L     + L++++  V DEAD + +  G  DQ   +   LP + Q
Sbjct: 230 -NANVVVGTPGTLLDLIRRKLIQLQNVKIFVLDEADNMLDKQGLGDQCIRVKKFLPKDTQ 288

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQD 367
            +LFSAT   ++  +A+  + N   + L       + ++ L++   ++  +  +L  L  
Sbjct: 289 LVLFSATFADAVKAYAQKVIPNANTLELQRNEVNVKAIKQLYMDCNDEAHKYEVLCELYG 348

Query: 368 VIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKA 427
           ++ I  +     +K                                           + A
Sbjct: 349 LLTIGSSIIFVAKK-------------------------------------------DTA 365

Query: 428 TILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 487
            +L+   +H    +S L  D           L    R R + +FR G + +L+ T+V AR
Sbjct: 366 NLLYGKLKHEGHQVSILHSD-----------LRTDERDRLIDDFREGRSKVLITTNVLAR 414

Query: 488 GVDIPMLANVINFSLPA------SSKIFIHRVGRTARAGNRGWAYSIV 529
           G+DIP ++ V+N+ LP           ++HR+GRT R G  G A S V
Sbjct: 415 GIDIPSVSMVVNYDLPTLPNGMPDYATYVHRIGRTGRFGRTGVAISFV 462

>ACR197W Chr3 (695405..696859) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL160C (DHH1)
          Length = 484

 Score =  147 bits (370), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 121/209 (57%), Gaps = 4/209 (1%)

Query: 128 KKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILP 187
           K  +F  F L + ++  I + GF +P+PIQ + IP+ L  RDI+  A+ G+GKTAAF++P
Sbjct: 27  KGNTFEDFYLRRELLMGIFEAGFERPSPIQEEAIPIALARRDILARAKNGTGKTAAFVIP 86

Query: 188 MIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            +  +K   +KI  +A+I+ P+RELA+QT  V +   K   +  ++ TGG +L D   M 
Sbjct: 87  TLEIVKPKVNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDI-MR 143

Query: 248 MNNP-DVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNR 306
           +N P  V++ TPGR L L      DL      V DEAD++    F+  + ++L+ LP N 
Sbjct: 144 LNEPVHVLVGTPGRVLDLASRKVADLSECSLFVMDEADKMLSRDFKSLVEQILSFLPQNH 203

Query: 307 QTLLFSATLPSSLVDFAKAGLTNPVLVRL 335
           Q+LLFSAT P ++ +F    L  P  + L
Sbjct: 204 QSLLFSATFPLTVKEFMVKHLNKPYEINL 232

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 72/140 (51%), Gaps = 5/140 (3%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+F  + + VE +++ + D GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 270 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 329

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKI 548
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++              G +I
Sbjct: 330 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEI 389

Query: 549 MLTPMYDSLCEIMKNKWIAE 568
              P      +I K+ ++AE
Sbjct: 390 AAIP-----AQIDKSLYVAE 404

>KLTH0H08646g Chr8 (750413..752113) [1701 bp, 566 aa] {ON} highly
           similar to uniprot|P45818 Saccharomyces cerevisiae
           YGL171W ROK1 ATP-dependent RNA helicase of the DEAD box
           family required for 18S rRNA synthesis
          Length = 566

 Score =  147 bits (372), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 118/401 (29%), Positives = 195/401 (48%), Gaps = 71/401 (17%)

Query: 130 GSFPS----FGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           GSF      F   K +++N+ +  F +PTPIQ + IPL L+ RD++  A TGSGKT AFI
Sbjct: 123 GSFEDLITRFQFDKRLLSNLIESHFTEPTPIQCEAIPLALEGRDVLACAPTGSGKTVAFI 182

Query: 186 LPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQ---------LRSVLLTG 236
           LP++++I +   K G + +I+SP++ELA Q   +F E SK +          L   LL+ 
Sbjct: 183 LPLLQQIISLGDKEGLKGLIISPTKELANQ---IFVECSKLSHKIYLARKRPLNIALLSK 239

Query: 237 GDSLEDQFGMMMNNP-DVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQL 295
             S + +  ++ +   D+II+TP R + +    +LDL  +++ +FDEAD+LF+  F +Q 
Sbjct: 240 SLSAKLRNKVISDKKYDLIISTPLRLIDVVKNEALDLSDVKHLIFDEADKLFDSTFVEQA 299

Query: 296 NELLASLP-SNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKN 354
           + +LAS   S  +  +FSAT+PSSL +   + + +PV + +  +   + N+E   +   N
Sbjct: 300 DSILASCQDSQLRKSMFSATVPSSLEEVVNSIMLDPVRIIIGHKEAANVNIEQKLVYCGN 359

Query: 355 DEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXE 414
           +  E  L+ + Q +         Q+  F                                
Sbjct: 360 E--EGKLVAIRQMI---------QEGGFK------------------------------- 377

Query: 415 RLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTG 474
             PP          I+F+ +    + +   L      +  I+    Q  R   +  FRTG
Sbjct: 378 --PP---------VIIFLESITRAKALFHELLYDNLNVDVIHAERTQVQRNTIIERFRTG 426

Query: 475 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGR 515
               L+ TDV ARGVD   +  VIN+ +P S++ ++HR+GR
Sbjct: 427 ELWCLICTDVLARGVDFKGVNLVINYDVPRSAQAYVHRIGR 467

>AAL041C Chr1 complement(270739..272202) [1464 bp, 487 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR065C
           (RRP3)
          Length = 487

 Score =  146 bits (368), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 88/242 (36%), Positives = 132/242 (54%), Gaps = 5/242 (2%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF    L   ++       F +PTPIQ K IP  LQ +DI+G+A+TGSGKTAAF +P++ 
Sbjct: 67  SFRELDLVPELIEACDNLNFTKPTPIQSKAIPPALQGKDIIGLAQTGSGKTAAFAIPILN 126

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
           ++  H  +    A IL+P+RELA Q    F        +R+  + GG ++ DQ   +M  
Sbjct: 127 RL-WHDQQ-PYYACILAPTRELAQQIKETFDSLGSLMGVRTTCIVGGMNMMDQARDLMRK 184

Query: 251 PDVIIATPGRFL-HLKV-EMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSN-RQ 307
           P +IIATPGR + HL+V +    L+  ++ V DEADRL  M F   L+ +L ++P+  R 
Sbjct: 185 PHIIIATPGRLMDHLEVHKRGFALRKQQFLVMDEADRLLNMKFGPVLDRILKNIPTKVRT 244

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQD 367
           T LFSAT+ S +    +A LTN V   +  + +  + L    +      +   L+YLL +
Sbjct: 245 TYLFSATMTSKIDKLQRASLTNTVKCAVSNKYQTVDTLVQTLIVVPGGLKNTFLIYLLNE 304

Query: 368 VI 369
            I
Sbjct: 305 FI 306

 Score = 97.4 bits (241), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 72/123 (58%)

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K TI+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 308 KTTIVFTRTKANAERISGLCNLLEFSATALHGDLNQNQRTGALDLFKAGKKSILVATDVA 367

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 545
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG  G + S+VS              G
Sbjct: 368 ARGLDIPSVDLVINYDIPVDSKSYIHRVGRTARAGRSGKSVSLVSQYDLELILRIEEVLG 427

Query: 546 KKI 548
           KK+
Sbjct: 428 KKL 430

>SAKL0E05148g Chr5 complement(419901..420979,421045..421372) [1407
           bp, 468 aa] {ON} highly similar to uniprot|Q07478
           Saccharomyces cerevisiae YDL084W SUB2 Suppresses the
           cold-sensitive snRNP biogenesis brr1-1 mutation RNA
           helicase
          Length = 468

 Score =  145 bits (367), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 104/410 (25%), Positives = 185/410 (45%), Gaps = 64/410 (15%)

Query: 127 HKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFIL 186
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 82  HSTG-FKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 140

Query: 187 PMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT-QLRSVLLTGGDSLEDQFG 245
             ++++     ++    V++  +RELA Q  N +  FSK    +++ +  GG  ++    
Sbjct: 141 STLQQLDPVPGEVS--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPIQKDAE 198

Query: 246 MMMNN---PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFE-MGFQDQLNELLAS 301
           ++ N    P +++ATPGR   L  +  ++L  ++  V DE D++ E +  +  + ++  +
Sbjct: 199 LLKNKETAPHIVVATPGRLKALVRDKLINLGHVKNFVIDECDKVLEALDMRRDVQDIFRA 258

Query: 302 LPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFLSTKNDEREAN 360
            P ++Q ++FSATL   +    +  L NP+ + +D E+K++   L+  ++  +  E+   
Sbjct: 259 TPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYVKLEEREKNRK 318

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
           L  LL D+            +FN                                     
Sbjct: 319 LAQLLDDL------------EFNQ------------------------------------ 330

Query: 421 QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480
                   I+FV +      +++LL  S +    ++G + Q  R  +   F+     I V
Sbjct: 331 -------VIIFVKSTLRANELTKLLNASNFPAITVHGGMKQEERIARYKAFKEFEKRICV 383

Query: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
            TDV  RG+DI  +   IN+ LP  +  ++HRVGR  R G +G A S VS
Sbjct: 384 STDVFGRGIDIERINLAINYDLPNEADQYLHRVGRAGRFGTKGLAISFVS 433

>ZYRO0A08272g Chr1 (665522..666853) [1332 bp, 443 aa] {ON} highly
           similar to uniprot|Q07478 Saccharomyces cerevisiae
           YDL084W SUB2 Suppresses the cold-sensitive snRNP
           biogenesis brr1-1 mutation RNA helicase
          Length = 443

 Score =  144 bits (363), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 103/410 (25%), Positives = 182/410 (44%), Gaps = 64/410 (15%)

Query: 127 HKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFIL 186
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 57  HSTG-FKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 115

Query: 187 PMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT-QLRSVLLTGGDSLEDQFG 245
             ++++     ++    V++  +RELA Q  N +  FSK    +++ +  GG  +     
Sbjct: 116 STLQQLDPVPGEVA--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPISKDAD 173

Query: 246 MMMNN---PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF-EMGFQDQLNELLAS 301
           ++ N    P +++ATPGR   L  +  +DL  ++  V DE D++  E+  +  + E+  +
Sbjct: 174 LLKNKETAPHIVVATPGRLKALVRDKLIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRA 233

Query: 302 LPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFLSTKNDEREAN 360
            P ++Q ++FSATL   +    +  L NP+ + +D E+K++   L+  ++     E+   
Sbjct: 234 TPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLDEKEKNRK 293

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
           L  LL D+            +FN                                     
Sbjct: 294 LAQLLDDL------------EFNQ------------------------------------ 305

Query: 421 QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480
                   I+FV +      +++LL  S +    ++G + Q  R  +   F+     I V
Sbjct: 306 -------VIIFVRSTARANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICV 358

Query: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
            TDV  RG+DI  +   +N+ L   +  ++HRVGR  R G +G A S +S
Sbjct: 359 STDVFGRGIDIERINLALNYDLTTEADQYLHRVGRAGRFGTKGLAISFIS 408

>TDEL0C01160 Chr3 complement(198802..200613) [1812 bp, 603 aa] {ON}
           Anc_8.87 YFL002C
          Length = 603

 Score =  147 bits (370), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 108/397 (27%), Positives = 179/397 (45%), Gaps = 61/397 (15%)

Query: 149 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGA------R 202
           GF   TP+Q  TIPL  +N+D+V  + TGSGKT AF++P++ +I +  +   A       
Sbjct: 26  GFDAMTPVQASTIPLFSRNKDVVVESVTGSGKTVAFVVPILERIISDGANSTAFKKGHFH 85

Query: 203 AVILSPSRELAMQTHNVFKEF-----SKGTQLRSVLLTGGDS---LEDQFGMMMNNPDVI 254
           ++I++P+REL+ Q  +V + F          ++S LL G       +D    +   P ++
Sbjct: 86  SLIVTPTRELSNQIQSVIQSFLDHYPGDSYPIKSQLLVGTSQKTVRDDVTKFLEERPQIL 145

Query: 255 IATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQTLLFSAT 314
           + TPGR L      S+   S    V DEADRL +  F   + ++L +LP  R+T LFSAT
Sbjct: 146 VGTPGRVLDFLQMPSVKTLSCNMVVLDEADRLLDSDFFKDVEKILRTLPKQRRTGLFSAT 205

Query: 315 LPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDVIKIPLA 374
           +  +     K GL NPV V +++  K   +L + +      E+   L+ +L +       
Sbjct: 206 ISEAGNQIFKTGLRNPVKVTVNSSKKGPASLGLFYTVIDPQEKLLQLINILNNY------ 259

Query: 375 TKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKATILFVPT 434
                 KF                                        P+  +   F   
Sbjct: 260 ------KFKKCIAY---------------------------------FPTCISVTFFYSF 280

Query: 435 RHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLT-SILVVTDVAARGVDIPM 493
             +++   +LL D   ++  ++G L   +R + L NF   +  ++L+ TDVAARG+DI  
Sbjct: 281 LQYLQREKKLLSDE-VMVYSLHGKLQTASRMKTLENFTDTVNKAVLLTTDVAARGIDISD 339

Query: 494 LANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           +  V+    P  + + +HR GRT RA   G A + ++
Sbjct: 340 VDLVVQLDPPTDTSVLLHRCGRTGRANRIGKAITFIN 376

>TPHA0N00940 Chr14 (202770..205085) [2316 bp, 771 aa] {ON} Anc_5.241
           YJL033W
          Length = 771

 Score =  148 bits (374), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 80/201 (39%), Positives = 122/201 (60%), Gaps = 4/201 (1%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F    LS   V  + +  F + T IQR +IP+ L+  DI+G A+TGSGKT AF++P++ K
Sbjct: 43  FKDLPLSSATVKGLNEASFVKVTEIQRDSIPISLKGHDILGAAKTGSGKTLAFLIPVLEK 102

Query: 192 I--KTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMN 249
           +  +  S   G  A+I+SP+RELAMQT+ V  +    T   + L+ GG  ++ +    ++
Sbjct: 103 LYREKWSEFDGLGALIISPTRELAMQTYEVLTKIGTHTSFSAGLVIGGKDVKFE-SARIS 161

Query: 250 NPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQT 308
             +++I TPGR L H+   + L   +++  V DEADR  +MGFQ  L+ ++++LP  RQT
Sbjct: 162 KINILIGTPGRILQHMDQAVGLSTSNLQMLVLDEADRCLDMGFQKTLDAIVSNLPPTRQT 221

Query: 309 LLFSATLPSSLVDFAKAGLTN 329
           LLFSAT   SL D A+  LT+
Sbjct: 222 LLFSATQSQSLTDLARLSLTD 242

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 48/97 (49%), Gaps = 2/97 (2%)

Query: 429 ILFVPTRHHVEYISQLLK--DSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 486
           I+F+ +   V ++ +  +    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFSRAQQVCLFATDVVA 354

Query: 487 RGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRG 523
           RG+D P +  V+    P     +IHRVGR+AR G +G
Sbjct: 355 RGIDFPSVDWVVQLDCPEDVDTYIHRVGRSARYGKQG 391

>Ecym_8261 Chr8 complement(528229..530556) [2328 bp, 775 aa] {ON}
           similar to Ashbya gossypii ACR040W
          Length = 775

 Score =  148 bits (373), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 129/209 (61%), Gaps = 6/209 (2%)

Query: 125 SKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAF 184
           +K    SF    +S++ +  + + GF + T IQR +IP+ L+  DI+G A+TGSGKT AF
Sbjct: 36  TKCTASSFDELPISEVTLKGLKESGFIKLTDIQRDSIPMALKGHDILGAAKTGSGKTLAF 95

Query: 185 ILPMIRKI--KTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLED 242
           ++P+I K+  +  +   G  A+I+SP+RELAMQ + V  +  K T   + L+ GG  +  
Sbjct: 96  LIPVIEKLYREKWTEFDGLGALIISPTRELAMQIYEVLIKIGKHTSFSAGLVIGGKDV-- 153

Query: 243 QFGM-MMNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLA 300
           +F M  ++  +++I TPGR L H+   + L   +++  V DEADR  +MGF+  L+ +++
Sbjct: 154 KFEMDRISKINILIGTPGRILQHMDQAVGLTSSNLQILVLDEADRCLDMGFKKTLDAIVS 213

Query: 301 SLPSNRQTLLFSATLPSSLVDFAKAGLTN 329
           +LP +RQTLLFSAT   SL D A+  L +
Sbjct: 214 NLPPDRQTLLFSATQSQSLADLARLSLVD 242

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 51/105 (48%), Gaps = 2/105 (1%)

Query: 428 TILFVPTRHHVEYISQLLK--DSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           T++F+ +   V ++ +  +    G  + +++G   Q AR   L  F     + L  TDV 
Sbjct: 291 TVVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQHACLFSTDVV 350

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           ARG+D P +  V+    P     +IHR GR+AR G  G    +++
Sbjct: 351 ARGIDFPTVDWVVQVDCPEDVDTYIHRAGRSARYGKSGKCLIMLT 395

>Kpol_1060.58 s1060 complement(135570..136760) [1191 bp, 396 aa]
           {ON} complement(135570..136760) [1191 nt, 397 aa]
          Length = 396

 Score =  142 bits (358), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 109/412 (26%), Positives = 193/412 (46%), Gaps = 62/412 (15%)

Query: 120 TNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 179
           TN +K  +K   F    L   ++  +   GF +P+ IQ++ I  I++  D++  A++G+G
Sbjct: 16  TNYDKVVYK---FDDMNLKDELLKGVYGYGFEEPSAIQQRAILPIVEEHDVLAQAQSGTG 72

Query: 180 KTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDS 239
           KT  F +  +++I   SS    +A+IL+P+RELA+Q   V    +    ++     GG S
Sbjct: 73  KTGTFSIAALQRID--SSIKAPQALILAPTRELALQIQKVVIALAFHMDVKVHACIGGTS 130

Query: 240 -LEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNEL 298
            +ED  G+   +  +++ TPGR             +I+  + DEAD +   GF++Q+ ++
Sbjct: 131 FVEDTEGL--KDAQIVVGTPGRVSDNIQRHRFKTDNIKMFILDEADEMLSSGFREQIYQI 188

Query: 299 LASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDERE 358
              LP   Q +L SATLP  +++     + NP+ + +  +    E ++  +++ +     
Sbjct: 189 FTMLPPTTQVVLLSATLPGDVLEVTTKFMRNPIRILVKKDELTLEGIKQFYINVE----- 243

Query: 359 ANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPP 418
                             E+Q KF+                                L  
Sbjct: 244 ------------------EEQYKFD-------------------------------CLSD 254

Query: 419 ANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSI 478
                S    ++F  TR  VE ++Q L +S + +S IY  L Q  R   +  FR+G + I
Sbjct: 255 LYDSISVTQAVIFCNTRRKVEELTQKLTESNFTVSSIYSDLPQQERDVIMKEFRSGSSRI 314

Query: 479 LVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           L+ TD+ ARG+D+  ++ VIN+ LP + + +IHR+GR  R G +G A + V+
Sbjct: 315 LISTDLLARGIDVQQVSLVINYDLPTNKENYIHRIGRGGRFGRKGVAINFVT 366

>NDAI0E01750 Chr5 complement(346153..347505) [1353 bp, 450 aa] {ON}
           Anc_2.384
          Length = 450

 Score =  143 bits (361), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 99/392 (25%), Positives = 178/392 (45%), Gaps = 63/392 (16%)

Query: 145 ITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAV 204
           I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L  ++++     ++    V
Sbjct: 81  IIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVA--VV 138

Query: 205 ILSPSRELAMQTHNVFKEFSKGT-QLRSVLLTGGDSLEDQFGMMMNN---PDVIIATPGR 260
           ++  +RELA Q  N +  FSK    +++ +  GG  +     ++ N    P +++ATPGR
Sbjct: 139 VICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPINKDAELLKNKDTAPHIVVATPGR 198

Query: 261 FLHLKVEMSLDLKSIEYAVFDEADRLF-EMGFQDQLNELLASLPSNRQTLLFSATLPSSL 319
              L  +  +DL  ++  V DE D++  E+  +  + E+  + P ++Q ++FSATL   +
Sbjct: 199 LKALVRDKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRATPRDKQVMMFSATLSQEI 258

Query: 320 VDFAKAGLTNPVLVRLDAESKIS-ENLEMLFLSTKNDEREANLLYLLQDVIKIPLATKEQ 378
               +  L NP+ + +D E+K++   L+  ++  +  E+   L  LL D+          
Sbjct: 259 RPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRKLAQLLDDL---------- 308

Query: 379 QRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKATILFVPTRHHV 438
             +FN                                             I+FV + +  
Sbjct: 309 --EFNQ-------------------------------------------VIIFVKSTNRA 323

Query: 439 EYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVI 498
             +++LL  S +    ++G + Q  R  +   F+     I V TDV  RG+DI  +   I
Sbjct: 324 NELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLAI 383

Query: 499 NFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           N+ L +    ++HRVGR  R G +G A S V+
Sbjct: 384 NYDLTSEPDQYLHRVGRAGRFGTKGLAISFVA 415

>KAFR0F02940 Chr6 (582057..583388) [1332 bp, 443 aa] {ON} Anc_2.384
           YDL084W
          Length = 443

 Score =  143 bits (361), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 105/410 (25%), Positives = 182/410 (44%), Gaps = 64/410 (15%)

Query: 127 HKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFIL 186
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 57  HSTG-FKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 115

Query: 187 PMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT-QLRSVLLTGGDSLEDQFG 245
             ++++     ++    V++  +RELA Q  N +  FSK    +++ +  GG        
Sbjct: 116 STLQQLDPVPGEVS--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPTSKDAE 173

Query: 246 MMMNN---PDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLF-EMGFQDQLNELLAS 301
           ++ N    P +++ATPGR   L  +  +DL  ++  V DE D++  E+  +  + E+  +
Sbjct: 174 ILKNKETAPHIVVATPGRLKALVRDKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRA 233

Query: 302 LPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFLSTKNDEREAN 360
            P ++Q ++FSATL   +    +  L NP+ + +D E+K++   L+  ++  +  E+   
Sbjct: 234 TPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRK 293

Query: 361 LLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 420
           L  LL D+            +FN                                     
Sbjct: 294 LAQLLDDL------------EFNQ------------------------------------ 305

Query: 421 QLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 480
                   I+FV +      +++LL  S +    ++G + Q  R  +   F+     I V
Sbjct: 306 -------VIIFVKSTARANELTKLLNASNFPAITVHGHMKQAERIARYKAFKDFEKRICV 358

Query: 481 VTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
            TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S VS
Sbjct: 359 STDVFGRGIDIERINLAINYDLSNEADQYLHRVGRAGRFGTKGLAISFVS 408

>NDAI0A01960 Chr1 complement(436462..438066) [1605 bp, 534 aa] {ON}
           Anc_7.336
          Length = 534

 Score =  145 bits (365), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 120/208 (57%), Gaps = 2/208 (0%)

Query: 128 KKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILP 187
           K  +F  F L + ++  I + GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 35  KGNTFEDFFLKRELLMGIFEAGFEKPSPIQEESIPIAITGRDILARAKNGTGKTAAFVIP 94

Query: 188 MIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            + +IK + +KI  +A+I+ P+RELA+QT  V +   K   +  ++ TGG +L D    +
Sbjct: 95  TLERIKPNLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 152

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
                V++ TPGR L L      DL      + DEAD++    F+  + ++L  LP   Q
Sbjct: 153 NETVHVLVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILIFLPKKHQ 212

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRL 335
           +LLFSAT P ++ +F    L NP  + L
Sbjct: 213 SLLFSATFPLTVKEFMVKHLNNPYEINL 240

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 60/102 (58%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+F  + + VE +++ + D GY   Y +  + Q  R R  + FR G    LV +D+  RG
Sbjct: 278 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 337

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           +DI  +  VINF  P +S+ ++HR+GR+ R G+ G A ++++
Sbjct: 338 IDIQAVNVVINFDFPKTSETYLHRIGRSGRFGHLGLAINLIN 379

>TDEL0C02100 Chr3 complement(362760..364199) [1440 bp, 479 aa] {ON}
           Anc_7.336 YDL160C
          Length = 479

 Score =  144 bits (362), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 121/211 (57%), Gaps = 2/211 (0%)

Query: 128 KKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILP 187
           K  SF  F L + ++  I + GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 29  KGNSFEDFYLKRELLMGIFEAGFEKPSPIQEESIPVAIAGRDILARAKNGTGKTAAFVIP 88

Query: 188 MIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            + K+K   +KI  +A+I+ P+RELA+QT  V +   K   +  ++ TGG +L+D    +
Sbjct: 89  ALEKVKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGVSCMVTTGGTNLKDDIMRL 146

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
                +++ TPGR L L      DL      + DEAD++    F+  + ++L  LP + Q
Sbjct: 147 NETVHILVGTPGRVLDLASRKLADLSECSLFIMDEADKMLSRDFKTIIEQILIFLPQSHQ 206

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAE 338
           +LLFSAT P ++ +F    L  P  + L  E
Sbjct: 207 SLLFSATFPLTVKEFMVKHLHKPYEINLMEE 237

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 60/102 (58%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+F  + + VE +++ + D GY   Y +  + Q  R R  + FR G    LV +D+  RG
Sbjct: 272 IIFCNSTNRVELLAKKITDLGYSCYYSHARMRQQERNRVFHEFRQGKVRTLVCSDLLTRG 331

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 332 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 373

>Smik_4.77 Chr4 complement(147172..148692) [1521 bp, 506 aa] {ON}
           YDL160C (REAL)
          Length = 506

 Score =  144 bits (363), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 121/211 (57%), Gaps = 2/211 (0%)

Query: 128 KKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILP 187
           K  +F  F L + ++  I + GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 44  KGNTFEDFYLRRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIP 103

Query: 188 MIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            + K+K   +KI  +A+I+ P+RELA+QT  V +   K   +  ++ TGG +L D    +
Sbjct: 104 TLEKVKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 161

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
                +++ TPGR L L      DL      + DEAD++    F+  + ++L+ LPS+ Q
Sbjct: 162 NETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPSSHQ 221

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAE 338
           +LLFSAT P ++ +F    L  P  + L  E
Sbjct: 222 SLLFSATFPLTVKEFMVKHLHKPYEINLMEE 252

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 75/145 (51%), Gaps = 6/145 (4%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+F  + + VE +++ + D GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 287 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 346

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKI 548
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++              G +I
Sbjct: 347 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEI 406

Query: 549 MLTPMYDSLCEIMKNKWIAEGNDES 573
              P       I K+ ++AE NDE+
Sbjct: 407 AAIP-----ATIDKSLYVAE-NDET 425

>Suva_16.191 Chr16 complement(333913..335769) [1857 bp, 618 aa] {ON}
           YPL119C (REAL)
          Length = 618

 Score =  145 bits (367), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 82/251 (32%), Positives = 139/251 (55%), Gaps = 17/251 (6%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F S  L  +++ NI   GF +PTP+Q+ ++P++  NRD++  A+TGSGKT  F+ P+  +
Sbjct: 154 FDSPPLDALLLENIKLAGFNKPTPVQKYSVPIVTNNRDLMACAQTGSGKTGGFLFPVFTE 213

Query: 192 I-------------KTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGD 238
           +               +S K    A++L+P+RELA Q     ++F+  + +R  ++ GG 
Sbjct: 214 LFHSGPSPAPEKAQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGA 273

Query: 239 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNEL 298
            + +Q   +    D+++ATPGR   L     + L +I+Y V DEADR+ +MGF+ Q+  +
Sbjct: 274 PIGNQMREVDRGCDLLVATPGRLNDLLERGKISLANIKYLVLDEADRMLDMGFEPQIRHI 333

Query: 299 L--ASLPS--NRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKN 354
           +    +PS  NRQTL+FSAT P  +   A+  L N + + +      SEN+    L   +
Sbjct: 334 VEECDMPSVGNRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDD 393

Query: 355 DEREANLLYLL 365
            ++++ LL LL
Sbjct: 394 MDKKSALLDLL 404

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 63/104 (60%)

Query: 425 EKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 484
           E  T++FV T+   + ++  L    +  + I+G   Q  R+R L  F++ +  ILV T V
Sbjct: 409 EGLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQAERERALSAFKSNVADILVATAV 468

Query: 485 AARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSI 528
           AARG+DIP + +VIN+ LP+    ++HR+GRT RAGN G A S 
Sbjct: 469 AARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSF 512

>KLLA0F01034g Chr6 (93422..95305) [1884 bp, 627 aa] {ON} similar to
           uniprot|P06634 Saccharomyces cerevisiae YOR204W DED1
           ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase
           required for translation initiation of all yeast mRNAs
          Length = 627

 Score =  146 bits (368), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 82/251 (32%), Positives = 143/251 (56%), Gaps = 17/251 (6%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F S  L  +++ NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ +
Sbjct: 161 FHSPPLDPLLLDNIKLARFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVLSE 220

Query: 192 I-------------KTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGD 238
                          ++  K+   AVIL+P+RELA Q ++  K+F+  + ++ +++ GG 
Sbjct: 221 SFSSGPASTPEAAGNSYIKKVYPTAVILAPTRELATQIYDEAKKFTYRSWVKPMVVYGGA 280

Query: 239 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNEL 298
           S+++Q   M    ++++ATPGR   L     + L +++Y V DEADR+ +MGF+ Q+  +
Sbjct: 281 SIDNQIKQMRYGCNLLVATPGRLTDLLERRYISLANVKYLVLDEADRMLDMGFEPQIRRI 340

Query: 299 L--ASLPS--NRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKN 354
           +  + +PS  NRQTL+FSAT PS +   A   L + V + +      SEN+    L  ++
Sbjct: 341 VEGSDMPSVDNRQTLMFSATFPSEIQHLASDFLKDYVFLSVGRVGSTSENITQKILYVED 400

Query: 355 DEREANLLYLL 365
            ++   LL LL
Sbjct: 401 FDKNDTLLDLL 411

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 64/102 (62%)

Query: 424 SEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 483
           +E  T++FV T+   + ++  L   G+  + I+G   Q  R+R L  F+TG  +ILV T 
Sbjct: 415 NEGLTLIFVETKRAADSLTDFLIMEGFKATAIHGDRTQGERERALSAFKTGRATILVATA 474

Query: 484 VAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWA 525
           VAARG+DIP + +VINF LP     ++HR+GRT RAGN G A
Sbjct: 475 VAARGLDIPNVTHVINFDLPNDIDDYVHRIGRTGRAGNTGVA 516

>TPHA0B02930 Chr2 (666924..668207) [1284 bp, 427 aa] {ON} Anc_6.148
           YBR237W
          Length = 427

 Score =  142 bits (358), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 78/245 (31%), Positives = 134/245 (54%), Gaps = 8/245 (3%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F   G    ++  +   GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 115 NFDEAGFPDYVLEEVKAEGFDKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 174

Query: 191 KIKTH---SSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            I      S   G   ++LSP+RELA+Q      +F + +++R+  + GG     Q   +
Sbjct: 175 HINAQPLLSPGDGPIVLVLSPTRELAVQIQKECSKFGQSSRIRNTCVYGGVPRGQQIRDL 234

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
           +   +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +  +RQ
Sbjct: 235 IRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 294

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVR-----LDAESKISENLEMLFLSTKNDEREANLL 362
           TL++SAT P  +   A+  L +P+ V+     L A   I++ +E++    K D    +L+
Sbjct: 295 TLMWSATWPKEVQQLARDYLNDPIQVQIGSLELSASHTITQLVEVVSDFEKRDRLNKHLV 354

Query: 363 YLLQD 367
              +D
Sbjct: 355 TASED 359

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 38/67 (56%)

Query: 425 EKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 484
           E   ++F  T+   + I++ L++ G+    I+G  DQ  R   L  FR G + I+V TDV
Sbjct: 361 ESKILIFASTKRTCDEITKYLREDGWPALAIHGDKDQRERDWVLQEFRDGRSPIMVATDV 420

Query: 485 AARGVDI 491
           AARG+ +
Sbjct: 421 AARGIGM 427

>KAFR0G00650 Chr7 complement(164087..165274) [1188 bp, 395 aa] {ON}
           Anc_1.211 YJL138C
          Length = 395

 Score =  141 bits (355), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 103/397 (25%), Positives = 185/397 (46%), Gaps = 62/397 (15%)

Query: 120 TNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 179
           TN +K  +   +F    L + ++  +   GF  P+ IQ++ I  I+++ D++  A++G+G
Sbjct: 15  TNYDKVVY---TFDDMNLDEKLLRGVYGYGFENPSAIQQRAIMPIIESHDVLAQAQSGTG 71

Query: 180 KTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDS 239
           KT  F +  +++I T  S    +A++L+P+RELA+Q   V    S    ++     GG S
Sbjct: 72  KTGTFSIAALQRIDT--SIKAPQALMLAPTRELALQIQKVVMALSFHMDVKVHACIGGTS 129

Query: 240 -LEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNEL 298
            +ED  G+   +  +++ TPGR             +I+  + DEAD +   GF++Q+ ++
Sbjct: 130 FVEDAEGL--RDAQIVVGTPGRVFDNIQRRKFKTDNIKMFILDEADEMLSSGFKEQIYQI 187

Query: 299 LASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDERE 358
              LP   Q +L SAT+PS +++     + NPV + +  +    E ++  +++ +     
Sbjct: 188 FTMLPPTTQVVLLSATMPSDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVE----- 242

Query: 359 ANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPP 418
                             E+Q K+                               E L  
Sbjct: 243 ------------------EEQYKY-------------------------------ECLTD 253

Query: 419 ANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSI 478
                S    ++F  TR  VE ++Q L    + +S IY  L Q  R   +  FR+G + I
Sbjct: 254 LYDSISVTQAVIFCNTRRKVEELTQKLTADNFTVSSIYSDLPQQERDTIMKEFRSGSSRI 313

Query: 479 LVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGR 515
           L+ TD+ ARG+D+  ++ VIN+ LP + + +IHR+GR
Sbjct: 314 LISTDLLARGIDVQQVSLVINYDLPTNKENYIHRIGR 350

>SAKL0H20218g Chr8 (1770946..1772670) [1725 bp, 574 aa] {ON} similar
           to uniprot|P45818 Saccharomyces cerevisiae YGL171W ROK1
           ATP-dependent RNA helicase of the DEAD box family
           required for 18S rRNA synthesis
          Length = 574

 Score =  145 bits (365), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 111/397 (27%), Positives = 191/397 (48%), Gaps = 71/397 (17%)

Query: 130 GSFPS----FGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           GSF      F   K ++ N+ +  F +PTPIQ + IP+ L  RDI+  A TGSGKT AF+
Sbjct: 125 GSFEDLITRFQFDKRLLNNLIENNFTEPTPIQCEGIPMTLNERDILACAPTGSGKTLAFL 184

Query: 186 LPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQ---------LRSVLLTG 236
           +P++++I    SK   + +I+SP++ELA Q   +F E SK            L+  LL+ 
Sbjct: 185 IPLLQQIIKDKSKPSLKGLIVSPTKELANQ---IFLECSKLANRIFLDKKRPLQVALLSK 241

Query: 237 GDSLEDQFGMMMNNP-DVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQL 295
             S + +  ++ +   D+II+TP R + +    SL+L S+++ VFDEAD+LF+  F +Q 
Sbjct: 242 SLSAKLKNKVISDKKYDIIISTPLRLIDIVKSESLNLNSVKHLVFDEADKLFDKTFLEQT 301

Query: 296 NELLA-SLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKN 354
           +++L+     N    +FSAT+PS++ + AK+ + +PV + +  +   + ++E   +   N
Sbjct: 302 DDILSLCTDPNLHKSMFSATIPSNVEEIAKSIMMDPVRIIIGHKEAANASIEQKLVFCGN 361

Query: 355 DEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXE 414
           +  E  L+ + Q +         QQ +F                                
Sbjct: 362 E--EGKLIAIRQLI---------QQGEFR------------------------------- 379

Query: 415 RLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTG 474
             PP          I+F+ +    + +   L      +  I+    Q  R + +  F+ G
Sbjct: 380 --PPV---------IIFLESITRAKALFHELLYDKLNVDVIHAERTQVQRSKIIERFKKG 428

Query: 475 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIH 511
               L+ TDV ARGVD   +  VIN+ +P S++ ++H
Sbjct: 429 ELWCLICTDVLARGVDFKGVNLVINYDVPRSAQAYVH 465

>Smik_6.318 Chr6 (498013..499854) [1842 bp, 613 aa] {ON} YPL119C
           (REAL)
          Length = 613

 Score =  145 bits (366), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 84/251 (33%), Positives = 141/251 (56%), Gaps = 17/251 (6%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F S  L  +++ NI   GF +PTP+Q+ +IP++ + RD++  A+TGSGKT  F+ P+  +
Sbjct: 152 FGSPPLDALLMENIKLAGFNKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTE 211

Query: 192 I----------KT---HSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGD 238
           +          KT   +S K    A++L+P+RELA Q     ++F+  + +R  ++ GG 
Sbjct: 212 LFRFGPSPVPEKTQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGA 271

Query: 239 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNEL 298
            + +Q   +    D+++ATPGR   L     + L +I+Y V DEADR+ +MGF+ Q+  +
Sbjct: 272 PIGNQMREVDRGCDLLVATPGRLNDLLERGKISLANIKYLVLDEADRMLDMGFEPQIRHI 331

Query: 299 L--ASLPS--NRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKN 354
           +    +PS  NRQTL+FSAT P  +   A+  L N + + +      SEN+    L   +
Sbjct: 332 VEGCDMPSVGNRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDD 391

Query: 355 DEREANLLYLL 365
            ++++ LL LL
Sbjct: 392 LDKKSALLDLL 402

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 63/101 (62%)

Query: 428 TILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 487
           T++FV T+   + ++  L    +  + I+G   Q  R+R L+ F+T +  ILV T VAAR
Sbjct: 410 TLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALFAFKTNVADILVATAVAAR 469

Query: 488 GVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSI 528
           G+DIP + +VIN+ LP+    ++HR+GRT RAGN G A S 
Sbjct: 470 GLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVASSF 510

>TDEL0F01090 Chr6 (196968..198623) [1656 bp, 551 aa] {ON} Anc_8.124
           YGL171W
          Length = 551

 Score =  144 bits (363), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 113/401 (28%), Positives = 195/401 (48%), Gaps = 78/401 (19%)

Query: 130 GSFPS----FGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           GSF      F   K ++ N+ +  F +PTPIQ + IPL L NRDIV  A TGSGKT AF+
Sbjct: 111 GSFEDLITRFQFDKRLLNNLIENHFTEPTPIQSEGIPLALNNRDIVACAPTGSGKTLAFL 170

Query: 186 LPMIRKIKTHSSKI-GARAVILSPSRELAMQTHNVFKEFSKGTQ---------LRSVLLT 235
           +P+++ I +      G + +I+SP++ELA Q   +F E SK  Q         L+  LL+
Sbjct: 171 IPLLQLIISDGKDSNGLKGLIISPTKELANQ---IFIECSKLAQKVFLDRKRPLQVALLS 227

Query: 236 GGDSLEDQF---GMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQ 292
              SL  +     +     D+++ TP R + +    +LDL  +++ +FDEAD+LF+  F 
Sbjct: 228 K--SLNAKLKNKAVSDKKYDILVTTPLRLIDVVKNEALDLSGVKHIIFDEADKLFDKTFV 285

Query: 293 DQLNELLASL--PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFL 350
           +Q +++L+S   P  R++ +FSAT+PS++ + A + + +PV V +  +   + N++   +
Sbjct: 286 EQTDDILSSCNNPKLRKS-MFSATIPSNVEEIANSIMMDPVRVIIGHKDAANANIKQDVI 344

Query: 351 STKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXX 410
              N+  E  L+ + Q V         Q+ +F                            
Sbjct: 345 YCGNE--EGKLIAIRQLV---------QEGEFR--------------------------- 366

Query: 411 XXXERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYN 470
                 PP          I+F+ +    + +   L   G  +  I+    Q  R++ + +
Sbjct: 367 ------PP---------VIIFLESITRAKALYHELMYDGLNVDVIHAERTQIQREKIIES 411

Query: 471 FRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIH 511
           F++G    L+ TDV ARGVD   +  VIN+ +P +++ ++H
Sbjct: 412 FKSGELWCLICTDVLARGVDFKGVNLVINYDVPRTAQAYVH 452

>KNAG0H01520 Chr8 complement(267709..269574) [1866 bp, 621 aa] {ON}
           Anc_8.614 YOR204W
          Length = 621

 Score =  145 bits (366), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 80/253 (31%), Positives = 139/253 (54%), Gaps = 19/253 (7%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F S  L +++  N+ + GF +PTP+Q+ +IP++   RD++G A+TGSGKT  F+ P++ +
Sbjct: 138 FTSPPLEQLLFDNVQRAGFSKPTPVQKYSIPIVTAGRDLMGCAQTGSGKTGGFLFPILSE 197

Query: 192 IKT---------------HSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTG 236
           + T               +  K+   A++L+P+RELA Q     ++F+  + +R  ++ G
Sbjct: 198 MFTAGPAPKPQAASGGYSYQRKVYPTALVLAPTRELATQIFEEARKFTYRSWVRPCVVYG 257

Query: 237 GDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLN 296
           G  +  Q G +    D+++ATPGR   L     + L +I+Y   DEADR+ +MGF+ Q+ 
Sbjct: 258 GAPVGAQMGELERGCDLLVATPGRLNDLLERGKISLANIKYLTLDEADRMLDMGFEPQIR 317

Query: 297 ELLASL---PSN-RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLST 352
            ++      P N RQTL+FSAT P  +   A+  L + + + +      SEN+    L  
Sbjct: 318 HIVEDCDMPPVNERQTLMFSATFPRDIQHLARDFLNDYIFLSVGRVGSTSENITQKVLYV 377

Query: 353 KNDEREANLLYLL 365
            + ++++ LL LL
Sbjct: 378 DDMDKKSALLDLL 390

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 59/101 (58%)

Query: 428 TILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 487
           T++FV T+   + ++  L       + I+G   Q  R+R L  F++G   +LV T VAAR
Sbjct: 398 TLIFVETKRMADQLTDFLIMQNIRATAIHGDRTQMERERALGAFKSGTADVLVATAVAAR 457

Query: 488 GVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSI 528
           G+DIP +  VIN+ LP     ++HR+GRT RAGN G A S 
Sbjct: 458 GLDIPNVTLVINYDLPGDIDDYVHRIGRTGRAGNTGTAISF 498

>TPHA0D04520 Chr4 (985683..987191) [1509 bp, 502 aa] {ON} Anc_7.336
           YDL160C
          Length = 502

 Score =  143 bits (361), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 120/208 (57%), Gaps = 2/208 (0%)

Query: 128 KKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILP 187
           K  +F  F L + ++  I + GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 30  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEESIPVAIAGRDILARAKNGTGKTAAFVIP 89

Query: 188 MIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            + K+K+  +KI  +A+I+ P+RELA+QT  V +   K  ++  ++ TGG +L D    +
Sbjct: 90  TLEKVKSKINKI--QALIMVPTRELALQTSQVVRTLGKRCEISCMVTTGGTNLRDDIIRL 147

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
                +++ TPGR L L      DL      + DEAD++    F+  + ++L  LP   Q
Sbjct: 148 NETVHILVGTPGRVLDLASRGIADLSGCGLFIMDEADKMLSRDFKSIIEQILTFLPEQHQ 207

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRL 335
           +LLFSAT P ++ +F    L  P  + L
Sbjct: 208 SLLFSATFPLTVKEFMVKHLHKPYEINL 235

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 60/102 (58%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+F  + + VE +++ + D G+   Y +  + Q  R R  + FR G    LV +D+  RG
Sbjct: 273 IIFCNSTNRVELLAKKITDLGFSCYYSHARMKQQERNRVFHEFRHGKVRTLVCSDLLTRG 332

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 333 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 374

>KLLA0C16599g Chr3 (1453655..1455199) [1545 bp, 514 aa] {ON} similar
           to uniprot|P39517 Saccharomyces cerevisiae YDL160C DHH1
           Cytoplasmic DExD/H-box helicase stimulates mRNA
           decapping coordinates distinct steps in mRNA function
           and decay interacts with both the decapping and
           deadenylase complexes may have a role in mRNA export and
           translation
          Length = 514

 Score =  143 bits (361), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 118/204 (57%), Gaps = 4/204 (1%)

Query: 128 KKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILP 187
           K  SF  F L + ++  I + GF +P+PIQ + IP+ +  +DI+  A+ G+GKTAAF++P
Sbjct: 34  KGRSFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAIAGKDILARAKNGTGKTAAFVIP 93

Query: 188 MIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            + K+K   +KI  +A+I+ P+RELA+QT  V +   K   +  ++ TGG +L D   M 
Sbjct: 94  TLEKVKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDI-MR 150

Query: 248 MNNP-DVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNR 306
           +N P  +++ TPGR L L      DL      + DEAD++    F+    ++L  LP  R
Sbjct: 151 LNEPVHILVGTPGRVLDLASRRVTDLSECHLFIMDEADKMLSRDFKVLAEQILGFLPERR 210

Query: 307 QTLLFSATLPSSLVDFAKAGLTNP 330
           Q LLFSAT P ++ +F    L NP
Sbjct: 211 QLLLFSATFPVTVKEFMVKHLKNP 234

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 60/102 (58%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+F  + + VE +++ + + G+   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 277 IIFCNSTNRVELLAKKITELGFSCYYSHARMKQSERNKVFHEFRQGKVRTLVCSDLLTRG 336

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 337 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 378

>TBLA0F02360 Chr6 (582109..583866) [1758 bp, 585 aa] {ON} Anc_7.336
           YDL160C
          Length = 585

 Score =  144 bits (364), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 121/211 (57%), Gaps = 2/211 (0%)

Query: 128 KKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILP 187
           K  SF  F L + ++  I + GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 35  KGNSFEDFYLKRELLMGIFEAGFEKPSPIQEESIPIAIAGRDILARAKNGTGKTAAFVIP 94

Query: 188 MIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            + K+K   +KI  +A+I+ P+RELA+QT  V +   K   +  ++ TGG +L D    +
Sbjct: 95  TLEKVKPKINKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDIMRL 152

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
                V++ TPGR L L      DL      + DEAD++    F+  + ++L  LP + Q
Sbjct: 153 NETIHVLVGTPGRVLDLASRKVADLSECSLFIMDEADKMLSRDFKTIIEQILIFLPKHHQ 212

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAE 338
           +LLFSAT P ++ +F    LT P  + L  E
Sbjct: 213 SLLFSATFPLTVKEFMVKHLTKPYEINLMDE 243

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 60/102 (58%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+F  + + VE +++ + D GY   Y +  + Q  R R  + FR G    LV +D+  RG
Sbjct: 278 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 337

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 338 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 379

>NDAI0B02410 Chr2 complement(602541..604256) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  144 bits (362), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 112/402 (27%), Positives = 198/402 (49%), Gaps = 73/402 (18%)

Query: 130 GSFPS----FGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           GSF      F   K ++TN+ +  F +PTPIQ ++IPL L +RDIV  A TGSGKT AF+
Sbjct: 131 GSFEDLITRFSFDKRLLTNLIENHFTEPTPIQCESIPLALNSRDIVACAPTGSGKTLAFL 190

Query: 186 LPMIRKIKTHSSKIGARAVILSPSRELAMQ--------THNVFKEFSKGTQLRSVLLTGG 237
           +P++++I      +G + +I+SP++ELA Q        ++ +F    K   L+  LL+  
Sbjct: 191 IPLLQQIINDKETLGLKGLIISPTKELANQIFIECIKLSNKIF--LDKKRPLQIALLSK- 247

Query: 238 DSLEDQFGMMMNNP---DVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQ 294
            SL  +    + N    D+II+TP R + +    +LDL  +++ +FDEAD+LF+  F +Q
Sbjct: 248 -SLSAKLKNKVINEKKYDIIISTPLRLIDVVKNEALDLSKVKHLIFDEADKLFDKTFVEQ 306

Query: 295 LNELLASLPSNR-QTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTK 353
            +++L+S   N  +  +FSAT+PS++ + A + + +P+ V +  +   + N+E   +   
Sbjct: 307 TDDILSSCTDNSLRKAMFSATIPSNVEEIANSIMLDPIRVIIGHKEAANMNIEQKLVFCG 366

Query: 354 NDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXX 413
           N+  E  L+ + Q V         Q+ +F                               
Sbjct: 367 NE--EGKLIAIRQLV---------QEGEFK------------------------------ 385

Query: 414 ERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRT 473
              PP          I+F+ +    + +   L      +  I+       R++ +  F++
Sbjct: 386 ---PP---------IIIFLESITRAKALYHELMYDRMNVDVIHAERTALQREKIIERFKS 433

Query: 474 GLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGR 515
           G    L+ TDV ARG+D   +  VIN+ +P +++ ++HR+GR
Sbjct: 434 GDLWCLICTDVLARGIDFKGVNLVINYDVPRTAQAYVHRIGR 475

>SAKL0G01496g Chr7 (125044..125050,125133..126568) [1443 bp, 480 aa]
           {ON} similar to uniprot|P20449 Saccharomyces cerevisiae
           YOR046C DBP5 Cytoplasmic ATP-dependent RNA helicase of
           the DEAD-box family involved in mRNA export from the
           nucleus
          Length = 480

 Score =  142 bits (358), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 106/389 (27%), Positives = 182/389 (46%), Gaps = 69/389 (17%)

Query: 150 FRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGARAVILS 207
           F++P+ IQ + +PL+L N  R+++  +++G+GKTAAF L M+ ++    +K   +A+ L+
Sbjct: 111 FQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLSRVDPALNK--TQAICLA 168

Query: 208 PSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVE 267
           P+RELA QT  V +E  K T++ + L+   DS +    +   N  +I+ TPG  L L   
Sbjct: 169 PARELARQTLEVIQEMGKFTKISTQLVV-PDSFKKNEPI---NAQIIVGTPGTVLDLMRR 224

Query: 268 MSLDLKSIEYAVFDEADRLFE-MGFQDQLNELLASLPSNRQTLLFSATLPSSLVDFAKAG 326
             L L +++  V DEAD + +  G  DQ   +   LP + Q +LFSAT   S+  +A+  
Sbjct: 225 KMLQLGNVKVFVLDEADNMLDKQGLGDQCIRVKKFLPKSTQLVLFSATFDDSVRAYARKV 284

Query: 327 LTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDVIKIPLATKEQQRKFNDQX 386
           + +   + L       E ++ L++   +++ +  +L  L  ++ I  +    Q K     
Sbjct: 285 VPDANSLELQKNEVNVEAIKQLYMDCNDEKHKFEVLSELYGLLTIGSSIIFVQTK----- 339

Query: 387 XXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKATILFVPTRHHVEYISQLLK 446
                                                 + A +L+   +     +S L  
Sbjct: 340 --------------------------------------QTANVLYAKLKQEGHQVSIL-- 359

Query: 447 DSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLP--- 503
                    +G L    R R + +FR G + +L+ T+V ARG+DIP ++ V+N+ LP   
Sbjct: 360 ---------HGDLQSTERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLH 410

Query: 504 ---ASSKIFIHRVGRTARAGNRGWAYSIV 529
              A    +IHR+GRT R G  G A S +
Sbjct: 411 NGKADPSTYIHRIGRTGRFGRTGVAISFI 439

>CAGL0I03476g Chr9 complement(294849..296372) [1524 bp, 507 aa] {ON}
           highly similar to uniprot|P39517 Saccharomyces
           cerevisiae YDL160c DHH1
          Length = 507

 Score =  142 bits (358), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 118/211 (55%), Gaps = 2/211 (0%)

Query: 128 KKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILP 187
           K  SF  F L + ++  I + GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 29  KGNSFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIP 88

Query: 188 MIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            + KIK   +KI  +A+I+ P+RELA+QT  V +   +   +  ++ TGG +L D    +
Sbjct: 89  TLEKIKPKLNKI--QALIMVPTRELALQTSQVIRTLGRHCGVSCMVTTGGTNLRDDILRL 146

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
                V++ TPGR L L      DL      V DEAD++    F+  + ++L  LP   Q
Sbjct: 147 NETVHVLVGTPGRVLDLASRKVADLSECSLFVMDEADKMLSRDFKTIIEQVLTFLPKAHQ 206

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAE 338
           +LLFSAT P ++ +F    L  P  + L  E
Sbjct: 207 SLLFSATFPLTVKEFMVKHLHKPYEINLMEE 237

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 61/102 (59%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+F  + + VE +++ + D GY   Y +  + Q  R +  ++FR G    LV +D+  RG
Sbjct: 272 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQDRNKVFHDFRQGKVRTLVCSDLLTRG 331

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 332 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 373

>Suva_4.86 Chr4 complement(158173..159699) [1527 bp, 508 aa] {ON}
           YDL160C (REAL)
          Length = 508

 Score =  142 bits (358), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 119/211 (56%), Gaps = 2/211 (0%)

Query: 128 KKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILP 187
           K  +F  F L + ++  I + GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 44  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIP 103

Query: 188 MIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            + K+K   +KI  +A+I+ P+RELA+QT  V +   K   +  ++ TGG +L D    +
Sbjct: 104 TLEKVKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 161

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
                V++ TPGR L L      DL      + DEAD++    F+  + ++L+ LP   Q
Sbjct: 162 NETVHVLVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQ 221

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAE 338
           +LLFSAT P ++ +F    L  P  + L  E
Sbjct: 222 SLLFSATFPLTVKEFMVKHLHKPYEINLMEE 252

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 75/145 (51%), Gaps = 6/145 (4%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+F  + + VE +++ + D GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 287 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 346

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKI 548
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++              G +I
Sbjct: 347 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEI 406

Query: 549 MLTPMYDSLCEIMKNKWIAEGNDES 573
              P       I K+ ++AE +DE+
Sbjct: 407 AAIP-----ATIDKSLYVAE-DDET 425

>Skud_4.96 Chr4 complement(166027..167550) [1524 bp, 507 aa] {ON}
           YDL160C (REAL)
          Length = 507

 Score =  142 bits (358), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 73/211 (34%), Positives = 120/211 (56%), Gaps = 2/211 (0%)

Query: 128 KKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILP 187
           K  +F  F L + ++  I + GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 44  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIP 103

Query: 188 MIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            + ++K   +KI  +A+I+ P+RELA+QT  V +   K   +  ++ TGG +L D    +
Sbjct: 104 TLERVKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 161

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
                +++ TPGR L L      DL      + DEAD++    F+  + ++L+ LP+  Q
Sbjct: 162 NETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPTTHQ 221

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAE 338
           +LLFSAT P ++ +F    L  P  + L  E
Sbjct: 222 SLLFSATFPLTVKEFMVKHLHKPYEINLMEE 252

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 75/145 (51%), Gaps = 6/145 (4%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+F  + + VE +++ + D GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 287 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 346

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKI 548
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++              G +I
Sbjct: 347 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEI 406

Query: 549 MLTPMYDSLCEIMKNKWIAEGNDES 573
              P       I K+ ++AE NDE+
Sbjct: 407 AAIP-----ATIDKSLYVAE-NDET 425

>Skud_16.161 Chr16 complement(295968..297827) [1860 bp, 619 aa] {ON}
           YPL119C (REAL)
          Length = 619

 Score =  144 bits (363), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 84/251 (33%), Positives = 141/251 (56%), Gaps = 17/251 (6%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F S  L  +++ NI   GF +PTP+Q+ +IP++ + RD++  A+TGSGKT  F+ P+  +
Sbjct: 156 FNSPPLDALLMENIKLAGFNKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTE 215

Query: 192 I----------KTHS--SKIG-ARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGD 238
           +          K HS  S+ G   A++L+P+RELA Q     ++F+  + +R  ++ GG 
Sbjct: 216 LFQIGPSSVPEKAHSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGA 275

Query: 239 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNEL 298
            + +Q   +    D+++ATPGR   L     + L + +Y V DEADR+ +MGF+ Q+  +
Sbjct: 276 PIGNQMREVDRGCDLLVATPGRLNDLLERGKISLANTKYLVLDEADRMLDMGFEPQIRHI 335

Query: 299 L--ASLPS--NRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKN 354
           +    +PS  NRQTL+FSAT P  +   A+  L N + + +      SEN+    L   +
Sbjct: 336 VEECDMPSVGNRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDD 395

Query: 355 DEREANLLYLL 365
            ++++ LL LL
Sbjct: 396 MDKKSALLDLL 406

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 61/101 (60%)

Query: 428 TILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 487
           T++FV T+   + ++  L    +  + I+G   Q  R+R L  F+  +  ILV T VAAR
Sbjct: 414 TLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANIADILVATAVAAR 473

Query: 488 GVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSI 528
           G+DIP + +VIN+ LP+    ++HR+GRT RAGN G A S 
Sbjct: 474 GLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSF 514

>YDL160C Chr4 complement(170410..171930) [1521 bp, 506 aa] {ON}
           DHH1Cytoplasmic DExD/H-box helicase, stimulates mRNA
           decapping; coordinates distinct steps in mRNA function
           and decay, interacts with both the decapping and
           deadenylase complexes, may have a role in mRNA export
           and translation; C-terminus of Dhh1p interacts with
           Ngr1p and promotes POR1, but not EDC1 mRNA decay
          Length = 506

 Score =  142 bits (358), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 119/211 (56%), Gaps = 2/211 (0%)

Query: 128 KKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILP 187
           K  +F  F L + ++  I + GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 44  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIP 103

Query: 188 MIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            + K+K   +KI  +A+I+ P+RELA+QT  V +   K   +  ++ TGG +L D    +
Sbjct: 104 TLEKVKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 161

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
                +++ TPGR L L      DL      + DEAD++    F+  + ++L+ LP   Q
Sbjct: 162 NETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQ 221

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAE 338
           +LLFSAT P ++ +F    L  P  + L  E
Sbjct: 222 SLLFSATFPLTVKEFMVKHLHKPYEINLMEE 252

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 75/145 (51%), Gaps = 6/145 (4%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+F  + + VE +++ + D GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 287 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 346

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKI 548
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++              G +I
Sbjct: 347 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEI 406

Query: 549 MLTPMYDSLCEIMKNKWIAEGNDES 573
              P       I K+ ++AE NDE+
Sbjct: 407 AAIP-----ATIDKSLYVAE-NDET 425

>Ecym_4775 Chr4 (1507889..1509391) [1503 bp, 500 aa] {ON} similar to
           Ashbya gossypii AGR333C
          Length = 500

 Score =  142 bits (358), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 85/244 (34%), Positives = 142/244 (58%), Gaps = 11/244 (4%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F   GLSK  +  I K GF   T +Q KTIP ++  RD++G A+TGSGKT AF++P I  
Sbjct: 38  FDELGLSKQTLKAIEKMGFTTMTQVQAKTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIEM 97

Query: 192 IKTHSSKI----GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
           +  HS K     G   ++++P+RELA+Q   V +E  +       ++ GG +   +   +
Sbjct: 98  L--HSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKL 155

Query: 248 MNNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-N 305
               ++IIATPGR L HL+       K+++  + DEADR+ E+GF+D++ +++  LP+ +
Sbjct: 156 SKGVNLIIATPGRLLDHLQNTKGFIFKNLKALIIDEADRILEIGFEDEMKQIIKILPNED 215

Query: 306 RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAESKIS--ENLEMLFLSTKNDEREANLL 362
           RQ++LFSAT  + + D A+  L   P+ + +D+E + S  + LE  ++  ++D+R   L 
Sbjct: 216 RQSMLFSATQTTKVEDLARISLRPGPLFINVDSEKETSTVDGLEQGYVVCESDKRFLLLF 275

Query: 363 YLLQ 366
             L+
Sbjct: 276 TFLK 279

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 57/104 (54%), Gaps = 1/104 (0%)

Query: 426 KATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 485
           K  I+F+ + + V Y ++LL      +  ++G   Q  R    + F      ILV TDVA
Sbjct: 284 KKIIVFLSSCNSVRYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAQRGILVCTDVA 343

Query: 486 ARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           ARG+DIP +  +I F  P   + +IHRVGRTAR G +G   S++
Sbjct: 344 ARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 386

>Smik_4.442 Chr4 complement(801552..803549) [1998 bp, 665 aa] {ON}
           YDR194C (REAL)
          Length = 665

 Score =  144 bits (364), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 118/415 (28%), Positives = 187/415 (45%), Gaps = 67/415 (16%)

Query: 137 LSKIIVTNITKRGFRQPTPIQRKTIPLIL--QNRDIVGMARTGSGKTAAFILPMIRKIKT 194
           L K I   IT+  F   TP+Q+KTI  IL  ++ D++  A+TG+GKT AF++P+ + +  
Sbjct: 113 LDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLMN 172

Query: 195 --HSSKIGARAVILSPSRELAMQTHNVFKEFSKGT----QLRSVLLTGGDSLEDQFGMMM 248
               S+   +AVI++P+R+LA+Q  +  K+         +   V L GG         M 
Sbjct: 173 TKFDSQYMVKAVIVAPTRDLALQIESEVKKIHDMNYGLKKYGCVSLVGGTDFRAAMNKMN 232

Query: 249 N-NPDVIIATPGRFLHLKVEMSLDL-KSIEYAVFDEADRLFEMGFQDQ-------LNELL 299
              P+++IATPGR + +  + S    + ++Y V DEADRL E+GF+D        LNE  
Sbjct: 233 KLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKN 292

Query: 300 ASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFLSTKNDERE 358
           +    N +TLLFSATL   +   A   +     + LD   K   E  E +  S    E+ 
Sbjct: 293 SKSVDNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKF 352

Query: 359 ANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPP 418
           AN ++   + IK  +  +E   K                                     
Sbjct: 353 ANSIFAAVEHIKKQIKERESNYK------------------------------------- 375

Query: 419 ANQLPSEKATILFVPTRHHVEYISQLLKDS---GYLISYIYGTLDQHARKRQLYNFRTGL 475
                     I+F PT     ++  +L++       I   +G + Q+ R   +  F+   
Sbjct: 376 ---------AIIFAPTVKFTSFLCNILQNEFKKDLPILEFHGKITQNKRTSLVKRFKKDE 426

Query: 476 TSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           + ILV TDV ARG+D P +  V+   +P+    +IHR+GRTAR+G  G +   + 
Sbjct: 427 SGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFIC 481

>ZYRO0F11440g Chr6 (939613..941184) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q75BS4 Ashbya gossypii ACR197W DHH1
           ATP-dependent RNA helicase DHH1 and similar to YDL160C
           uniprot|P39517 Saccharomyces cerevisiae YDL160C DHH1
           Cytoplasmic DExD/H-box helicase stimulates mRNA
           decapping coordinates distinct steps in mRNA function
           and decay interacts with both the decapping and
           deadenylase complexes may have a role in mRNA export and
           translation
          Length = 523

 Score =  142 bits (358), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 119/211 (56%), Gaps = 2/211 (0%)

Query: 128 KKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILP 187
           K  +F  F L + ++  I + GF +P+PIQ ++IP+ L  RDI+  A+ G+GKTAAF++P
Sbjct: 28  KGNTFEDFFLKRELLMGIFEAGFEKPSPIQEESIPVALAGRDILARAKNGTGKTAAFVIP 87

Query: 188 MIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            + K+K   +KI  +A+I+ P+RELA+QT  V +   K   +  ++ TGG +L D    +
Sbjct: 88  TLEKVKPKINKI--QALIMVPTRELALQTSQVVRTLGKHCGVSCMVTTGGTNLRDDILRL 145

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
                V++ TPGR L L      DL      V DEAD++    F+  + ++L  LP   Q
Sbjct: 146 NETVHVLVGTPGRVLDLASRKVADLSECSLFVMDEADKMLSRDFKTIIEQILIFLPPQHQ 205

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAE 338
           +LLFSAT P ++ +F    L  P  + L  E
Sbjct: 206 SLLFSATFPITVKEFMVKHLHKPYEINLMEE 236

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 75/150 (50%), Gaps = 7/150 (4%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+F  + + VE +++ + D GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 271 IIFCNSTNRVELLAKKITDLGYSCYYSHARMRQQERNKVFHEFRQGKVRTLVCSDLLTRG 330

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKI 548
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++              G +I
Sbjct: 331 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEI 390

Query: 549 MLTPMYDSLCEIMKNKWIAEGNDESSFVNP 578
              P       I K+ ++AE  D S+   P
Sbjct: 391 AAIP-----ATIDKSLYVAE--DVSTVPTP 413

>YDR194C Chr4 complement(845952..847946) [1995 bp, 664 aa] {ON}
           MSS116DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns; non-polar RNA
           helicase that also facilities strand annealing
          Length = 664

 Score =  144 bits (363), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 118/408 (28%), Positives = 184/408 (45%), Gaps = 67/408 (16%)

Query: 137 LSKIIVTNITKRGFRQPTPIQRKTIPLIL--QNRDIVGMARTGSGKTAAFILPMIRKI-- 192
           L K I   IT+  F   TP+Q+KTI  IL  ++ D++  A+TG+GKT AF++P+ + +  
Sbjct: 113 LDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLIN 172

Query: 193 KTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGT----QLRSVLLTGGDSLEDQFGMMM 248
               S+   +AVI++P+R+LA+Q     K+         +   V L GG         M 
Sbjct: 173 TKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMN 232

Query: 249 N-NPDVIIATPGRFLHLKVEMSLDL-KSIEYAVFDEADRLFEMGFQDQ-------LNELL 299
              P+++IATPGR + +  + S    + ++Y V DEADRL E+GF+D        LNE  
Sbjct: 233 KLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKN 292

Query: 300 ASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFLSTKNDERE 358
           +    N +TLLFSATL   +   A   +     + LD   K   E  E +  S    E+ 
Sbjct: 293 SKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKF 352

Query: 359 ANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPP 418
           AN ++   + IK  +  ++   K                                     
Sbjct: 353 ANSIFAAVEHIKKQIKERDSNYK------------------------------------- 375

Query: 419 ANQLPSEKATILFVPTRHHVEYISQLLKDS---GYLISYIYGTLDQHARKRQLYNFRTGL 475
                     I+F PT     ++  +LK+       I   +G + Q+ R   +  F+   
Sbjct: 376 ---------AIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDE 426

Query: 476 TSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRG 523
           + ILV TDV ARG+D P +  V+   +P+    +IHR+GRTAR+G  G
Sbjct: 427 SGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEG 474

>KNAG0I02050 Chr9 complement(399547..399554,399758..401021) [1272
           bp, 423 aa] {ON} Anc_2.164 YNL112W
          Length = 423

 Score =  140 bits (352), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 74/226 (32%), Positives = 126/226 (55%), Gaps = 8/226 (3%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F   G    ++T +   GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 111 TFDEAGFPDYVLTEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 170

Query: 191 KIKTHS---SKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            I   +      G   ++L+P+RELA+Q      +F   +++R+  + GG     Q   +
Sbjct: 171 HINAQALLQPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDL 230

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +  +RQ
Sbjct: 231 NRGSEIVIATPGRLIDMLELGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 290

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVR-----LDAESKISENLEML 348
           TL++SAT P  +   A   L++P+ V+     L A   I++ +E++
Sbjct: 291 TLMWSATWPKEVKQLAADYLSDPIQVQIGSLELAASHTITQRVEVV 336

 Score = 54.7 bits (130), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (59%), Gaps = 1/72 (1%)

Query: 419 ANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSI 478
           A+Q P  K  ++F  T+   + I++ L++ G+    I+G  DQ  R   L  FRTG + I
Sbjct: 352 ASQNPESK-ILVFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLNEFRTGRSPI 410

Query: 479 LVVTDVAARGVD 490
           +V TDVAARG+D
Sbjct: 411 MVATDVAARGID 422

>TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 540
           aa] {ON} Anc_2.164 YNL112W
          Length = 540

 Score =  142 bits (358), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 80/245 (32%), Positives = 132/245 (53%), Gaps = 8/245 (3%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F   G    ++  +   GF  PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 114 NFDEAGFPDYVLNEVKAEGFANPTAIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 173

Query: 191 KIKTH---SSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            I      +   G   ++LSP+RELA+Q      +F K +++R+  + GG     Q   +
Sbjct: 174 HINAQPLLAPGDGPIVLVLSPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPKGQQIRDL 233

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +  +RQ
Sbjct: 234 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVR-----LDAESKISENLEMLFLSTKNDEREANLL 362
           TL++SAT P  + + A+  L +P+ V+     L A   I++ +E++    K D    +L 
Sbjct: 294 TLMWSATWPKEVQNLARDYLNDPIQVQIGSLELAASHTITQLVEVITDFEKRDRMVKHLE 353

Query: 363 YLLQD 367
              QD
Sbjct: 354 VASQD 358

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 63/106 (59%)

Query: 425 EKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 484
           E   ++F  T+   + I++ L++ G+    I+G  DQ  R   L  FR G + I+V TDV
Sbjct: 360 ESKILVFASTKRTCDEITKYLREDGWPALAIHGDKDQRERDWVLAEFREGRSPIMVATDV 419

Query: 485 AARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           AARG+D+  +  VIN+ +P + + ++HR+GRT RAG  G A S  +
Sbjct: 420 AARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 465

>YPL119C Chr16 complement(324411..326264) [1854 bp, 617 aa] {ON}
           DBP1Putative ATP-dependent RNA helicase of the DEAD-box
           protein family; mutants show reduced stability of the
           40S ribosomal subunit scanning through 5' untranslated
           regions of mRNAs
          Length = 617

 Score =  143 bits (360), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 139/251 (55%), Gaps = 17/251 (6%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F S  L ++++ NI    F +PTP+Q+ +IP++ + RD++  A+TGSGKT  F+ P+  +
Sbjct: 156 FSSPPLDELLMENIKLASFTKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTE 215

Query: 192 I-------------KTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGD 238
           +               +S K    A++L+P+RELA Q     ++F+  + +R  ++ GG 
Sbjct: 216 LFRSGPSPVPEKAQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGA 275

Query: 239 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNEL 298
            + +Q   +    D+++ATPGR   L     + L +I+Y V DEADR+ +MGF+ Q+  +
Sbjct: 276 PIGNQMREVDRGCDLLVATPGRLNDLLERGKVSLANIKYLVLDEADRMLDMGFEPQIRHI 335

Query: 299 L--ASLPS--NRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKN 354
           +    +PS  NRQTL+FSAT P  +   A+  L N + + +      SEN+    L   +
Sbjct: 336 VEECDMPSVENRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDD 395

Query: 355 DEREANLLYLL 365
            ++++ LL LL
Sbjct: 396 MDKKSALLDLL 406

 Score = 83.6 bits (205), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 61/101 (60%)

Query: 428 TILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 487
           T++FV T+   + ++  L    +  + I+G   Q  R+R L  F+  +  ILV T VAAR
Sbjct: 414 TLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANVADILVATAVAAR 473

Query: 488 GVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSI 528
           G+DIP + +VIN+ LP+    ++HR+GRT RAGN G A S 
Sbjct: 474 GLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSF 514

>Kpol_274.7 s274 complement(11790..13502) [1713 bp, 570 aa] {ON}
           complement(11790..13502) [1713 nt, 571 aa]
          Length = 570

 Score =  142 bits (358), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 111/398 (27%), Positives = 197/398 (49%), Gaps = 73/398 (18%)

Query: 130 GSFPS----FGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           GSF      F   K ++ N+    F +PTPIQ + IPL L NRD++  A TGSGKT AF+
Sbjct: 127 GSFEDLITRFSFDKRLLNNLILNHFTEPTPIQCEAIPLALNNRDMLACAPTGSGKTLAFL 186

Query: 186 LPMIRKIKTHSSKIGARAVILSPSRELAMQ--------THNVFKEFSKGTQLRSVLLTGG 237
           +P+I+++       G + +I+SP++ELA Q        ++ +F    K   L+  LL+  
Sbjct: 187 IPLIQQVINDKDTQGLKGLIISPTKELANQIFLECIKLSNRIF--LDKKRPLQVALLSKS 244

Query: 238 DSLEDQFGMMMNNP-DVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLN 296
            S + +  ++ +   D+I++TP R + +    +LDL  +++ +FDEAD+LF+  F +Q +
Sbjct: 245 LSAKLRNKVISDKKYDIIVSTPLRLIDVVKNEALDLSQVKHLIFDEADKLFDKTFVEQSD 304

Query: 297 ELLASLP-SNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKND 355
           ++L+S   S+ +  +FSAT+PS++ + AK+ + +PV V +  +   + ++E   +   N+
Sbjct: 305 DILSSCSHSSLRKSMFSATIPSNVEEIAKSIMMDPVRVIIGHKEAANTSIEQKLVFCGNE 364

Query: 356 EREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXER 415
             E  L+ + Q V         Q+ +F                                 
Sbjct: 365 --EGKLIAIKQLV---------QEGEFK-------------------------------- 381

Query: 416 LPPANQLPSEKATILFVP--TRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRT 473
            PP          I+F+   TR    Y  +++ DS   +  I+    Q  R + +  F++
Sbjct: 382 -PP---------VIIFLESITRAKALY-HEMMYDS-LNVDVIHAERTQVQRNKIIERFKS 429

Query: 474 GLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIH 511
           G    L+ TDV ARGVD   +  VIN+ +P +++ ++H
Sbjct: 430 GDLWCLITTDVLARGVDFKGVNLVINYDVPRTAQAYVH 467

>Skud_14.219 Chr14 (403781..405088) [1308 bp, 435 aa] {ON} YNL112W
           (REAL)
          Length = 435

 Score =  140 bits (352), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 80/245 (32%), Positives = 130/245 (53%), Gaps = 8/245 (3%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF   G    ++  +   GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 114 SFEEAGFPDYVLKEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 173

Query: 191 KIKTH---SSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            I      +   G   ++LSP+RELA+Q      +F   +++R+  + GG     Q   +
Sbjct: 174 HINAQPLLAPGDGPIVLVLSPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDL 233

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +  +RQ
Sbjct: 234 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVR-----LDAESKISENLEMLFLSTKNDEREANLL 362
           TL++SAT P  +   A   L +P+ V+     L A   I++ +E++    K D    +L 
Sbjct: 294 TLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHTITQVVEVVSDFEKRDRLNKHLE 353

Query: 363 YLLQD 367
              QD
Sbjct: 354 TASQD 358

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 6/78 (7%)

Query: 425 EKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 484
           E  T++F  T+   + I++ L++ G+    I+G  DQ  R   L  FR G + ++V TDV
Sbjct: 360 EYKTLVFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPVMVATDV 419

Query: 485 AARGVDIPMLANVINFSL 502
           AARG+       ++NFS 
Sbjct: 420 AARGI------GMLNFSF 431

>Kwal_27.11734 s27 complement(923899..925614) [1716 bp, 571 aa] {ON}
           YDR243C (PRP28) - RNA helicase [contig 27] FULL
          Length = 571

 Score =  142 bits (358), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 88/228 (38%), Positives = 136/228 (59%), Gaps = 20/228 (8%)

Query: 136 GLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIK-- 193
           GL +II +   K  +R+PTPIQR TIP +L+ RD VG+A TGSGKT AF+LP + ++   
Sbjct: 178 GLVEIISS---KLKYREPTPIQRITIPNVLRGRDFVGIAATGSGKTLAFLLPSLCQLSKL 234

Query: 194 ---THSSKI-GARAVILSPSRELAMQTH----NVFKEFSKGTQLRSVLLTGGDSLEDQFG 245
                 +K+ G   +IL+P+RELA Q       V   +S+ T++ S++  GG S+E+   
Sbjct: 235 PPLNDITKLDGPFTLILAPTRELAQQIEAEAKKVVNLWSRPTKVTSIV--GGHSIEEISY 292

Query: 246 MMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLP-- 303
            + +  D+++ATPGR +       L LK +   V DEADR+ + GF+DQL  +LA     
Sbjct: 293 SLSDGCDILVATPGRLIDCLENRMLVLKQVRILVLDEADRMIDFGFEDQLTTILARTESV 352

Query: 304 SNRQTLLFSATLPSSLVDFAKAGLTNPVLVRL---DAESKISENLEML 348
           S RQT++F+AT+ +++   A   LT P  VR+   D +++I + +E L
Sbjct: 353 SGRQTMMFTATMSNTVEKIANGYLTKPAYVRVGSDDTKAQIKQIVEYL 400

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 67/110 (60%), Gaps = 2/110 (1%)

Query: 422 LPSEKATIL-FVPTRHHVEY-ISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 479
           LP  +A I+ F+  +   ++ +S+   ++ + ++ ++G+  Q  R+  L   RTG   I+
Sbjct: 415 LPKFRAPIMIFINYKKTADWLVSKFSSETRFKVTTLHGSKSQEQREHSLNMLRTGKVDIM 474

Query: 480 VVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIV 529
           + TDVA RG+DIP ++ V+NF +  + + ++HR+GRT RAG  G A + +
Sbjct: 475 IATDVAGRGIDIPDVSLVVNFQMCTAFESYVHRIGRTGRAGRSGCALTFL 524

>KAFR0E01640 Chr5 complement(335123..337405) [2283 bp, 760 aa] {ON}
           Anc_5.241 YJL033W
          Length = 760

 Score =  144 bits (362), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 126/201 (62%), Gaps = 4/201 (1%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F    +S   +  + +  F Q T IQR +IP+ L+  D++G ARTGSGKT AF++P++ K
Sbjct: 43  FKDLPISAQTLKGLNESAFIQLTGIQRDSIPVSLKGHDVLGAARTGSGKTLAFLIPVLEK 102

Query: 192 I--KTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMN 249
           +  +  ++  G  A+I+SP+RELAMQ + V  +  + T   + L+ GG  ++ +    ++
Sbjct: 103 LYREKWTAFDGLGALIISPTRELAMQIYEVLIKIGRHTSFSAGLVIGGKDVKFE-SERIS 161

Query: 250 NPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQT 308
             +++I TPGR L HL   + L   +++  V DEADR  +MGF+  L+ ++++LP++RQT
Sbjct: 162 KINILIGTPGRVLQHLDQAVGLSTSNLQMLVLDEADRCLDMGFKKTLDAIVSNLPASRQT 221

Query: 309 LLFSATLPSSLVDFAKAGLTN 329
           LLFSAT  +SL D A+  LT+
Sbjct: 222 LLFSATQSNSLADLARLSLTD 242

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 47/97 (48%), Gaps = 2/97 (2%)

Query: 429 ILFVPTRHHVEYISQLLK--DSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 486
           I+F+ +   V ++ +  +    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQKARTETLDKFNRAQHVCLFATDVVA 354

Query: 487 RGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRG 523
           RG+D P +  VI    P     +IHRVGRT R G +G
Sbjct: 355 RGIDFPAVNWVIQVDCPEDVDTYIHRVGRTGRYGKKG 391

>ZYRO0G08580g Chr7 complement(695127..696746) [1620 bp, 539 aa] {ON}
           similar to uniprot|P20447 Saccharomyces cerevisiae
           YGL078C DBP3 Putative ATP-dependent RNA helicase of the
           DEAD-box family involved in ribosomal biogenesis
          Length = 539

 Score =  141 bits (356), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 127/217 (58%), Gaps = 6/217 (2%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF    L   I + I+K  F +PTPIQ  + P +L  RD++G+A TGSGKT AF +P I 
Sbjct: 129 SFSHLSLKPEIQSEISK--FPKPTPIQSVSWPYLLSGRDVIGVAETGSGKTFAFGVPAID 186

Query: 191 KIKTH--SSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMM 248
           ++ ++  + +   + +++SP+RELA QT++     +    L    + GG   ++Q   + 
Sbjct: 187 QLVSNGDAKRKSVKVLVISPTRELASQTYDNLIILTNKVGLECCCVYGGVPKQEQRNQLR 246

Query: 249 NNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-NRQ 307
           N+  V++ATPGR L L  E S+DL  ++Y V DEADR+ E GF++ +  ++    S +RQ
Sbjct: 247 NS-QVVVATPGRLLDLINEQSVDLSQVQYLVLDEADRMLEKGFEEDIKNIINQTNSRDRQ 305

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISEN 344
           TL+F+AT P  + + A   + +PV V +    ++S N
Sbjct: 306 TLMFTATWPKEVRELASTFMRDPVKVSIGNRDELSAN 342

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 64/103 (62%)

Query: 428 TILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 487
            ++F   +     +   LK +GY ++ I+G L Q  R   L +F+ G +++L+ TDVAAR
Sbjct: 378 VLIFALYKKEASRVENNLKYNGYDVAAIHGDLSQQQRTSALNDFKAGKSNLLLATDVAAR 437

Query: 488 GVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           G+DIP +  VIN + P + + ++HR+GRT RAG  G A+++ +
Sbjct: 438 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 480

>TPHA0B02850 Chr2 complement(650888..652774) [1887 bp, 628 aa] {ON}
           Anc_8.614 YOR204W
          Length = 628

 Score =  142 bits (358), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 141/251 (56%), Gaps = 17/251 (6%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F S  L  +++ NI    F +PTP+Q+ ++P++ Q RD++  A+TGSGKT  F+ P++ +
Sbjct: 157 FTSPPLDSLLLENIHLARFTKPTPVQKYSVPIVAQGRDLMACAQTGSGKTGGFLFPVLSQ 216

Query: 192 I-------------KTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGD 238
                         ++   K    A++L+P+RELA Q ++  K+F+  + +R V++ GG 
Sbjct: 217 SFKNGPAPVPEDLKRSFLRKGNPTALVLAPTRELATQIYDEAKKFTYRSWVRPVVIYGGS 276

Query: 239 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNEL 298
            +  Q   +    D+++ATPGR   L     + L +++Y V DEADR+ +MGF+ Q+  +
Sbjct: 277 DVGTQIRELERGCDLLVATPGRLNDLLERGRVSLANVKYLVLDEADRMLDMGFEPQIRHI 336

Query: 299 L--ASLP--SNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKN 354
           +    +P  +NRQTL+FSAT P  +   A+  L + + + +      SEN+    L  ++
Sbjct: 337 VDGCDMPDANNRQTLMFSATFPDDIQHLARDFLNDYIFLSVGRVGSTSENITQRILYVED 396

Query: 355 DEREANLLYLL 365
            ++++ LL LL
Sbjct: 397 MDKKSALLDLL 407

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 62/101 (61%)

Query: 428 TILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 487
           T++FV T+   + ++  L    ++ + I+G   Q  R+R L  F+ G  ++LV T VAAR
Sbjct: 415 TLIFVETKRMADELTDFLIMQDFMATAIHGDRTQIERERALAAFKGGRANVLVATAVAAR 474

Query: 488 GVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSI 528
           G+DIP + +VIN+ LP     ++HR+GRT RAGN G A S 
Sbjct: 475 GLDIPNVTHVINYDLPTDIDDYVHRIGRTGRAGNTGVATSF 515

>NCAS0B08130 Chr2 (1551641..1552831) [1191 bp, 396 aa] {ON}
           Anc_1.211
          Length = 396

 Score =  138 bits (347), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 103/397 (25%), Positives = 183/397 (46%), Gaps = 62/397 (15%)

Query: 120 TNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 179
           TN +K  +K   F    L + ++  +   GF  P+ IQ++ I  I++  D++  A++G+G
Sbjct: 16  TNYDKVVYK---FDDMNLDEKLLRGVFGYGFEDPSAIQQRAIMPIIEGHDVLAQAQSGTG 72

Query: 180 KTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDS 239
           KT  F +  +++I T  S    +A++L+P+RELA+Q   V    +    ++     GG S
Sbjct: 73  KTGTFSIAALQRIDT--SIKAPQALMLAPTRELALQIQKVVMALAFHMDVKVHACIGGTS 130

Query: 240 -LEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNEL 298
            +ED  G+   +  +++ TPGR             SI+  + DEAD +   GF++Q+ ++
Sbjct: 131 FVEDAEGL--RDAQIVVGTPGRVFDNIQRRRFRTDSIKMFILDEADEMLSSGFKEQIYQI 188

Query: 299 LASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDERE 358
              LP   Q +L SAT+P  +++     + NPV + +  +    E ++  +++ +     
Sbjct: 189 FTMLPPTTQVVLLSATMPRDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVE----- 243

Query: 359 ANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPP 418
                             E+Q K+                               E L  
Sbjct: 244 ------------------EEQFKY-------------------------------ECLTD 254

Query: 419 ANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSI 478
                S    ++F  TR  VE ++Q L    + +S IY  L Q  R   +  FR+G + I
Sbjct: 255 LYDSISVTQAVIFCNTRRKVEELTQKLTADDFTVSAIYSDLPQQERDTIMKEFRSGSSRI 314

Query: 479 LVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGR 515
           L+ TD+ ARG+D+  ++ VIN+ LP + + +IHR+GR
Sbjct: 315 LISTDLLARGIDVQQVSLVINYDLPTNKENYIHRIGR 351

>KLTH0H01562g Chr8 complement(140915..142390) [1476 bp, 491 aa] {ON}
           similar to uniprot|P39517 Saccharomyces cerevisiae
           YDL160C DHH1 Cytoplasmic DExD/H-box helicase stimulates
           mRNA decapping coordinates distinct steps in mRNA
           function and decay interacts with both the decapping and
           deadenylase complexes may have a role in mRNA export and
           translation
          Length = 491

 Score =  140 bits (352), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 119/206 (57%), Gaps = 4/206 (1%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F  F L + ++  I + GF +P+PIQ + IP+ +  RD++  A+ G+GKTAAF++P + 
Sbjct: 30  TFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPIAIAGRDVLARAKNGTGKTAAFVVPTLE 89

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
           K+K   +KI  +A+I+ P+RELA+QT  V +   K   +  ++ TGG +L D   + +N 
Sbjct: 90  KVKPKVNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDI-LRLNE 146

Query: 251 P-DVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQTL 309
           P  +++ TPGR L L      DL      V DEAD++    F+  + ++L  LP   Q+L
Sbjct: 147 PVHILVGTPGRVLDLASRKVADLSECPLFVMDEADKMLSRDFKAIIEQILTFLPPVHQSL 206

Query: 310 LFSATLPSSLVDFAKAGLTNPVLVRL 335
           LFSAT P ++ +F    L  P  + L
Sbjct: 207 LFSATFPLTVKEFMVKHLHKPYEINL 232

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 77/150 (51%), Gaps = 7/150 (4%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+F  + + VE +++ + D GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 270 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQSERNKVFHEFRQGKVRTLVCSDLLTRG 329

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKI 548
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++              G +I
Sbjct: 330 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEI 389

Query: 549 MLTPMYDSLCEIMKNKWIAEGNDESSFVNP 578
              P      +I K+ ++AE  D+S+   P
Sbjct: 390 AAIP-----AQIDKSLYVAE--DDSAVPVP 412

>NCAS0E03920 Chr5 complement(769305..770618) [1314 bp, 437 aa] {ON} 
          Length = 437

 Score =  139 bits (349), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 93/253 (36%), Positives = 124/253 (49%), Gaps = 14/253 (5%)

Query: 125 SKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAF 184
           S+ K  +F S GLS+ +   +      QPT IQ+  IP IL+ RD +G A+TGSGKT AF
Sbjct: 2   SEIKNATFKSLGLSRWLQEALQAMKINQPTAIQKACIPEILKGRDCIGGAKTGSGKTVAF 61

Query: 185 ILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQF 244
             PM+ K     S  G   V+L+P+RELAMQ    F        +R  L+ GG+S+ DQ 
Sbjct: 62  AAPMLTKWSEDPS--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVALVVGGESIVDQA 119

Query: 245 GMMMNNPDVIIATPGRFLHLKVEMSLD----LKSIEYAVFDEADRLFEMGFQDQLNELLA 300
             +   P  IIATPGR  H  +    D    LK  ++ V DEAD L    F   L   + 
Sbjct: 120 IQLQKKPHFIIATPGRLAHHIMSSGEDTIGGLKRAKFLVLDEADSLLTDTFASDLATCIG 179

Query: 301 SLPS--NRQTLLFSATLPSSLVDFAKAGLTN--PVLVRLDAES----KISENLEMLFLST 352
           +LPS   RQTLLF+AT+   +     A +    P L     ES     I   L+  ++  
Sbjct: 180 ALPSKDKRQTLLFTATITDQVRALEDAPIQEGKPPLFTYQVESVDKVAIPSTLKTEYILV 239

Query: 353 KNDEREANLLYLL 365
               +EA L  LL
Sbjct: 240 PEHVKEAYLYQLL 252

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 60/106 (56%)

Query: 425 EKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 484
           + + I+FV      E + + L      ++ ++  + Q  R   L+ FR  +  +L+ TDV
Sbjct: 259 DSSAIIFVNRTMTAEILRRTLYHLEVRVASLHSQMPQQERTNSLHRFRANVARVLIATDV 318

Query: 485 AARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           A+RG+DIP +  VIN+ +PA    FIHR GRTARAG  G A S V+
Sbjct: 319 ASRGLDIPTVELVINYDIPADPDTFIHRAGRTARAGRSGDAISFVT 364

>KAFR0H02820 Chr8 (537121..538956) [1836 bp, 611 aa] {ON} Anc_8.614
           YOR204W
          Length = 611

 Score =  141 bits (356), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 142/251 (56%), Gaps = 17/251 (6%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F S  L ++++ NI    F +PTP+Q+ +IP++ +NRD++G A+TGSGKT  F+ P++ +
Sbjct: 139 FTSPPLEELLLENIKLARFTKPTPVQKYSIPIVSKNRDLMGCAQTGSGKTGGFLFPILSE 198

Query: 192 I------------KTHSSKIG-ARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGD 238
           +            + H  + G   A++L+P+RELA Q     ++F+  + +R  ++ GG 
Sbjct: 199 MFINGPLNVPDKSRNHYMRKGYPTALVLAPTRELATQIFEESRKFTYRSWVRPCVVYGGA 258

Query: 239 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNEL 298
            + +Q   +    D+++ATPGR   L     + L ++ Y + DEADR+ +MGF+ Q+  +
Sbjct: 259 PIGNQMRELDRGCDLLVATPGRLNDLLERGKISLMNVRYLILDEADRMLDMGFEPQIRHI 318

Query: 299 L--ASLPS--NRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKN 354
           +    +P   +RQTL+FSAT P  +   A+  L N V + +      SEN+    +  ++
Sbjct: 319 VEDCDMPEVQDRQTLMFSATFPRDIQHLARDFLKNYVFLSVGRVGSTSENITQKIIMVED 378

Query: 355 DEREANLLYLL 365
            ++++ LL LL
Sbjct: 379 MDKKSALLDLL 389

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 61/104 (58%)

Query: 425 EKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 484
           E  T++FV T+   + ++  L    +  + I+G   Q  R+R L  F+ G   ILV T V
Sbjct: 394 EGLTLIFVETKRMADQLTDFLIMQNFNATAIHGDRTQEERERALGAFKAGRADILVATAV 453

Query: 485 AARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSI 528
           AARG+DIP +  VINF LP+    ++HR+GRT RAGN G A S 
Sbjct: 454 AARGLDIPNVTLVINFDLPSDIDDYVHRIGRTGRAGNTGVAISF 497

>KLTH0D09746g Chr4 (805863..807728) [1866 bp, 621 aa] {ON} similar
           to uniprot|P06634 Saccharomyces cerevisiae YOR204W DED1
           ATP-dependent DEAD (Asp-Glu-Ala- Asp)-box RNA helicase
           required for translation initiation of all yeast mRNAs
           mutations in human DEAD-box DBY are a frequent cause of
           male infertility
          Length = 621

 Score =  141 bits (356), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 83/251 (33%), Positives = 140/251 (55%), Gaps = 17/251 (6%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F S  L ++++ NI K  F +PTP+Q+ ++P+I   RD++  A+TGSGKT  F+ P++ +
Sbjct: 151 FTSPPLDQLLLDNIIKARFTKPTPVQKYSVPIIAARRDLMACAQTGSGKTGGFLFPVLSE 210

Query: 192 --------IKTHSS-----KIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGD 238
                   +   +S     K    AV+L+P+RELA Q  +  K+F+  + +R  ++ GG 
Sbjct: 211 SFANGPAPVPEQASNFYIKKAFPTAVVLAPTRELATQIFDEAKKFTYRSWVRPCVVYGGA 270

Query: 239 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNEL 298
            +  Q   +    D+++ATPGR   L     + L +I+Y V DEADR+ +MGF+ Q+  +
Sbjct: 271 DIGSQIKELNRGCDLLVATPGRLSDLLERGRISLCNIKYLVLDEADRMLDMGFEPQIRHI 330

Query: 299 L--ASLPS--NRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKN 354
           +    +PS   RQTL+FSAT P  +   A+  L + V + +      SEN+    L  ++
Sbjct: 331 VEGCDMPSVDERQTLMFSATFPMDIQHLARDFLKDYVFLSVGRVGSTSENITQHVLYVED 390

Query: 355 DEREANLLYLL 365
            ++++ LL LL
Sbjct: 391 MDKKSALLDLL 401

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 63/103 (61%)

Query: 428 TILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 487
           T++FV T+   + ++  L       + I+G   Q  R+R L  FR+G  S+LV T VAAR
Sbjct: 409 TLIFVETKRMADALTDFLIMQNLRATAIHGDRSQSERERALAAFRSGKASLLVATAVAAR 468

Query: 488 GVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           G+DIP + +VIN+ LP     ++HR+GRT RAGN G A + ++
Sbjct: 469 GLDIPNVTHVINYDLPNDIDDYVHRIGRTGRAGNTGVATAFLN 511

>SAKL0H08162g Chr8 complement(702292..704166) [1875 bp, 624 aa] {ON}
           similar to uniprot|P06634 Saccharomyces cerevisiae
           YOR204W DED1 ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box
           RNA helicase required for translation initiation of all
           yeast mRNAs mutations in human DEAD-box DBY are a
           frequent cause of male infertility
          Length = 624

 Score =  141 bits (356), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 140/251 (55%), Gaps = 17/251 (6%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F S  L+++++ NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ +
Sbjct: 153 FTSPPLNELLLDNIKSARFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVLSE 212

Query: 192 --------IKTHSSKIGAR-----AVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGD 238
                   +   +S    R     AV+L+P+RELA Q  +  K+F+  + ++  ++ GG 
Sbjct: 213 SFNNGPAPVPEQASSFYIRKAYPTAVVLAPTRELATQIFDEAKKFTYRSWVKPCVVYGGA 272

Query: 239 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNEL 298
            +  Q   +    D+++ATPGR   L     + L +++Y V DEADR+ +MGF+ Q+  +
Sbjct: 273 DIRSQIRELERGCDLLVATPGRLNDLLERGKISLCNVKYLVLDEADRMLDMGFEPQIRHI 332

Query: 299 L--ASLPS--NRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKN 354
           +    +PS  NRQTL+FSAT P  +   A+  L + + + +      SEN+    L  ++
Sbjct: 333 VQDCDMPSAENRQTLMFSATFPMDIQHLARDFLEDYIFLSVGRVGSTSENITQKVLYVED 392

Query: 355 DEREANLLYLL 365
            ++ + LL LL
Sbjct: 393 ADKRSALLDLL 403

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 61/98 (62%)

Query: 428 TILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 487
           T++FV T+   + ++  L       + I+G   Q  R+R L  FR+G  ++LV T VAAR
Sbjct: 411 TLIFVETKRMADALTDFLIMQELKATAIHGDRSQPERERALAAFRSGRANLLVATAVAAR 470

Query: 488 GVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWA 525
           G+DIP + +VIN+ LP+    ++HR+GRT RAGN G A
Sbjct: 471 GLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVA 508

>Suva_14.226 Chr14 (410416..411691,412742..413097) [1632 bp, 543 aa]
           {ON} YNL112W (REAL)
          Length = 543

 Score =  140 bits (353), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 79/245 (32%), Positives = 132/245 (53%), Gaps = 8/245 (3%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F   G    +++ +   GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 115 TFDEAGFPDYVLSEVKAEGFAKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 174

Query: 191 KIKTH---SSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            I      +   G   ++LSP+RELA+Q      +F + +++R+  + GG     Q   +
Sbjct: 175 HINAQPLLAPGDGPIVLVLSPTRELAVQIQTECSKFGQSSRIRNTCVYGGVPKSQQIRDL 234

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +  +RQ
Sbjct: 235 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 294

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVR-----LDAESKISENLEMLFLSTKNDEREANLL 362
           TL++SAT P  +   A   L +P+ V+     L A   I++ +E++    K D    +L 
Sbjct: 295 TLMWSATWPKEVKQLAADYLNDPIQVQVGSLELAASHTITQLVEVVSDFEKRDRLNKHLE 354

Query: 363 YLLQD 367
              QD
Sbjct: 355 TASQD 359

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 64/106 (60%)

Query: 425 EKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 484
           E  T++F  T+   + I++ L++ G+    I+G  DQ  R   L  FR G + I+V TDV
Sbjct: 361 EYKTLIFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGGSPIMVATDV 420

Query: 485 AARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           AARG+D+  +  VIN+ +P + + ++HR+GRT RAG  G A S  +
Sbjct: 421 AARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAVSFFT 466

>Smik_15.390 Chr15 (672576..674405) [1830 bp, 609 aa] {ON} YOR204W
           (REAL)
          Length = 609

 Score =  141 bits (355), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 141/251 (56%), Gaps = 17/251 (6%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F S  L ++++ NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ +
Sbjct: 148 FTSPPLDELLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSE 207

Query: 192 -IKTHSS------------KIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGD 238
             KT  S            K    AVI++P+RELA Q  +  K+F+  + +++ ++ GG 
Sbjct: 208 SFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGS 267

Query: 239 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNEL 298
            + +Q   +    D+++ATPGR   L     + L +++Y V DEADR+ +MGF+ Q+  +
Sbjct: 268 PIGNQLREIERGCDLLVATPGRLNDLLERGKISLVNVKYLVLDEADRMLDMGFEPQIRHI 327

Query: 299 LASLP----SNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKN 354
           +         +RQTL+FSAT P+ +   A+  L++ + + +      SEN+    L  +N
Sbjct: 328 VEDCDMTPVGDRQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVEN 387

Query: 355 DEREANLLYLL 365
            ++++ LL LL
Sbjct: 388 QDKKSALLDLL 398

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 64/102 (62%)

Query: 424 SEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 483
           ++  T++FV T+   + ++  L    +  + I+G   Q  R+R L  FR+G  S+LV T 
Sbjct: 402 TDGLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAASLLVATA 461

Query: 484 VAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWA 525
           VAARG+DIP + +VIN+ LP+    ++HR+GRT RAGN G A
Sbjct: 462 VAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLA 503

>ADL273C Chr4 complement(225068..226939) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR204W
           (DED1) and YPL119C (DBP1)
          Length = 623

 Score =  141 bits (355), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 79/250 (31%), Positives = 139/250 (55%), Gaps = 16/250 (6%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F S  L ++++ NI    F +PTP+Q+ ++P++ + RD++  A+TGSGKT  F+ P++ +
Sbjct: 148 FTSPPLDELLLENIKLARFTKPTPVQKYSVPIVAKGRDLMACAQTGSGKTGGFLFPVLSQ 207

Query: 192 IKTHSS------------KIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDS 239
             ++              K    AV+L+P+RELA Q  +  K+F+  + ++  ++ GG  
Sbjct: 208 SFSNGPASTPDESGYYMRKAYPTAVVLAPTRELATQIFDEAKKFTYRSWVKPCVVYGGAD 267

Query: 240 LEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELL 299
           +  Q   +    D+I+ATPGR   L     + L S++Y V DEADR+ +MGF+ Q+  ++
Sbjct: 268 IRQQIRELERGCDLIVATPGRLNDLLERGKISLCSVKYLVLDEADRMLDMGFEPQIRHIV 327

Query: 300 --ASLPS--NRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKND 355
               +P+  NRQTL+FSAT P+ +   A   L + + + +      SEN+    L  ++ 
Sbjct: 328 EGCDMPTVENRQTLMFSATFPTDIQHLAADFLKDYIFLSVGRVGSTSENITQKVLHVEDI 387

Query: 356 EREANLLYLL 365
           ++ + LL LL
Sbjct: 388 DKRSVLLDLL 397

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 61/98 (62%)

Query: 428 TILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 487
           T++FV T+   + ++  L       + I+G   Q  R+R L  FRTG  ++LV T VAAR
Sbjct: 405 TLVFVETKRMADALTDFLIMQNLSATAIHGDRTQAERERALAFFRTGRANVLVATAVAAR 464

Query: 488 GVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWA 525
           G+DIP + +VIN+ LP+    ++HR+GRT RAGN G A
Sbjct: 465 GLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGLA 502

>KLLA0F23716g Chr6 complement(2215454..2215845,2216857..2218129)
           [1665 bp, 554 aa] {ON} similar to uniprot|P24783
           Saccharomyces cerevisiae YNL112W DBP2 Essential
           ATP-dependent RNA helicase of the DEAD-box protein
           family involved in nonsense-mediated mRNA decay and rRNA
           processing
          Length = 554

 Score =  140 bits (353), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 80/245 (32%), Positives = 131/245 (53%), Gaps = 8/245 (3%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF   G    ++  + + GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 114 SFDEAGFPSYVLDEVKQEGFAKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 173

Query: 191 KIKTH---SSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            I      S   G   ++L+P+RELA+Q      +F   +++R+  + GG     Q   +
Sbjct: 174 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGASSRIRNTCVYGGVPKSQQIRDL 233

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +  +RQ
Sbjct: 234 QRGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVR-----LDAESKISENLEMLFLSTKNDEREANLL 362
           TL++SAT P  +   A   L +P+ V+     L A   I++ +E+L    K D    +L 
Sbjct: 294 TLMWSATWPKEVKQLASDYLHDPIQVQIGSLELSASHTITQIVEVLTDFEKRDRLAKHLE 353

Query: 363 YLLQD 367
              QD
Sbjct: 354 TASQD 358

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 62/102 (60%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+F  T+   + I+  L+  G+    I+G   Q+ R   L  FR+G + I+V TDVAARG
Sbjct: 364 IIFASTKRTCDEITSYLRTEGWPALAIHGDKAQNERDWVLAEFRSGRSPIMVATDVAARG 423

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           +D+  +  VIN+ +P + + ++HR+GRT RAG+ G A S  +
Sbjct: 424 IDVKGINYVINYDMPGNIEDYVHRIGRTGRAGSTGTAISFFT 465

>SAKL0G11748g Chr7 complement(998525..1000816) [2292 bp, 763 aa]
           {ON} highly similar to uniprot|P20448 Saccharomyces
           cerevisiae YJL033W HCA4 Putative nucleolar DEAD box RNA
           helicase high-copy number suppression of a U14 snoRNA
           processing mutant suggests an involvement in 18S rRNA
           synthesis
          Length = 763

 Score =  142 bits (358), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 124/202 (61%), Gaps = 4/202 (1%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F    +S   +  + +  F + T IQ+ +IP+ L+  D++G A+TGSGKT AF++P+I 
Sbjct: 42  TFDDLPISGNTLKGLKESAFIKMTEIQKNSIPVSLKGHDLLGAAKTGSGKTLAFLIPVIE 101

Query: 191 KI--KTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMM 248
           K+  +  +   G  A+I+SP+RELAMQT+ V  +  + T   + L+ GG  ++ +   + 
Sbjct: 102 KLYREKWTEHDGLGALIISPTRELAMQTYEVLVKIGRHTSFSAGLVIGGKDVKFELERI- 160

Query: 249 NNPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
           +  +V+I TPGR L H+   + L+   ++  V DEADR  +MGF+  L+ ++++LP  RQ
Sbjct: 161 SKINVLIGTPGRILQHMDQAIGLNTSGLQMLVLDEADRCLDMGFKRTLDAIVSNLPPTRQ 220

Query: 308 TLLFSATLPSSLVDFAKAGLTN 329
           TLLFSAT   SL D A+  LT+
Sbjct: 221 TLLFSATQSQSLADLARLSLTD 242

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 47/97 (48%), Gaps = 2/97 (2%)

Query: 429 ILFVPTRHHVEYISQLLK--DSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 486
           I+F+ +   V ++ +  +    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 293 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQQVCLFATDVVA 352

Query: 487 RGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRG 523
           RG+D P +  V+    P     +IHR GR+AR G +G
Sbjct: 353 RGIDFPAVDWVVQVDCPEDVDTYIHRAGRSARYGKQG 389

>NCAS0B04630 Chr2 (845866..847557) [1692 bp, 563 aa] {ON} Anc_8.124
          Length = 563

 Score =  140 bits (352), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 108/398 (27%), Positives = 192/398 (48%), Gaps = 73/398 (18%)

Query: 130 GSFPS----FGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           GSF      F L + ++ N+ +  F +PTPIQ +++PL L  RDI+  A TGSGKT AF+
Sbjct: 121 GSFEDLITRFSLDRRLLNNLIENHFTEPTPIQCESLPLALHGRDILACAPTGSGKTLAFL 180

Query: 186 LPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQ---------LRSVLLTG 236
           +P+ ++I      +G + +I+SP++ELA Q   +F E  K +          L+  LL+ 
Sbjct: 181 IPLFQQIINEKDTLGLKGLIISPTKELANQ---IFLECVKLSNRIYLDKKRPLQVALLSK 237

Query: 237 GDSLEDQFGMMMNNP-DVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQL 295
             S + +  ++ +   D+II TP R + L    +LDL  +++ +FDEAD+LF+  F +Q 
Sbjct: 238 SLSAKLKNKVINDKKYDLIITTPLRLIDLVKSEALDLSKVKHLIFDEADKLFDKTFVEQA 297

Query: 296 NELLASL--PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTK 353
           +++L S   P  R+  +FSAT+PS++ + A + + +PV V +  +   + N+E   +   
Sbjct: 298 DDILNSCTDPVLRKA-MFSATIPSNVEEIANSIMLDPVRVIIGHKEAANANIEQKLVFCG 356

Query: 354 NDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXX 413
           N+  E  L+ + Q V         Q+ +F                               
Sbjct: 357 NE--EGKLIAIRQLV---------QESEFK------------------------------ 375

Query: 414 ERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRT 473
              PP          I+F+ +    + +   L      +  I+       R++ +  F++
Sbjct: 376 ---PP---------IIIFLESITRAKALYHELMYDRMNVDVIHAERTPMQREKIIERFKS 423

Query: 474 GLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIH 511
           G    L+ TDV ARG+D   +  VIN+ +P +++ ++H
Sbjct: 424 GDLWCLICTDVLARGIDFKGVNLVINYDVPRTAQAYVH 461

>NCAS0C01720 Chr3 complement(317951..319873) [1923 bp, 640 aa] {ON}
           Anc_2.164 YNL112W
          Length = 640

 Score =  141 bits (355), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 141/246 (57%), Gaps = 17/246 (6%)

Query: 137 LSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK-IKTH 195
           L ++++ NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ +  KT 
Sbjct: 176 LDELLLENIKLARFTKPTPVQKYSVPIVENGRDLMACAQTGSGKTGGFLFPVLSESFKTG 235

Query: 196 SSKIGAR------------AVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQ 243
            SK   +            A+IL+P+RELA Q  +  K+F+  + +R  ++ GG  + +Q
Sbjct: 236 PSKTPEQGRNFYSKKGYPTALILAPTRELATQIFDEAKKFTYRSWVRPCVVYGGAPIGNQ 295

Query: 244 FGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELL--AS 301
              + +  D+++ATPGR   L     + L +I Y V DEADR+ +MGF+ Q+ +++  + 
Sbjct: 296 MREVDHGCDLLVATPGRLTDLIDRGKISLANIRYLVLDEADRMLDMGFEPQIRQIVEGSD 355

Query: 302 LP--SNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREA 359
           +P   +RQTL+FSAT P  +   A+  L + + + +      SEN+  + L  ++ ++ +
Sbjct: 356 MPQVGDRQTLMFSATFPVDIQQLARDFLNDYIFLSVGRVGSTSENITQVILYVEDQDKYS 415

Query: 360 NLLYLL 365
            LL LL
Sbjct: 416 ALLDLL 421

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 63/105 (60%)

Query: 424 SEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 483
           ++  T++FV T+   + ++  L    +  + I+G   Q  R+R L  FR G  +ILV T 
Sbjct: 425 TDGLTLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQQERERALSAFRAGTATILVATA 484

Query: 484 VAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSI 528
           VAARG+DIP + +VINF LP     ++HR+GRT RAGN G A S 
Sbjct: 485 VAARGLDIPNVTHVINFDLPGDIDDYVHRIGRTGRAGNTGVATSF 529

>KLTH0H04466g Chr8 (399689..401350) [1662 bp, 553 aa] {ON} similar
           to uniprot|P20447 Saccharomyces cerevisiae YGL078C DBP3
           Putative ATP-dependent RNA helicase of the DEAD-box
           family involved in ribosomal biogenesis
          Length = 553

 Score =  140 bits (352), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 79/216 (36%), Positives = 125/216 (57%), Gaps = 5/216 (2%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           SF    LS  I   I+K  F +PTPIQ  + P +L  +D+VG+A TGSGKT AF +P I 
Sbjct: 144 SFDQISLSSEIQEEISK--FPKPTPIQAVSWPYLLSGKDVVGVAETGSGKTFAFGVPAIH 201

Query: 191 KIKTHSSKI-GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMN 249
            +KT  +K  G + +++SP+RELA Q ++     +K   +    + GG   ++Q   +  
Sbjct: 202 NLKTADAKSQGVQVLVISPTRELASQIYDNLILLTKKAGVNCCCVYGGVPKDEQRSQLKK 261

Query: 250 NPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASL-PSNRQT 308
           +  V++ATPGR L L  E S  L +++Y V DEADR+ E GF++ +  ++ S   + RQT
Sbjct: 262 S-QVVVATPGRLLDLIEEGSARLSNVKYLVLDEADRMLEKGFEEDIKRIIGSTKATGRQT 320

Query: 309 LLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISEN 344
           L+F+AT P  + + A   + +PV + +    ++S N
Sbjct: 321 LMFTATWPKEVRELANTFMDSPVKISIGNRDELSAN 356

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 66/102 (64%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           ++F   +     + + LK +GY ++ I+G L Q  R + L  F++G +++L+ TDVAARG
Sbjct: 393 LIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGESNMLLATDVAARG 452

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           +DIP +  VIN + P + + ++HR+GRT RAG  G A+++ +
Sbjct: 453 LDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGLTGTAHTLFT 494

>KLLA0C17424g Chr3 (1529941..1531680) [1740 bp, 579 aa] {ON} similar
           to uniprot|P45818 Saccharomyces cerevisiae YGL171W ROK1
           ATP-dependent RNA helicase of the DEAD box family
           required for 18S rRNA synthesis
          Length = 579

 Score =  140 bits (353), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 111/402 (27%), Positives = 201/402 (50%), Gaps = 73/402 (18%)

Query: 130 GSFPS----FGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 185
           GSF      F   K ++ N+ +  F +PTPIQ ++IP++L  RD++  A TGSGKT AF+
Sbjct: 129 GSFEDLITRFQFDKRLLNNLIENNFTEPTPIQSESIPILLHERDMIACAPTGSGKTLAFL 188

Query: 186 LPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQ---------LRSVLLTG 236
           +P++++I    + +G + +I+SP++ELA Q   +F E SK            L+  LL+ 
Sbjct: 189 IPLLQQIINDKTTVGLKGLIISPTKELANQ---IFIECSKLANKIYLDKKRPLQVALLSK 245

Query: 237 GDSLEDQFGMMMNNP-DVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQL 295
             S + +  ++  +  D+II+TP R + +  E +L+L  +++ +FDEAD+LF+  F +Q 
Sbjct: 246 SLSSKLKNKVISEDKYDIIISTPLRLITVVQEEALNLGKVKHLIFDEADKLFDKTFVEQT 305

Query: 296 NELLASL--PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTK 353
           +++L+S   P  R+T+ FSAT+PS++ + A+  + +P+ V +  +   + N++   +   
Sbjct: 306 DDILSSCTDPHLRKTM-FSATIPSNVEEIAQTIMNDPIRVIIGHKEAANINIDQQLVFCG 364

Query: 354 NDEREANLLYLLQDVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXX 413
           N+  E  L+ + Q V++                                           
Sbjct: 365 NE--EGKLIAIRQLVLE------------------------------------------G 380

Query: 414 ERLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRT 473
           E  PP          I+F+ +    + +   L      +  I+    Q  R + +  F++
Sbjct: 381 EFKPPV---------IIFLESITRAKALFHELLYDKLNVDVIHAERTQVQRDKIIERFKS 431

Query: 474 GLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGR 515
           G    L+ TDV ARGVD   +  VIN+ +P S++ ++HR+GR
Sbjct: 432 GDLWCLICTDVLARGVDFKGVNLVINYDVPRSAQAYVHRIGR 473

>Kwal_56.24005 s56 complement(809954..811555) [1602 bp, 533 aa] {ON}
           YGL078C (DBP3) - ATP-dependent RNA helicase CA3 of the
           DEAD/DEAH box family [contig 168] FULL
          Length = 533

 Score =  139 bits (351), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 79/216 (36%), Positives = 124/216 (57%), Gaps = 5/216 (2%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F    LS  I   I+K  F +PTPIQ  + P +L  +D+VG+A TGSGKT AF +P + 
Sbjct: 124 AFDHISLSPEIQHEISK--FPKPTPIQSVSWPYLLSGKDVVGVAETGSGKTFAFGVPAVN 181

Query: 191 KIKTHSSKI-GARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMN 249
            + +  +K  G + +++SP+RELA QT++     +K   +    + GG   ++Q   +  
Sbjct: 182 NLMSADAKKKGIQVLVISPTRELASQTYDNLISLTKKAGVNCCCVYGGVPKDEQRAQL-K 240

Query: 250 NPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPS-NRQT 308
              V++ATPGR L L  E S  L +++Y V DEADR+ E GF++ +  ++ S  S  RQT
Sbjct: 241 KAHVVVATPGRLLDLIEEGSARLSNVDYLVLDEADRMLEKGFEEDIKRIIGSTKSAGRQT 300

Query: 309 LLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISEN 344
           L+F+AT P  + + A   + NPV V +    ++S N
Sbjct: 301 LMFTATWPKEVRELASTFMNNPVKVSIGNRDELSAN 336

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 66/103 (64%)

Query: 428 TILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 487
            ++F   +     + + LK +GY ++ I+G L Q  R + L  F++G +++L+ TDVAAR
Sbjct: 372 VLIFALYKKEAARVERNLKYNGYSVAAIHGDLSQQQRTQALNEFKSGASNLLLATDVAAR 431

Query: 488 GVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           G+DIP +  VIN + P + + ++HR+GRT RAG  G A+++ +
Sbjct: 432 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGLTGTAHTLFT 474

>Suva_8.257 Chr8 (461776..463632) [1857 bp, 618 aa] {ON} YOR204W
           (REAL)
          Length = 618

 Score =  140 bits (354), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 140/251 (55%), Gaps = 17/251 (6%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F S  L ++++ NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ +
Sbjct: 151 FTSPPLDELLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSE 210

Query: 192 -IKTHSS------------KIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGD 238
             KT  S            K    AVI++P+RELA Q  +  K+F+  + +++ ++ GG 
Sbjct: 211 SFKTGPSPQPEAQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGS 270

Query: 239 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNEL 298
            + +Q   +    D+++ATPGR   L     + L +++Y V DEADR+ +MGF+ Q+  +
Sbjct: 271 PIGNQLREIERGCDLLVATPGRLNDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHI 330

Query: 299 LASLP----SNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKN 354
           +          RQTL+FSAT P+ +   A+  L++ + + +      SEN+    L  +N
Sbjct: 331 VEDCDMTPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVEN 390

Query: 355 DEREANLLYLL 365
            ++++ LL LL
Sbjct: 391 QDKKSALLDLL 401

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 62/98 (63%)

Query: 428 TILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 487
           T++FV T+   + ++  L    +  + I+G   Q  R+R L  FR+G  S+LV T VAAR
Sbjct: 410 TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAASLLVATAVAAR 469

Query: 488 GVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWA 525
           G+DIP + +VIN+ LP+    ++HR+GRT RAGN G A
Sbjct: 470 GLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLA 507

>Smik_14.215 Chr14 (393283..394555,395537..395907) [1644 bp, 547 aa]
           {ON} YNL112W (REAL)
          Length = 547

 Score =  139 bits (351), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 73/226 (32%), Positives = 125/226 (55%), Gaps = 8/226 (3%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F   G    +++ +   GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 114 TFDEAGFPDYVLSEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 173

Query: 191 KIKTH---SSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            I      +   G   ++L+P+RELA+Q      +F   +++R+  + GG     Q   +
Sbjct: 174 HINAQPLLAPGDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDL 233

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +  +RQ
Sbjct: 234 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVR-----LDAESKISENLEML 348
           TL++SAT P  +   A   L +P+ V+     L A   I++ +E++
Sbjct: 294 TLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVV 339

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 65/107 (60%)

Query: 424 SEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 483
           +E  T++F  T+   + I++ L++ G+    I+G  DQ  R   L  FR G + I+V TD
Sbjct: 359 NEYKTLVFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATD 418

Query: 484 VAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           VAARG+D+  +  VIN+ +P + + ++HR+GRT RAG  G A S  +
Sbjct: 419 VAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 465

>Skud_15.370 Chr15 (661915..663744) [1830 bp, 609 aa] {ON} YOR204W
           (REAL)
          Length = 609

 Score =  140 bits (353), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 139/251 (55%), Gaps = 17/251 (6%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F S  L  +++ NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ +
Sbjct: 148 FTSPPLDSLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSE 207

Query: 192 -IKTHSS------------KIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGD 238
             KT  S            K    AVI++P+RELA Q  +  K+F+  + +++ ++ GG 
Sbjct: 208 SFKTGPSPQPESQGSFYQKKAYPTAVIMAPTRELATQIFDESKKFTYRSWVKACVVYGGS 267

Query: 239 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNEL 298
            + +Q   +    D+++ATPGR   L     + L +++Y V DEADR+ +MGF+ Q+  +
Sbjct: 268 PIGNQLREIERGCDLLVATPGRLNDLLERGKISLSNVKYLVLDEADRMLDMGFEPQIRHI 327

Query: 299 LASLP----SNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKN 354
           +          RQTL+FSAT P+ +   A+  L++ + + +      SEN+    L  +N
Sbjct: 328 VEDCDMTPVGARQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVEN 387

Query: 355 DEREANLLYLL 365
            ++++ LL LL
Sbjct: 388 QDKKSALLDLL 398

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 64/102 (62%)

Query: 424 SEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 483
           ++  T++FV T+   + ++  L    +  + I+G   Q  R+R L  FR+G  S+LV T 
Sbjct: 402 TDGLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGTASLLVATA 461

Query: 484 VAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWA 525
           VAARG+DIP + +VIN+ LP+    ++HR+GRT RAGN G A
Sbjct: 462 VAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGVA 503

>Skud_4.458 Chr4 complement(812448..814442) [1995 bp, 664 aa] {ON}
           YDR194C (REAL)
          Length = 664

 Score =  140 bits (354), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 114/407 (28%), Positives = 181/407 (44%), Gaps = 67/407 (16%)

Query: 145 ITKRGFRQPTPIQRKTIPLIL--QNRDIVGMARTGSGKTAAFILPMIRKIKTH--SSKIG 200
           IT+  F   TP+Q+KTI  IL  Q  D++  A+TG+GKT AF++P+ + +      S+  
Sbjct: 120 ITRMEFPGLTPVQQKTIKPILSSQEHDVIARAKTGTGKTFAFLIPIFQHLINTKLDSQYM 179

Query: 201 ARAVILSPSRELAMQTHNVFKEFSKGT----QLRSVLLTGGDSLEDQFGMMMN-NPDVII 255
            +AVI++P+R+LA+Q     K+         +   V L GG         M    P+++I
Sbjct: 180 VKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVI 239

Query: 256 ATPGRFLHLKVEMSLDL-KSIEYAVFDEADRLFEMGFQDQ-------LNELLASLPSNRQ 307
            TPGR + +  + S    + ++Y V DEADRL E+GF+D        LNE  +    N +
Sbjct: 240 GTPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGLLNEKNSKSADNIK 299

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFLSTKNDEREANLLYLLQ 366
           TL+FSATL   +   A   +     + LD   K   E  E +  S    E+ AN ++   
Sbjct: 300 TLMFSATLDDKVQKLANNIMNKSECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAV 359

Query: 367 DVIKIPLATKEQQRKFNDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 426
           + IK  +  +E   K                                             
Sbjct: 360 EHIKKQVKERESNYK--------------------------------------------- 374

Query: 427 ATILFVPTRHHVEYISQLLKDS---GYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 483
             I+F PT     ++  +L++       I   +G + Q+ R   +  F+   + ILV TD
Sbjct: 375 -AIIFAPTVKFTSFLCNILQNEFKKDLPILEFHGKITQNRRTSLVKKFKKDESGILVCTD 433

Query: 484 VAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           V ARG+D P +  V+   +P+    +IHR+GRTAR+G  G +   + 
Sbjct: 434 VGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFIC 480

>YOR204W Chr15 (722911..724725) [1815 bp, 604 aa] {ON}
           DED1ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA
           helicase, required for translation initiation of all
           yeast mRNAs; mutations in human DEAD-box DBY are a
           frequent cause of male infertility
          Length = 604

 Score =  140 bits (352), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 139/251 (55%), Gaps = 17/251 (6%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F S  L  +++ NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ +
Sbjct: 144 FTSPPLDGLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSE 203

Query: 192 -IKTHSS------------KIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGD 238
             KT  S            K    AVI++P+RELA Q  +  K+F+  + +++ ++ GG 
Sbjct: 204 SFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGS 263

Query: 239 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNEL 298
            + +Q   +    D+++ATPGR   L     + L +++Y V DEADR+ +MGF+ Q+  +
Sbjct: 264 PIGNQLREIERGCDLLVATPGRLNDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHI 323

Query: 299 LASLP----SNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKN 354
           +          RQTL+FSAT P+ +   A+  L++ + + +      SEN+    L  +N
Sbjct: 324 VEDCDMTPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVEN 383

Query: 355 DEREANLLYLL 365
            ++++ LL LL
Sbjct: 384 QDKKSALLDLL 394

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 64/102 (62%)

Query: 424 SEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 483
           ++  T++FV T+   + ++  L    +  + I+G   Q  R+R L  FR+G  ++LV T 
Sbjct: 398 TDGLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAATLLVATA 457

Query: 484 VAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWA 525
           VAARG+DIP + +VIN+ LP+    ++HR+GRT RAGN G A
Sbjct: 458 VAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLA 499

>AFL221C Chr6 complement(22711..23108,23775..25050) [1674 bp, 557
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YNL112W (DBP2); 1-intron
          Length = 557

 Score =  139 bits (350), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 119/208 (57%), Gaps = 3/208 (1%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F   G  + ++  + + GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 115 TFDEAGFPEYVLKEVKEEGFEKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 174

Query: 191 KIKTH---SSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            I      S   G   ++L+P+RELA+Q      +F + +++R+  + GG     Q   +
Sbjct: 175 HINAQPLLSPGDGPVVLVLAPTRELAVQIQKECSKFGRSSRIRNTCVYGGVPKSQQIRDL 234

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +  +RQ
Sbjct: 235 QRGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 294

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVRL 335
           TL++SAT P  +   A+  L +P+ V +
Sbjct: 295 TLMWSATWPKEVQQLARDYLHDPIQVNI 322

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 57/102 (55%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+   T+   + I+  L+  G+    I+G          L ++RTG + I+V TDV ARG
Sbjct: 365 IILHSTKRTCDEITSYLRQDGWPALAIHGPTPLQDIDCTLNDYRTGRSPIMVATDVVARG 424

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           +D+  +  VIN+ +P + + ++HR+GRT RAG  G A S  +
Sbjct: 425 IDVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 466

>TDEL0A05590 Chr1 (980392..982185) [1794 bp, 597 aa] {ON} Anc_8.614
           YOR204W
          Length = 597

 Score =  140 bits (352), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 80/251 (31%), Positives = 143/251 (56%), Gaps = 17/251 (6%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F S  L ++++ NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ +
Sbjct: 142 FTSPPLDELLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSE 201

Query: 192 -IKTHSSKI--GAR----------AVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGD 238
              T  S+I   AR          AV+L+P+RELA Q  +  K+F+  + +R+ ++ GG 
Sbjct: 202 SFSTGPSEIPENARGGYMRKAFPTAVVLAPTRELATQIFDEAKKFTYRSWVRATVVYGGA 261

Query: 239 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNEL 298
            +  Q   +    D+++ATPGR   L     + L  ++Y V DEADR+ +MGF+ Q+  +
Sbjct: 262 DVGSQMRELDRGCDLLVATPGRLNDLLERGKISLAKVKYLVLDEADRMLDMGFEPQIRHI 321

Query: 299 L--ASLPS--NRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKN 354
           +    +P   +RQTL+FSAT P  +   A+  L++ + + +      SEN+    L  ++
Sbjct: 322 VEGCDMPGVEDRQTLMFSATFPVDIQHLARDFLSDYIFLSVGRVGSTSENITQHVLYVED 381

Query: 355 DEREANLLYLL 365
           +++++ LL L+
Sbjct: 382 EDKKSALLDLI 392

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 63/100 (63%)

Query: 424 SEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 483
           ++  T++FV T+   + ++  L    +  + I+G   Q  R+R L  FR+G  ++LV T 
Sbjct: 396 TDGLTLIFVETKRMADQLTDFLIMQNFAATAIHGDRTQGERERALAAFRSGKANLLVATA 455

Query: 484 VAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRG 523
           VAARG+DIP + +VIN+ LP+    ++HR+GRT RAGN G
Sbjct: 456 VAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTG 495

>YNL112W Chr14 (413639..414911,415914..416281) [1641 bp, 546 aa]
           {ON}  DBP2Essential ATP-dependent RNA helicase of the
           DEAD-box protein family, involved in nonsense-mediated
           mRNA decay and rRNA processing
          Length = 546

 Score =  139 bits (349), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/226 (32%), Positives = 124/226 (54%), Gaps = 8/226 (3%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F   G    ++  +   GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 114 TFDEAGFPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 173

Query: 191 KIKTH---SSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMM 247
            I      +   G   ++L+P+RELA+Q      +F   +++R+  + GG     Q   +
Sbjct: 174 HINAQPLLAPGDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDL 233

Query: 248 MNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQ 307
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +  +RQ
Sbjct: 234 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 308 TLLFSATLPSSLVDFAKAGLTNPVLVR-----LDAESKISENLEML 348
           TL++SAT P  +   A   L +P+ V+     L A   I++ +E++
Sbjct: 294 TLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVV 339

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 65/107 (60%)

Query: 424 SEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 483
           +E  T++F  T+   + I++ L++ G+    I+G  DQ  R   L  FR G + I+V TD
Sbjct: 359 NEYKTLIFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATD 418

Query: 484 VAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           VAARG+D+  +  VIN+ +P + + ++HR+GRT RAG  G A S  +
Sbjct: 419 VAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 465

>Kwal_56.24588 s56 (1065225..1066766) [1542 bp, 513 aa] {ON} YDL160C
           (DHH1) - (putative) DEAD box RNA helicase [contig 161]
           FULL
          Length = 513

 Score =  138 bits (348), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 119/206 (57%), Gaps = 4/206 (1%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F  F L + ++  I + GF +P+PIQ + IP+ +  RD++  A+ G+GKTAAF++P + 
Sbjct: 30  TFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPIAIAGRDVLARAKNGTGKTAAFVIPTLE 89

Query: 191 KIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNN 250
           K++   +KI  +A+I+ P+RELA+QT  V +   K   +  ++ TGG +L D   + +N 
Sbjct: 90  KVRPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGVSCMVTTGGTNLRDDI-LRLNE 146

Query: 251 P-DVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQTL 309
           P  V++ TPGR L L      DL      V DEAD++    F+  + ++L  LP   Q+L
Sbjct: 147 PVHVLVGTPGRVLDLASRKVADLSECPLFVMDEADKMLSRDFKAIIEQILTFLPPVHQSL 206

Query: 310 LFSATLPSSLVDFAKAGLTNPVLVRL 335
           LFSAT P ++ +F    L  P  + L
Sbjct: 207 LFSATFPLTVKEFMVKHLHKPYEINL 232

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 77/150 (51%), Gaps = 7/150 (4%)

Query: 429 ILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 488
           I+F  + + VE +++ + D GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 270 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQSERNKVFHEFRQGKVRTLVCSDLLTRG 329

Query: 489 VDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKI 548
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++              G +I
Sbjct: 330 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEI 389

Query: 549 MLTPMYDSLCEIMKNKWIAEGNDESSFVNP 578
              P      +I K+ ++AE  D+S+   P
Sbjct: 390 AAIP-----AQIDKSLYVAE--DDSAVPVP 412

>Kpol_1072.50 s1072 complement(115009..116961) [1953 bp, 650 aa]
           {ON} complement(115009..116961) [1953 nt, 651 aa]
          Length = 650

 Score =  140 bits (353), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 77/251 (30%), Positives = 140/251 (55%), Gaps = 17/251 (6%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F S  L  +++ NI    F +PTP+Q+ ++P++ + RD++  A+TGSGKT  F+ P++ +
Sbjct: 162 FTSPPLDALLLENIILARFTKPTPVQKYSVPIVSRGRDLMACAQTGSGKTGGFLFPVLSE 221

Query: 192 I-------------KTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGD 238
                         K+   K    A++L+P+RELA Q ++  K+F+  + +R  ++ GG 
Sbjct: 222 SFKNGPSPMPESARKSFVKKAYPTALVLAPTRELATQIYDEAKKFTYRSWVRPTVVYGGS 281

Query: 239 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNEL 298
            +  Q   +    D+++ATPGR   L     + L +++Y V DEADR+ +MGF+ Q+ ++
Sbjct: 282 DIGSQIRDLSRGCDLLVATPGRLSDLLERGRVSLANVKYLVLDEADRMLDMGFEPQIRQI 341

Query: 299 L--ASLP--SNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKN 354
           +    +P    RQTL+FSAT P  +   A+  L++ + + +      SEN+    L  ++
Sbjct: 342 VDGCDMPPVGERQTLMFSATFPDDIQHLARDFLSDYIFLSVGKVGSTSENITQRILYVED 401

Query: 355 DEREANLLYLL 365
            ++++ LL LL
Sbjct: 402 MDKKSTLLDLL 412

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 61/98 (62%)

Query: 428 TILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 487
           T++FV T+   + ++  L    +  + I+G   Q  R+R L  F+ G  ++LV T VAAR
Sbjct: 420 TLIFVETKRMADELTDFLIMQDFRATAIHGDRTQSERERALAAFKNGNANLLVATAVAAR 479

Query: 488 GVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWA 525
           G+DIP + +V+N+ LP+    ++HR+GRT RAGN G A
Sbjct: 480 GLDIPNVTHVVNYDLPSDIDDYVHRIGRTGRAGNTGVA 517

>KLLA0C15499g Chr3 complement(1345201..1346715) [1515 bp, 504 aa]
           {ON} similar to uniprot|P20447 Saccharomyces cerevisiae
           YGL078C DBP3 Putative ATP-dependent RNA helicase of the
           DEAD-box family involved in ribosomal biogenesis
          Length = 504

 Score =  138 bits (347), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 118/197 (59%), Gaps = 3/197 (1%)

Query: 150 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGA-RAVILSP 208
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I  I T   K  + + +++SP
Sbjct: 112 FPKPTPIQAVSWPYLLAGKDVIGIAETGSGKTFAFGVPAINNIVTSGDKSSSVKVLVISP 171

Query: 209 SRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEM 268
           +RELA Q ++     +    LRS  + GG   +DQ    +    V++ATPGR L L  E 
Sbjct: 172 TRELASQIYDNLIVLTDACGLRSCCVYGGVP-KDQQREDLRRSQVVVATPGRLLDLIEEG 230

Query: 269 SLDLKSIEYAVFDEADRLFEMGFQDQLNELL-ASLPSNRQTLLFSATLPSSLVDFAKAGL 327
           S+DL  + Y V DEADR+ E GF++ + +++  +  ++RQTL+F+AT P  + + A + +
Sbjct: 231 SVDLSHVNYLVLDEADRMLEKGFEEDIKKIIRQTRSTSRQTLMFTATWPKEVRELASSFM 290

Query: 328 TNPVLVRLDAESKISEN 344
           + PV V +    ++S N
Sbjct: 291 SEPVKVSIGNRDELSAN 307

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 64/103 (62%)

Query: 428 TILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 487
            ++F   +     + + LK +GY ++ I+G L Q  R + L  F+ G  ++L+ TDVAAR
Sbjct: 343 VLIFALYKKEASRVERNLKYNGYDVAAIHGDLSQQQRTQALNEFKAGKCNLLLATDVAAR 402

Query: 488 GVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           G+DIP +  VIN + P + + ++HR+GRT RAG  G A+++ +
Sbjct: 403 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQYGTAHTLFT 445

>NCAS0B01730 Chr2 complement(286249..288105) [1857 bp, 618 aa] {ON}
           Anc_8.614
          Length = 618

 Score =  139 bits (351), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 138/253 (54%), Gaps = 18/253 (7%)

Query: 131 SFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIR 190
           +F S  L ++++ NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ 
Sbjct: 146 AFTSPPLDELLLENIKLARFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVLS 205

Query: 191 K-IKT-------------HSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTG 236
           +  KT             +  K    AVI++P+RELA Q  +  K+F   + ++  ++ G
Sbjct: 206 ESFKTGPTVVDNAQSHGYYQKKAYPTAVIMAPTRELATQIFDEAKKFCYRSWVQPCVVYG 265

Query: 237 GDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLN 296
           G  + +Q   M    D+++ATPGR   L     + L +++Y V DEADR+ +MGF+ Q+ 
Sbjct: 266 GSPIGNQMREMDRGCDLLVATPGRLSDLIDRGKISLSNVKYLVLDEADRMLDMGFEPQIR 325

Query: 297 ELLASLP----SNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLST 352
            ++          RQTL+FSAT P+ +   A+  L + + + +      SEN+    L  
Sbjct: 326 AIVEGADMTPVGERQTLMFSATFPADIQHLARDFLADYIFLSVGRVGSTSENITQRVLYV 385

Query: 353 KNDEREANLLYLL 365
           +N ++++ LL LL
Sbjct: 386 ENQDKKSALLDLL 398

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 61/98 (62%)

Query: 428 TILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 487
           T++FV T+   + ++  L    +  + I+G   Q  R+R L  FR+G  ++LV T VAAR
Sbjct: 406 TLIFVETKRMADQLTDFLIMQDFRATAIHGDRTQQERERALAAFRSGRANLLVATAVAAR 465

Query: 488 GVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWA 525
           G+DIP + +VIN+ LP     ++HR+GRT RAGN G A
Sbjct: 466 GLDIPNVTHVINYDLPGDIDDYVHRIGRTGRAGNTGVA 503

>NDAI0B00900 Chr2 complement(209012..210322) [1311 bp, 436 aa] {ON}
           Anc_5.69
          Length = 436

 Score =  136 bits (343), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 91/253 (35%), Positives = 125/253 (49%), Gaps = 14/253 (5%)

Query: 125 SKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAF 184
           S  K+ +F S GLSK +  +++     QPT IQ   IP IL+ RD +G A+TGSGKT AF
Sbjct: 2   STSKQETFKSLGLSKWLYESLSAMKITQPTAIQSACIPEILKGRDCIGGAKTGSGKTIAF 61

Query: 185 ILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQF 244
             PM+ K        G   V+L+P+RELAMQ    F        +R  ++ GG S+ +Q 
Sbjct: 62  AGPMLTKWS--EDPCGMFGVVLTPTRELAMQIAEQFTALGSSMNIRVAIVVGGQSIVEQA 119

Query: 245 GMMMNNPDVIIATPGRFLHLKVEMSLD----LKSIEYAVFDEADRLFEMGFQDQLNELLA 300
             + N P  IIATPGR  H  +    D    LK  ++ V DEAD L    F   L   + 
Sbjct: 120 IQLQNKPHFIIATPGRLAHHIMNSGEDTVGGLKRTKFLVLDEADSLLTDSFAGDLATCIG 179

Query: 301 SLP--SNRQTLLFSATLPSSL--VDFAKAGLTNPVLVRLDAES----KISENLEMLFLST 352
           +LP    RQTLLF+AT+   +  ++ A A    P +     ES     I   L+  ++  
Sbjct: 180 ALPPKHKRQTLLFTATITDQVRTLENAPAQDGKPSVFTYQVESVDKVAIPSTLKTEYILV 239

Query: 353 KNDEREANLLYLL 365
               +EA L  LL
Sbjct: 240 PEHVKEAYLYQLL 252

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 60/106 (56%)

Query: 425 EKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 484
           + + I+FV      E + + L      ++ ++  + Q  R   L+ FR     +LV TDV
Sbjct: 259 DSSAIIFVNRAMTAEVLRRTLYHLDVRVASLHSYMPQQERTNSLHRFRANAARVLVATDV 318

Query: 485 AARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVS 530
           AARG+DIP++  VIN+ +P+    FIHR GRTARAG  G A S V+
Sbjct: 319 AARGLDIPIVELVINYDIPSDPDTFIHRAGRTARAGRSGDAISFVT 364

>NDAI0C02320 Chr3 (527244..529538) [2295 bp, 764 aa] {ON} Anc_5.241
          Length = 764

 Score =  140 bits (354), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 76/201 (37%), Positives = 126/201 (62%), Gaps = 4/201 (1%)

Query: 132 FPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRK 191
           F    LS   +  +    F + T IQR++IP+ L+  D++G A+TGSGKT AF++P++ K
Sbjct: 43  FKDLPLSPPTLKGLNGAAFLKLTDIQRESIPISLKGYDVLGSAKTGSGKTLAFLIPILEK 102

Query: 192 I--KTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMN 249
           +  +  +   G  A+++SP+RELAMQ + V  +    T L + L+ GG  ++ +    ++
Sbjct: 103 LYREKWTEFDGLGALVISPTRELAMQIYEVLLKIGTYTSLSAGLVIGGKDVKFE-SERLS 161

Query: 250 NPDVIIATPGRFL-HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQT 308
             +++I TPGR L HL   ++L+  +++  V DEADR  +MGF+  L+ ++++LP++RQT
Sbjct: 162 KINILIGTPGRILQHLDQAIALNTSNLQMLVLDEADRCLDMGFKKTLDAIVSNLPASRQT 221

Query: 309 LLFSATLPSSLVDFAKAGLTN 329
           LLFSAT   SL D A+  LT+
Sbjct: 222 LLFSATQSQSLGDLARLSLTD 242

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 48/97 (49%), Gaps = 2/97 (2%)

Query: 429 ILFVPTRHHVEYISQLLK--DSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 486
           I+F+ +   V ++ +  +    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQKARTETLDKFSRAQQVCLFATDVVA 354

Query: 487 RGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRG 523
           RG+D P +  VI    P  +  +IHRVGR AR G +G
Sbjct: 355 RGIDFPSVDWVIQVDCPEDADTYIHRVGRAARYGKKG 391

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 95,068,751
Number of extensions: 4015304
Number of successful extensions: 17906
Number of sequences better than 10.0: 633
Number of HSP's gapped: 17136
Number of HSP's successfully gapped: 1129
Length of query: 991
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 872
Effective length of database: 39,836,145
Effective search space: 34737118440
Effective search space used: 34737118440
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)