Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G026008.321ON91191143460.0
NCAS0C032808.321ON81190810861e-134
TDEL0F044708.321ON8099296931e-77
Smik_12.1908.321ON8509356811e-75
Skud_12.1968.321ON8549556661e-73
YLR127C (APC2)8.321ON8539056642e-73
Suva_10.2208.321ON8549386572e-72
SAKL0H15598g8.321ON7878946312e-69
Kwal_56.239098.321ON7768885387e-57
KLTH0G12342g8.321ON7749215351e-56
CAGL0M04235g8.321ON7838855324e-56
ZYRO0F10340g8.321ON8185604512e-45
TPHA0C008308.321ON8429134112e-40
TBLA0A039208.321ON7327654021e-39
Ecym_42528.321ON6897583983e-39
KAFR0H022808.321ON8179343951e-38
AGL193W8.321ON7097423531e-33
KNAG0G024308.321ON7977073381e-31
Kpol_YGOB_Anc_8.3218.321ON5113213001e-27
KLLA0D16324g8.321ON6977342809e-25
TDEL0E037805.248ON21485706.1
KNAG0F023906.139ON51184726.3
NCAS0B055708.163ON160250726.5
Skud_12.404.32ON90891727.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G02600
         (911 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.3...  1678   0.0  
NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.3...   422   e-134
TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {O...   271   1e-77
Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {...   266   1e-75
Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {...   261   1e-73
YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON} ...   260   2e-73
Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {...   257   2e-72
SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} simi...   247   2e-69
Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {...   211   7e-57
KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} simi...   210   1e-56
CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa] ...   209   4e-56
ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {...   178   2e-45
TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.3...   162   2e-40
TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {O...   159   1e-39
Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}...   157   3e-39
KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.3...   156   1e-38
AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic ho...   140   1e-33
KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {O...   134   1e-31
Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 5...   120   1e-27
KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]...   112   9e-25
TDEL0E03780 Chr5 (712981..713625) [645 bp, 214 aa] {ON} Anc_5.24...    32   6.1  
KNAG0F02390 Chr6 complement(447686..449221) [1536 bp, 511 aa] {O...    32   6.3  
NCAS0B05570 Chr2 (1052241..1057049) [4809 bp, 1602 aa] {ON} Anc_...    32   6.5  
Skud_12.40 Chr12 (79588..82314) [2727 bp, 908 aa] {ON} YLL026W (...    32   7.1  

>NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.321
           YLR127C
          Length = 911

 Score = 1678 bits (4346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 844/911 (92%), Positives = 844/911 (92%)

Query: 1   MTPLLDTDVDLSRITESIFVSIDPQYHPQLQTMLLWLNPNETTTQSATTMTIDLKNCINI 60
           MTPLLDTDVDLSRITESIFVSIDPQYHPQLQTMLLWLNPNETTTQSATTMTIDLKNCINI
Sbjct: 1   MTPLLDTDVDLSRITESIFVSIDPQYHPQLQTMLLWLNPNETTTQSATTMTIDLKNCINI 60

Query: 61  IVSTYGKDDQIRLLFKKYYSFVIKLHFMKDNRPKNMTSIREFHKLENLYLTPLRFTYDLI 120
           IVSTYGKDDQIRLLFKKYYSFVIKLHFMKDNRPKNMTSIREFHKLENLYLTPLRFTYDLI
Sbjct: 61  IVSTYGKDDQIRLLFKKYYSFVIKLHFMKDNRPKNMTSIREFHKLENLYLTPLRFTYDLI 120

Query: 121 DTNEMQSLINIFKRYLINNNFTFRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLNDA 180
           DTNEMQSLINIFKRYLINNNFTFRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLNDA
Sbjct: 121 DTNEMQSLINIFKRYLINNNFTFRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLNDA 180

Query: 181 NGNVSPIXXXXXXXXRKIEKFCQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQF 240
           NGNVSPI        RKIEKFCQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQF
Sbjct: 181 NGNVSPIDLLLDLLLRKIEKFCQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQF 240

Query: 241 DYGDVENDHALTNLIYYFFTQQFIKIRINESLKIMVSNFPISTPTIIELKNVLITSSMPR 300
           DYGDVENDHALTNLIYYFFTQQFIKIRINESLKIMVSNFPISTPTIIELKNVLITSSMPR
Sbjct: 241 DYGDVENDHALTNLIYYFFTQQFIKIRINESLKIMVSNFPISTPTIIELKNVLITSSMPR 300

Query: 301 ENVSTTATTTFRDTNLSEEYXXXXXXXXXXXXQRKFLNPCIPTIPLIRALVKMTNSFLIL 360
           ENVSTTATTTFRDTNLSEEY            QRKFLNPCIPTIPLIRALVKMTNSFLIL
Sbjct: 301 ENVSTTATTTFRDTNLSEEYLKLFVKKFLKDFQRKFLNPCIPTIPLIRALVKMTNSFLIL 360

Query: 361 DPRGQXXXXXXXXXXXXXQRRTTDIVNILLYAMLNLNEMELHKLGCNIDFDIESFNILVS 420
           DPRGQ             QRRTTDIVNILLYAMLNLNEMELHKLGCNIDFDIESFNILVS
Sbjct: 361 DPRGQLLTTIILTLKPLIQRRTTDIVNILLYAMLNLNEMELHKLGCNIDFDIESFNILVS 420

Query: 421 ELYPTIIKSMNQNQNNPSVVPYTTAGTGTTCSNERITNDDIPYQNVKDMANANTMEYLAR 480
           ELYPTIIKSMNQNQNNPSVVPYTTAGTGTTCSNERITNDDIPYQNVKDMANANTMEYLAR
Sbjct: 421 ELYPTIIKSMNQNQNNPSVVPYTTAGTGTTCSNERITNDDIPYQNVKDMANANTMEYLAR 480

Query: 481 RKPETKPFFDLFKQYLEWVPPMNKIYDSTSKNTVVDDEETSRIRSRHAIDYLFRFFDSID 540
           RKPETKPFFDLFKQYLEWVPPMNKIYDSTSKNTVVDDEETSRIRSRHAIDYLFRFFDSID
Sbjct: 481 RKPETKPFFDLFKQYLEWVPPMNKIYDSTSKNTVVDDEETSRIRSRHAIDYLFRFFDSID 540

Query: 541 XXXXXXXXXXTEKFIHSKNYYTXXXXXXXXXXXXKEKSNSSNVPDENVKSTINTIDIMLN 600
                     TEKFIHSKNYYT            KEKSNSSNVPDENVKSTINTIDIMLN
Sbjct: 541 LLLSEYLKLLTEKFIHSKNYYTLDNNWLWCLNLLKEKSNSSNVPDENVKSTINTIDIMLN 600

Query: 601 DMKRSASYGKDKKHTKENNMVQGDIGFYPKEVSKLYWKINSTNIAKWRMNMKGDFFHLLK 660
           DMKRSASYGKDKKHTKENNMVQGDIGFYPKEVSKLYWKINSTNIAKWRMNMKGDFFHLLK
Sbjct: 601 DMKRSASYGKDKKHTKENNMVQGDIGFYPKEVSKLYWKINSTNIAKWRMNMKGDFFHLLK 660

Query: 661 YSKTAEPNHTMDIKLNRFFNELGRKGKKMELYKDKSLMEMKISFDDGRELFFDNITIEQY 720
           YSKTAEPNHTMDIKLNRFFNELGRKGKKMELYKDKSLMEMKISFDDGRELFFDNITIEQY
Sbjct: 661 YSKTAEPNHTMDIKLNRFFNELGRKGKKMELYKDKSLMEMKISFDDGRELFFDNITIEQY 720

Query: 721 DVLSLFTVEKGAAFTLEKAYDFFSGLKRGKQKLEECIQFWXXXXXXXXXXXXGCYKVLER 780
           DVLSLFTVEKGAAFTLEKAYDFFSGLKRGKQKLEECIQFW            GCYKVLER
Sbjct: 721 DVLSLFTVEKGAAFTLEKAYDFFSGLKRGKQKLEECIQFWVDKKVLYLDDDDGCYKVLER 780

Query: 781 LTFLDEIKQRKKMQEETVIKSDARMGIDHDYVQEAAEDDDIAGFETHKDVISRANDEIKN 840
           LTFLDEIKQRKKMQEETVIKSDARMGIDHDYVQEAAEDDDIAGFETHKDVISRANDEIKN
Sbjct: 781 LTFLDEIKQRKKMQEETVIKSDARMGIDHDYVQEAAEDDDIAGFETHKDVISRANDEIKN 840

Query: 841 ILDRIFPFINGMLENLGSMKLEKIHSFLKMTVPRDFEYNRIAIHQLENYLNGLVEDEKLE 900
           ILDRIFPFINGMLENLGSMKLEKIHSFLKMTVPRDFEYNRIAIHQLENYLNGLVEDEKLE
Sbjct: 841 ILDRIFPFINGMLENLGSMKLEKIHSFLKMTVPRDFEYNRIAIHQLENYLNGLVEDEKLE 900

Query: 901 TTTDGAFKKPK 911
           TTTDGAFKKPK
Sbjct: 901 TTTDGAFKKPK 911

>NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.321
           YLR127C
          Length = 811

 Score =  422 bits (1086), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 289/908 (31%), Positives = 462/908 (50%), Gaps = 101/908 (11%)

Query: 5   LDTDVDLSRITESIFVSIDPQYHPQLQTMLLWLNPNETT-TQSATTMTIDLKNCINIIVS 63
           +  D DL  I  S+   ++ Q+HPQL+++LLWL+PN +  T+     T++LK+CIN++ +
Sbjct: 1   MSLDADLPTIITSLREQVERQFHPQLESLLLWLDPNSSKGTRQNKPPTLELKDCINLLRA 60

Query: 64  TYGKDDQIRLLFKKYYSFVIKLHFMKDNRPKNMTSIREFHKLENLYLTPLRFTYDLIDTN 123
            Y +D++ ++  ++YY +V+K HFMK+     ++ +++F  LE +Y+ PL+F  DL+D+ 
Sbjct: 61  GYSQDEKFKMWLREYYLYVVKFHFMKN--VDEISVLKDFKLLEMIYIYPLQFM-DLVDST 117

Query: 124 EMQSLINIFKRYLINNNFTFRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLNDANGN 183
           ++ +L+  FK YLI+ N TFRKN++   +  FL  +QFEF+Y   ++ EI+ W+ D+ G 
Sbjct: 118 DISNLVKSFKHYLIDKNVTFRKNLITKFKDCFLVGNQFEFEYEFANIVEIIHWIQDSEGV 177

Query: 184 VSPIXXXXXXXXRKIEKFCQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQFDYG 243
           +S           KIE F + +M G  N +FI+ME FN FI+ YWK +++L        G
Sbjct: 178 LSATDLILDASLTKIEIFAREQMIGKLNQKFIVMETFNKFIDIYWKNLTQLI-------G 230

Query: 244 DVENDHALTNLIYYFFTQQFIKIRINESLKIMVSNFPISTPTIIELKNVLITSSMPRENV 303
           ++E+DH LTNLIY FF +QFIKIRI E L IMV ++P + PTI+ELK++L      ++N 
Sbjct: 231 NIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQDYPQTKPTILELKSIL-----SKQNS 285

Query: 304 STTATTTFRDTNLSEEYXXXXXXXXXXXXQRKFLNPCIPTIPLIRALVKMTNSFLILDPR 363
           ST      +     +E+            +R+FLNPCIPTI ++ A VK T SFL+LDP 
Sbjct: 286 STAGAR--KRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTIDVLNAYVKATKSFLLLDPS 343

Query: 364 GQXXXXXXXXXXXXXQRRTTDIVNILLYAMLNLNEMELHKLGC-NIDFDIESFNILVSEL 422
           G              +    ++V+ILLYA+LNL   +L +L C    +D+ S  +L  EL
Sbjct: 344 GSLLNSIVIFVKPYLRSNEVEMVDILLYALLNLKSKDLIELNCEKTTYDMRSIELLSKEL 403

Query: 423 YPTIIKSMNQNQNNPSVVPYTTAGTGTTCSNERITNDDIPYQNVKDMANANTMEYLARRK 482
                   N +  +   V Y       T   E   N  +PY+ V                
Sbjct: 404 -------SNDHSKHAGDVDYKKFSPEGTNEFE---NSTLPYEQV---------------- 437

Query: 483 PETKPFFDLFKQYLEWVPPMNKIYDSTSKNTVVDDEETSRIRSRHAIDYLFRFFDSIDXX 542
                    +  +L W P +  I +S++     DDE  S  ++   IDY+F   +S D  
Sbjct: 438 ---------YTDFLNWKPSITPISESSN-----DDEFASLGKNITPIDYVFNALESKDKL 483

Query: 543 XXXXXXXXTEKFIHSKNYYTXXXXXXXXXXXXKEKSNSSN-VPDENVKSTINTIDIMLND 601
                   T K +H K Y               + ++  N V DE++ S INTI IML+D
Sbjct: 484 ISEFLKLLTIKLLHMKGYEVEDRWQKCLKILQDKVTSDKNIVNDESITSDINTILIMLHD 543

Query: 602 MKRSASYGKDKKHTKENNMVQGDIGFYPKEVSKLYWKINSTNIAKWRMNMKGDFFHLLKY 661
           +  S     +K    +N+    ++  +PK +SKLYWK    +  ++ ++ K     L KY
Sbjct: 544 ISISKESSNEKISEFQNS---SEMQLFPKFISKLYWKFKRQSEYQFPLDSKLR-KKLSKY 599

Query: 662 SKTAEPNHTMDIKLNRFFNELGRKGKKMELYKDKSLMEMKISFDDGRELFFDNITIEQYD 721
            K+   +H                G K++L     +  + ++F DGR+L  D  T EQY 
Sbjct: 600 MKSYHHSHP---------------GMKLKLVNGTGICSLNLTFKDGRKLSVD-ATFEQYT 643

Query: 722 VLSLFTVEKGAAFTLEKAYDFFSGLKRGKQKLEECIQFWXXXXXXXXXXXXGCYKVLERL 781
           VLS F  +K  +  +       + LK   +++   +QFW             C++  +  
Sbjct: 644 VLSAFHNDKDDSSQVLSINQLSTMLKMDPERVRAHLQFWINKKVL-------CHQN-DYY 695

Query: 782 TFLDEIKQRKKMQEETVIKSDARMGIDHDYVQEAAEDDDIAGFETHKDVISRANDEIKNI 841
           T  + +  ++     TVI S + + +  + +               + V +   ++ K I
Sbjct: 696 TIQEYLNNQELSSGPTVITS-SILPLSQERM------------PFKRSVPTNVLNDPKEI 742

Query: 842 LDRIFPFINGMLENLGSMKLEKIHSFLKMTVPRDFEYNRIAIHQLENYLNGLVEDEKLET 901
           L R++P+IN M  NLGS+K++KIHSFL M+VPR   Y+++ + QLE YL+ LVE+E+L  
Sbjct: 743 LHRVYPYINDMFTNLGSLKVDKIHSFLNMSVPRGLHYSKVTVTQLEAYLDQLVEEEQLIV 802

Query: 902 TTDGAFKK 909
             DG+FKK
Sbjct: 803 LPDGSFKK 810

>TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {ON}
           Anc_8.321 YLR127C
          Length = 809

 Score =  271 bits (693), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 243/929 (26%), Positives = 414/929 (44%), Gaps = 176/929 (18%)

Query: 18  IFVSIDPQYHPQLQTMLLWLNPNET-TTQSATTMTIDLKNCINIIVSTY-------GKDD 69
           + + + P     L+ +L WLNPNE+ +        + LK+ I + V+ Y       G D 
Sbjct: 19  VALRLHPGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIKLFVNQYYNSGYISGSDG 78

Query: 70  QIRL--------LFKKYYSFVIKLHFMKDNRPKNMTSIREFHKLENLYLTPLRFTYDLID 121
           +I            +++Y + +++HF        + + ++  +LE  Y++PL + + L +
Sbjct: 79  EINKGPEFELGNQLRQFYIYQVRIHFFTSFNL--IQTFKDIQRLEKYYVSPLAYIH-LFE 135

Query: 122 TNEMQSLI--NIFKRYLINNNFTFRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLND 179
           ++  + +I  +  + YL+N N  F  N+   ME+LF+ +D   F+Y    + E++ W+  
Sbjct: 136 SSGYEWIIERDGLRHYLLNRNMEFHNNMKQRMESLFMQDD---FEY----VAEMLDWVEK 188

Query: 180 ANGNVSPIXXXXXXXXRKIEKFCQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQ 239
           A+ ++S           K+++FC   M G++   +++M+ FN FI +YW   ++L     
Sbjct: 189 AHTSLSSKDILLDLIIAKVKQFCDDHMMGVYGKTYLVMKTFNKFIIKYWSNFAQLL---- 244

Query: 240 FDYGDVENDHALTNLIYYFFTQQFIKIRINESLKIMVSNFPISTPTIIELKNVLITSSMP 299
              G  ++DH LTN++Y  F +QFI+IR  E   I V+ FP S PTIIE++  LIT S  
Sbjct: 245 ---GCPQDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRK-LITHSTD 300

Query: 300 RENVSTTATTTFRDTNLSEEYXXXXXXXXXXXXQRKFLNPCIPTIPLIRALVKMTNSFLI 359
            + +     +TF                     ++K LNP + T   + A VK   +FL 
Sbjct: 301 FKTIVIAFLSTF---------------------EKKVLNPSVTTTDALLAYVKSVKAFLT 339

Query: 360 LDPRGQXXXXXXXXXXXXXQRRTTDIVNILLYAMLNLNEMELHKLGCNIDFDIESFNILV 419
           LDP G+             Q R+ D+V ILLYA+L+L    L  +G +I  D        
Sbjct: 340 LDPSGRYLQSVISFVKQTFQERS-DLVVILLYAILDLQLDGL--VGSHIQVD-------- 388

Query: 420 SELYPTIIKSMNQNQNNPSVVPYTTAGTGTTCSNERITNDDIPYQNVKDMANANTMEYLA 479
               P  +K++     +P +                I ND  P  N+ ++A       +A
Sbjct: 389 ----PVCLKALASELRDPEL---------------GIENDIYPDDNLANVATG-----MA 424

Query: 480 RRKPE-TKPFFDLFKQYLEWVP-PMNKIYDSTSKNTVVDDEETSRIRSRHAIDYLFRFFD 537
           +   E   P+ ++ +++L W P P +    + SK +               +D L   F+
Sbjct: 425 KLNYEGCLPYEEVMQRFLSWNPDPRDMAPRAISKQSP---------SHMSLLDILMELFE 475

Query: 538 SIDXXXXXXXXXXTEKFIHSKNY---------------YTXXXXXXXXXXXXKEKSNSSN 582
           S D          T++ +  K Y                              +++NS  
Sbjct: 476 SKDFFVSEFLKLLTKRLLSLKFYNLDRNWSKCLQLLKKKLARGAPNISLAPTGQQNNSER 535

Query: 583 VPDENVKSTINTIDIMLNDMKRSASYGKDKKHTKENNMVQG-DIGFYPKEVSKLYWKINS 641
             D    S IN+ D+ML D+K S          K+ + V G D   YPK +S LYW    
Sbjct: 536 GDD---YSNINSNDVMLWDVKLSYEL------CKQMHQVSGLDQRIYPKFISYLYWNC-- 584

Query: 642 TNIAKWRMNMKGDFFHLLKYSKTAEPNHTMDIKLNRFFNELGRKGKKMELYKDKSLMEMK 701
                 ++  K DF       +  EP ++   K +R ++E+ + G+ ++L KD+ ++E+ 
Sbjct: 585 ------QLESKNDF-------EIPEPLNSEFEKYSRVYSEV-KAGRALKLLKDQGVIELD 630

Query: 702 ISFDDGRELFFDNITIEQYDVLSLFTVEKGAAFTLEKAYDFFSGLKRGKQKLEECIQFWX 761
           + F DGR L  D +T+EQY V+  F  +  A   + +    +  ++  + K    +QFW 
Sbjct: 631 LEFKDGRVLQCD-VTLEQYAVIQQFDEDSYANRLMAETISLYLNMEISRVK--SALQFWV 687

Query: 762 XXXXXXXXXXXGCYKVLERLTFLDEIKQRKKMQEETVIKSDARMGIDHDYVQEAAEDDDI 821
                        Y+V       D     ++ ++++ IK+              A+ D +
Sbjct: 688 EKGV--------LYQV-------DAFYATQESRQDSNIKT--------------AKSDSV 718

Query: 822 AGFETHKDVISRANDEIKNILDRIFPFINGMLENLGSMKLEKIHSFLKMTVPRDFEYNRI 881
             F    + I      +   L+ I+PF+ GML NLGS+K  KIHSFLK+TVP++  Y  +
Sbjct: 719 GSFFEKNETIIEEETTLSKTLNAIWPFVQGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVV 778

Query: 882 AIHQLENYLNGLVEDEKLETTTDGAFKKP 910
              QLE+YLN LVE+E+L  TT G++K P
Sbjct: 779 TQSQLESYLNSLVEEERLACTTSGSYKLP 807

>Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {ON}
           YLR127C (REAL)
          Length = 850

 Score =  266 bits (681), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 253/935 (27%), Positives = 414/935 (44%), Gaps = 183/935 (19%)

Query: 30  LQTMLLWLNPNET-TTQSATTMTIDLKNCINII------VSTYG---------------- 66
           L ++L+W +PN+  +       ++ +KN I ++       S Y                 
Sbjct: 34  LNSLLIWTSPNDPKSNHQLRPPSLRIKNIIKVLFPNSASTSPYSVVNTGQTSNSIVNEGN 93

Query: 67  --KDDQIRLL--FKKYYSFVIKLHFMKDNRPKNMTSIREFHKLENLYLTPLRFT--YDLI 120
             K+ Q++LL   K+YY F ++ HF   +  +N+  +++  + EN Y  PLR+   +DL 
Sbjct: 94  TNKELQLQLLSTLKEYYIFQVRYHFF--SHFENINYLKDIQRWENYYEFPLRYVPIFDL- 150

Query: 121 DTNEMQSLINIFKRYLINNNFTFRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLNDA 180
           D N     +N  + YL+N N  F+ N+   ++ L + +D F+   N+      + WLN A
Sbjct: 151 DINGWSLELNSLRHYLLNRNMKFKNNLRTRLDKLIM-DDDFDLADNL------IQWLNSA 203

Query: 181 NGNVSPIXXXXXXXXRKIEKFCQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQF 240
           +G++S +         KI KFC+  M+G+WN RF+IME FN FINQYW   SKL      
Sbjct: 204 DGSLSSMELIVNALFNKINKFCEDTMSGVWNKRFMIMETFNKFINQYWSQFSKLI----- 258

Query: 241 DYGDVENDHALTNLIYYFFTQQFIKIRINESLKIMVSNFPISTPTIIELKNVLITSSMPR 300
             G  E+DH LT  ++  F   F++IR  E   I V  +P S  T++ELK ++       
Sbjct: 259 --GCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKVTLLELKKIM-KDFKDY 315

Query: 301 ENVSTTATTTFRDTNLSEEYXXXXXXXXXXXXQRKFLNPCIPTIPLIRALVKMTNSFLIL 360
            N+ TT  + F+                     +  LNP I T+  +   VK   +FL+L
Sbjct: 316 ANIVTTFLSDFK---------------------KYILNPSITTVDALLRYVKTIKAFLVL 354

Query: 361 DPRGQXXXXXXXXXXXXXQRRTTDIVNILLYAMLNLNEMELHKLGCNIDFDIESFNILVS 420
           DP G+             Q R   +V++LLYAML+L E EL K       DI++   LV 
Sbjct: 355 DPTGRCLHSITTFVKPYFQER-KHLVDLLLYAMLDLPEEEL-KEKITFKVDIKALISLVD 412

Query: 421 ELYPTIIKS----MNQNQNNPSVVPYTTAGTGTTCSNERITNDDIPYQNVKDMANANTME 476
            L+ + I      M +N+N            G    N ++   + P    + M   + + 
Sbjct: 413 TLHDSDISQFTNVMKRNKNK----------KGPFLWNLKVKGKNGPSPTSQTMIYQHILN 462

Query: 477 YLARRKPETKPFFDLFKQYLEWVPPMNKIYDSTSKNTVVDDEETSRIRSRHAIDYLFRFF 536
           Y                 YL WVP  N +   + K++ +           +  + L   F
Sbjct: 463 Y-----------------YLTWVPEPNDMIPGSVKSSCI---------KTNLFEVLLDLF 496

Query: 537 DSIDXXXXXXXXXXTEKFIHSKNYYTXXXXXXXXXXXXKEK----SNSSNV--------- 583
           +S +          T++    K +Y             +EK      +S+V         
Sbjct: 497 ESREFFISEFRNLLTDRLFTLK-FYKLDDKWTQCLKLIREKVVKFRETSHVNYITNGILG 555

Query: 584 ------PDENV-KSTINTIDIMLNDMKRSASYGKDKKHTKENNMVQGDIGFYPKEVSKLY 636
                 P  +  +S +N+ID+ML D+K S    +     K + +   D   +PK +S LY
Sbjct: 556 LPETTAPSADADQSNLNSIDVMLWDIKCSEELCR-----KMHEVAGLDPAIFPKFISLLY 610

Query: 637 WKINSTNIAKWRMNMKGDFFHLLKYSKTAEPNHTMDIKLNRFFNELGRKGKKMELYKDKS 696
           WK N    +   +      FHL  + K          K +  +++L + G+K++L KD+ 
Sbjct: 611 WKYNCDMQSSNELT-----FHLPIHLKKELQ------KYSDVYSQL-KPGRKLQLCKDQG 658

Query: 697 LMEMKISFDDGRELFFDNITIEQYDVLSLF--TVEKGAAFTLEKAYDFFSGLKRGKQKLE 754
            +E++++F DGR+L  D +++EQ  V++ F  T  K  + TLE+  D    L     +L 
Sbjct: 659 KVEIELNFKDGRKLVLD-VSLEQCSVINQFDSTDNKSISLTLEQLSD---SLNITPPRLV 714

Query: 755 ECIQFWXXXXXXXXXXXXGCYKVLERL-TFLDEIKQRKKMQEETVIKSDARMGIDHDYVQ 813
             + FW            G Y V+E   T  D++ +   M+ E     +   G+ ++   
Sbjct: 715 HLLDFW--IQKGVISKENGVYSVIENCETDFDKVHKDIPMETE-----NNNRGLRNE--- 764

Query: 814 EAAEDDDIAGFETHKDVISRANDEIKNILDRIFPFINGMLENLGSMKLEKIHSFLKMTVP 873
                             S A  + +  L R  PFI GML NLG+MKL KIHSFLK+TVP
Sbjct: 765 ------------------SEAERKCELTLQRSLPFIEGMLANLGAMKLNKIHSFLKITVP 806

Query: 874 RDFEYNRIAIHQLENYLNGLVEDEKLETTTDGAFK 908
           +D+ YNR+++ QLE YL+ L ++ +L+   +G+++
Sbjct: 807 KDWGYNRVSLQQLEQYLSALADEGRLKYIANGSYE 841

>Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score =  261 bits (666), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 261/955 (27%), Positives = 421/955 (44%), Gaps = 213/955 (22%)

Query: 30  LQTMLLWLNPNET-TTQSATTMTIDLKNCI------NIIVSTYG---------------- 66
           L ++L+W++PN+  +       ++ +KN I      N+  S+YG                
Sbjct: 34  LNSLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLFPNNVSTSSYGVINSGQTINAVAGEGN 93

Query: 67  --KDDQIRLL--FKKYYSFVIKLHFMKDNRPKNMTSIREFHKLENLYLTPLRFT--YDLI 120
             K+ Q++LL   K+YY F ++ HF    R  ++  +++  + EN Y  PLR+   +DL 
Sbjct: 94  TNKELQLQLLSTLKEYYVFQVRYHFFL--RFNDIIYLKDIQRWENYYEFPLRYVPIFDL- 150

Query: 121 DTNEMQSLINIFKRYLINNNFTFRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLNDA 180
             N+    +N  + Y++N N  F+ N+   +  L + +D F+   N+      + WLN A
Sbjct: 151 SVNDWSLELNSLRHYMLNRNIKFKNNLRVRLNKLIM-DDDFDLAGNL------IRWLNFA 203

Query: 181 NGNVSPIXXXXXXXXRKIEKFCQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQF 240
           NG++S +         KIEKFC+  M+G+WN RF+IME FN FINQYW    +L      
Sbjct: 204 NGSLSSMELIVNALFNKIEKFCEANMSGVWNKRFMIMETFNKFINQYWSQFCELICCP-- 261

Query: 241 DYGDVENDHALTNLIYYFFTQQFIKIRINESLKIMVSNFPISTPTIIELKNVLITSSMPR 300
                E+DH LT  ++  F   F++IR  E   I V  +P S   ++ELK ++       
Sbjct: 262 -----EDDHELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKVALLELKKIM------- 309

Query: 301 ENVSTTATTTFRD-TNLSEEYXXXXXXXXXXXXQRKFLNPCIPTIPLIRALVKMTNSFLI 359
                     F+D TN+  ++            ++  LNP I T+  +   VK   +FL+
Sbjct: 310 --------KDFKDYTNIVTKFLSDF--------KKYILNPSITTVDALLRYVKTIKAFLV 353

Query: 360 LDPRGQXXXXXXXXXXXXXQRRTTDIVNILLYAMLNLNEMELHKLGCNIDFDIESFNILV 419
           LDP G+             Q R   +VN+LLYAML+L E EL K       D+++   LV
Sbjct: 354 LDPTGRCLHSIITFVKPYFQERK-HLVNVLLYAMLDLPEEEL-KEKITFKVDMKALLSLV 411

Query: 420 SELYPTII-------KSMNQNQNNPSVVPYTTAGTGTTCSNERITNDDIPYQNVKDMANA 472
             L+   I       KS ++N+ +P +      G       ++ TN+D P          
Sbjct: 412 DILHDYDIGQNTDAHKSKDKNKRSPFLWNLKVKG-------KKETNED-P---------- 453

Query: 473 NTMEYLARRKPETKPFFDLFKQYLEWVPPMNKIYDSTSKNTVVDDEETSRIRSRHAIDYL 532
                LAR   +T  +  +   YL WVP  N I   + K++ +           +  + L
Sbjct: 454 -----LAR---QTMLYEHVLNHYLTWVPEPNDIIPGSVKSSYI---------KTNLFEIL 496

Query: 533 FRFFDSIDXXXXXXXXXXTEKFIHSKNYYTXXXXXXXXXXXXKEK------SNSSN---- 582
              F+S +          T++ + S  +Y             +E+      +N +N    
Sbjct: 497 LDLFESREFFISEFRNLLTDR-LSSLKFYKLDDKWSQCLKLIRERIVKFTETNHANYITN 555

Query: 583 ----VPDENV------KSTINTIDIMLNDMKRSASYGKDKKHTKENNMVQGDIGFYPKEV 632
               +P+         +S +N+ID+ML D+K S    +     K + +   D   +PK +
Sbjct: 556 GILGLPETTAPAADADQSNLNSIDVMLWDIKCSEELCR-----KMHEVAGLDPTVFPKFI 610

Query: 633 SKLYWKIN--STNIAKWRMNMKGDF-FHLLKYSKTAEPNHTMDIKLNRFFNELGRKGKKM 689
           S LYWK N  + N    +  +  D    L KYS         DI     ++++ + G+++
Sbjct: 611 SLLYWKHNGDTQNPKDSKFRIPADLERELQKYS---------DI-----YSQM-KPGRRL 655

Query: 690 ELYKDKSLMEMKISFDDGRELFFDNITIEQYDVLSLFTVEKGAAFTLEKAYDFFSGLKRG 749
           +L KD+  +EM++SF DGR+L  D +++EQY V++ F         L         L   
Sbjct: 656 QLCKDQGKVEMELSFRDGRKLVLD-VSLEQYSVMNQFNSTNDEPINLSLK-QLSESLNIT 713

Query: 750 KQKLEECIQFWXXXXXXXXXXXXGCYKVLERLTFLDEIKQRKKMQEETVIKSDARMGIDH 809
             KL + + FW                            Q+  + EE  + S        
Sbjct: 714 TSKLLQLLNFWI---------------------------QKGVLSEEGEVYS-------- 738

Query: 810 DYVQEAAEDDDIAGFETHKDVISR---ANDEIKN----------ILDRIFPFINGMLENL 856
                  E  D    +T KDV+ +    N+E+++           L R  PFI GML NL
Sbjct: 739 -----VIEYSDTGFSQTQKDVLMKNVNNNNELRDESEVEKKCELTLQRSLPFIEGMLANL 793

Query: 857 GSMKLEKIHSFLKMTVPRDFEYNRIAIHQLENYLNGLVEDEKLETTTDGAFKKPK 911
           G+MKL KIHSFLK+TVP+D+ YNRI + QLE YLN L ++ KL+   +G+++  K
Sbjct: 794 GAMKLNKIHSFLKITVPKDWGYNRITLLQLEKYLNTLTDEGKLKYIANGSYEIAK 848

>YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON}
           APC2Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; component of the catalytic core of the
           APC/C; has similarity to cullin Cdc53p
          Length = 853

 Score =  260 bits (664), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 246/905 (27%), Positives = 397/905 (43%), Gaps = 159/905 (17%)

Query: 37  LNPNETTTQSATTMTIDLKNCINIIVSTYGKDDQIRLL--FKKYYSFVIKLHFMKDNRPK 94
           L PN  TT   + +     N   +      K+ Q++L    K++Y F ++ HF       
Sbjct: 66  LFPNNATTSPYSMINTSQANNSIVNEGNTNKELQLQLFSTLKEFYIFQVRYHFFL--HFN 123

Query: 95  NMTSIREFHKLENLYLTPLRFT--YDLIDTNEMQSLINIFKRYLINNNFTFRKNVLHSME 152
           N+  +++  + EN Y  PLR+   +D ++ N+    +N  + YL+N N  F+ N+   ++
Sbjct: 124 NINYLKDIQRWENYYEFPLRYVPIFD-VNVNDWALELNSLRHYLLNRNIKFKNNLRTRLD 182

Query: 153 TLFLTEDQFEFQYNMNSLNEIVIWLNDANGNVSPIXXXXXXXXRKIEKFCQREMAGLWNG 212
            L + +D F+   N+      + WL  ANG++S           KI KFC+  M+ +WN 
Sbjct: 183 KLIM-DDDFDLADNL------IQWLKSANGSLSSTELIVNALYSKINKFCEDNMSRVWNK 235

Query: 213 RFIIMEKFNLFINQYWKLISKLFHHQQFDYGDVENDHALTNLIYYFFTQQFIKIRINESL 272
           RF+IME FN FINQYW   SKL        G  E+DH LT  ++  F   F++IR NE  
Sbjct: 236 RFMIMETFNKFINQYWSQFSKLV-------GCPEDDHELTTTVFNCFESNFLRIRTNEIF 288

Query: 273 KIMVSNFPISTPTIIELKNVLITSSMPRENVSTTATTTFRDTNLSEEYXXXXXXXXXXXX 332
            I V  +P S  T++EL+ ++        N+ TT  + F+                    
Sbjct: 289 DICVLAYPDSKVTLLELRKIM-KDFKDYTNIVTTFLSDFK-------------------- 327

Query: 333 QRKFLNPCIPTIPLIRALVKMTNSFLILDPRGQXXXXXXXXXXXXXQRRTTDIVNILLYA 392
            +  LNP + T+  +   VK   +FL+LDP G+             Q R   +VN+LLYA
Sbjct: 328 -KYILNPSVTTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERK-HLVNVLLYA 385

Query: 393 MLNLNEMELHKLGCNIDFDIESFNILVSELYP------TIIKSMNQNQNNPSVVPYTTAG 446
           ML+L E EL K   N + D+++   LV  L+       T I   ++N+ +P +      G
Sbjct: 386 MLDLPEEEL-KEKINFNVDMKALLSLVDTLHDSDINQDTNITKRDKNKKSPFLWNLKVKG 444

Query: 447 TGTTCSNERITNDDIPYQNVKDMANANTMEYLARRKPETKPFFDLFKQYLEWVPPMNKIY 506
                  +R  N D+P ++   M   + + Y                 Y+ WVP  N + 
Sbjct: 445 -------KRELNKDLPIRHA--MLYEHILNY-----------------YIAWVPEPNDMI 478

Query: 507 DSTSKNTVVDDEETSRIRSRHAIDYLFRFFDSIDXXXXXXXXXXTEKFIHSKNYYTXXXX 566
               K++ +           +  + L   F+S +          T++    K +YT    
Sbjct: 479 PGNIKSSYI---------KTNLFEVLLDLFESREFFISEFRNLLTDRLFTLK-FYTLDEK 528

Query: 567 XXXXXXXXKEK------SNSSN-------------VPDENV-KSTINTIDIMLNDMKRSA 606
                   +EK      ++ SN              P  +  +S +N+ID+ML D+K S 
Sbjct: 529 WTRCLKLIREKIVKFTETSHSNYITNGILGLLETTAPAADADQSNLNSIDVMLWDIKCSE 588

Query: 607 SYGKDKKHTKENNMVQGDIGFYPKEVSKLYWKINSTNIAKWRMNMKGDFFHLLKYSKTAE 666
              +     K + +   D   +PK +S LYWK N             D    L      E
Sbjct: 589 ELCR-----KMHEVAGLDPIIFPKFISLLYWKYNCDTQGS------NDLAFHLPIDLERE 637

Query: 667 PNHTMDIKLNRFFNELGRKGKKMELYKDKSLMEMKISFDDGRELFFDNITIEQYDVLSLF 726
                DI     +++L + G+K++L KDK  +E++++F DGR+L  D +++EQ  V++ F
Sbjct: 638 LQKYSDI-----YSQL-KPGRKLQLCKDKGKVEIQLAFKDGRKLVLD-VSLEQCSVINQF 690

Query: 727 TV--EKGAAFTLEKAYDFFSGLKRGKQKLEECIQFWXXXXXXXXXXXXGCYKVLERLTFL 784
               ++    +LE+  +    L     +L   + FW            G Y V+E     
Sbjct: 691 DSPNDEPICLSLEQLSE---SLNIAPPRLTHLLDFWIQKGVLLKEN--GTYSVIEH---- 741

Query: 785 DEIKQRKKMQEETVIKSDARMGIDHDYVQEAAE-DDDIAGFETHKDVISRANDEIKNILD 843
                                 +D D  Q+ A  + + + +E H D  S    + +  L 
Sbjct: 742 --------------------SEMDFDQAQKTAPMEIENSNYELHND--SEIERKYELTLQ 779

Query: 844 RIFPFINGMLENLGSMKLEKIHSFLKMTVPRDFEYNRIAIHQLENYLNGLVEDEKLETTT 903
           R  PFI GML NLG+MKL KIHSFLK+TVP+D+ YNRI + QLE YLN L ++ +L+   
Sbjct: 780 RSLPFIEGMLTNLGAMKLHKIHSFLKITVPKDWGYNRITLQQLEGYLNTLADEGRLKYIA 839

Query: 904 DGAFK 908
           +G+++
Sbjct: 840 NGSYE 844

>Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score =  257 bits (657), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 255/938 (27%), Positives = 422/938 (44%), Gaps = 179/938 (19%)

Query: 30  LQTMLLWLNPNET-TTQSATTMTIDLKNCI------NIIVSTYG---------------- 66
           L ++L+W++P++  +       ++ +KN I      N   S+YG                
Sbjct: 34  LNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLFPNNACTSSYGAMNTAQANNSIVNEGN 93

Query: 67  --KDDQIRLL--FKKYYSFVIKLHFMKDNRPKNMTSIREFHKLENLYLTPLRFT--YDLI 120
             K+ Q++ +  FK+YY F ++ HF       ++  +++  + EN Y  PLR+   +DL 
Sbjct: 94  TNKELQLQFISTFKEYYIFQVRYHFFL--HFSSINYLKDIQRWENYYEFPLRYVSIFDL- 150

Query: 121 DTNEMQSLINIFKRYLINNNFTFRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLNDA 180
           + N     +N  + YL+N N  F+ N+   +  L + +D F+   N+      + WLN A
Sbjct: 151 NVNGWTLELNSLRHYLLNRNTKFKNNLRTRLNKLII-DDDFDLASNL------IRWLNSA 203

Query: 181 NGNVSPIXXXXXXXXRKIEKFCQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQF 240
           NG++S +         KI  FC+  M+G+WN RF+IME FN FINQYW   S+L      
Sbjct: 204 NGSLSSMDLIVNALFDKISMFCEINMSGVWNKRFMIMETFNKFINQYWSQFSELI----- 258

Query: 241 DYGDVENDHALTNLIYYFFTQQFIKIRINESLKIMVSNFPISTPTIIELKNVLITSSMPR 300
             G  E+DH LT  ++  F   F++IR  E   I V  +P S  T++ELK ++       
Sbjct: 259 --GCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKITLLELKKIM-KDFKDY 315

Query: 301 ENVSTTATTTFRDTNLSEEYXXXXXXXXXXXXQRKFLNPCIPTIPLIRALVKMTNSFLIL 360
            N+ TT  + F+                     +  LNP I T+  + + VK   +FL+L
Sbjct: 316 TNIVTTFLSDFK---------------------KHILNPSITTVDALLSYVKTIKAFLVL 354

Query: 361 DPRGQXXXXXXXXXXXXXQRRTTDIVNILLYAMLNLNEMELHKLGCNIDFDIESFNILVS 420
           DP G+             Q R   +VN+LLYA+L+L E EL K   +   D+++  +LV 
Sbjct: 355 DPTGRCLHSITTFVKPYFQER-KHLVNVLLYAILDLPEEEL-KEKISFKVDMKALLLLVE 412

Query: 421 ELYPTIIKSMNQNQNNPSVVPYTTAGTGTTCSNERITNDDIPYQ-NVKDMANANTMEYLA 479
            L+ + I  +                T T  S ++      P+  +VK     N    + 
Sbjct: 413 TLHDSDIDQI----------------TNTPKSKDKNKGGSFPWNLHVKGKKEKNGSSSIT 456

Query: 480 RRKPETKPFFDLFKQYLEWVPPMNKIYDSTSKNTVVDDEETSRIRSRHAIDYLFRFFDSI 539
               ++  +  +   YL WVP  N +     K        +S I++ +  + L   F+S 
Sbjct: 457 ----QSMLYEHILNYYLTWVPEPNDMIPGNIK--------SSSIKT-NLFEVLLDLFESR 503

Query: 540 DXXXXXXXXXXTE-----KFIHSKNYYTXXXXXXXXXXXXKEKSNSSN------------ 582
           +          T+     KF    N ++              ++N +N            
Sbjct: 504 EFFISEFRNLLTDRLFTLKFYKLDNKWSRCLKLIREKIVKSTETNQTNYIANGIIGLPQT 563

Query: 583 -VPDENVK-STINTIDIMLNDMKRSASYGKDKKHTKENNMVQGDIGFYPKEVSKLYWKIN 640
             P  +   S IN+ID+ML D+K S     ++   K + +   D   YPK +S LYWK N
Sbjct: 564 TAPAADADLSNINSIDVMLWDIKCS-----EELCLKMHEVAGLDPAIYPKFISLLYWKHN 618

Query: 641 --STNIAKWRMNMKGDFFH-LLKYSKTAEPNHTMDIKLNRFFNELGRKGKKMELYKDKSL 697
             + N  +   ++ G+  + L KYS         DI     +++L + G+K++L KD+  
Sbjct: 619 GDTNNANELTFHLPGNLENELQKYS---------DI-----YSQL-KPGRKLQLCKDQGK 663

Query: 698 MEMKISFDDGRELFFDNITIEQYDVLSLFTVEKGAA--FTLEKAYDFFSGLKRGKQKLEE 755
           +EM++ F+DGR+L  D +++EQ  V++ F    G     +LE+  +    L     +L +
Sbjct: 664 IEMELDFNDGRKLVLD-VSLEQCSVINQFNSTDGEPIYLSLEQLSE---PLNIAPARLLD 719

Query: 756 CIQFWXXXXXXXXXXXXGCYKVLE--RLTFLDEIKQRKKMQEETVIKSDARMGIDHDYVQ 813
            + FW            G Y V+E  R  F            +T I+   +   +++ ++
Sbjct: 720 LLNFW--IQRGVLSEENGVYSVIEYSRTDF-----------NQTQIEFPMKNENNNNELR 766

Query: 814 EAAEDDDIAGFETHKDVISRANDEIKNILDRIFPFINGMLENLGSMKLEKIHSFLKMTVP 873
           +  E                   + + IL+R  PFI GML NLG+MKL KIHSFLK+TVP
Sbjct: 767 DETE----------------VERKCELILERSLPFIEGMLANLGAMKLNKIHSFLKITVP 810

Query: 874 RDFEYNRIAIHQLENYLNGLVEDEKLETTTDGAFKKPK 911
           +++ YNRI + QLE YLN L ++ KL+  T+G+++  K
Sbjct: 811 KNWGYNRITLLQLEKYLNVLADEGKLKYITNGSYELEK 848

>SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 787

 Score =  247 bits (631), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 231/894 (25%), Positives = 391/894 (43%), Gaps = 139/894 (15%)

Query: 23  DPQYHPQLQTMLLWLNPNE-TTTQSATTMTIDLKNCINIIVSTYGKDDQIRLLFKKYYSF 81
           +P    +L  +L WLNPNE  +       ++ LKN I ++V+          L +++   
Sbjct: 22  NPNLEDELDGVLTWLNPNEPNSNHQLRPPSLRLKNGIKLVVNNEDVPPGFVHLLRQFVLL 81

Query: 82  VIKLHFMKDNRPKNMTSIREFHKLENLYLTPLRFTYDLIDTNEMQSLINIFKRYLINNNF 141
             ++HF  +    ++TS ++  +LE  Y  PL++  ++   +E    +N F+ YL++ N 
Sbjct: 82  QTRIHFFSNFN--SITSFKDIQRLEKYYEFPLKYI-NIFTPDEWFIEMNGFRHYLMSKNR 138

Query: 142 TFRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLNDANGNVSPIXXXXXXXXRKIEKF 201
            F  N+ H +  L + ED F+  +      +I  WL +  G+   +         KI  F
Sbjct: 139 IFGDNIKHRVRQLIM-EDDFDMAW------KIYTWLTETMGH-QLVSLLLEILMDKIADF 190

Query: 202 CQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQFDYGDVENDHALTNLIYYFFTQ 261
            ++ M G W  RF++ME FN FI +YW   ++            E+DH +T  I++ F +
Sbjct: 191 SKQNMMGKWTQRFLVMETFNTFITKYWSTFAQALRCP-------EDDHEITTEIFHCFEK 243

Query: 262 QFIKIRINESLKIMVSNFPISTPTIIELKNVLITSSMPRENVSTTATTTFRDTNLSEEYX 321
           +F+KIR +E  +I V  +P S P ++EL+NV+ TS+                + L  E+ 
Sbjct: 244 EFVKIRTSEIYEICVLEYPHSKPALLELRNVMKTSA--------------DYSKLMIEFL 289

Query: 322 XXXXXXXXXXXQRKFLNPCIPTIPLIRALVKMTNSFLILDPRGQXXXXXXXXXXXXXQRR 381
                      + K +NP + T  ++ + ++   SFL +DP G+             + R
Sbjct: 290 SKF--------ESKLMNPSVTTTEILLSYIRTIKSFLTVDPAGRYLQSVTAYIKPYLRER 341

Query: 382 TTDIVNILLYAMLNLNEMELHKLGCNIDFDIESFNILVSELYPTIIKSMNQNQNNPSVVP 441
              +V+ LLYAML L+E E+     +++                I+  +++   +P    
Sbjct: 342 RDTVVH-LLYAMLELDESEIDDANVSLNM--------------PILTELSKELKDPDFG- 385

Query: 442 YTTAGTGTTCSNERITNDDIPYQNVKDMANANTMEYLARRKPETKPFFDLFKQYLEWVPP 501
                   +  N+ +  D  P   V+       + Y                 +L+W P 
Sbjct: 386 -IEDADSKSRKNKLMVTDSSPVFKVEKPLCEQVLNY-----------------FLQWTPE 427

Query: 502 MNKIYDSTSKNTVVDDEETSRIRSRHAIDYLFRFFDSIDXXXXXXXXXXTEKFIHSKNYY 561
            + +      NT V+         +  +D L   FDS D          T+K +  K YY
Sbjct: 428 PSDVAHRKPNNTFVN---------KSLLDILLDIFDSKDVFISEFLSLFTKKLLGLK-YY 477

Query: 562 TXXXXXXXXXXXXKEKSNSSNVPDENVKST--INTIDIMLNDMKRSASYGKDKKHTKENN 619
                        K+K   ++ P    + T  IN IDIML D+K S         +K + 
Sbjct: 478 KLETKWIKILRLLKKKFGHTSFPQHQFQDTSNINNIDIMLRDVKTSYELI-----SKMHE 532

Query: 620 MVQGDIGFYPKEVSKLYWKINSTNIAKWRMNMKGDFFHLLKYSKTAEPNHTMDIKLNRFF 679
           +   D   +PK +S L+W  NS       +  +   F L  + +T         K +  +
Sbjct: 533 VAGLDDRVFPKFISYLFW--NSA------LEAETSDFQLPGWLETEIE------KYSEVY 578

Query: 680 NELGRKGKKMELYKDKSLMEMKISFDDGRELFFDNITIEQYDVLSLF---TVEKGAAFTL 736
           ++L + G+++ LYKD+  +E+ + F DGR++  + + + +  V+S F   T  KG A  +
Sbjct: 579 SQL-KPGRRLHLYKDQGTVELDLEFKDGRKISCE-VPLNKAAVISCFDQDTALKGLA--V 634

Query: 737 EKAYDFFSGLKRGKQKLEECIQFWXXXXXXXXXXXXGCYKVLERLTFLDEIKQRKKMQEE 796
           E+  D    +K  K  +   +QFW              Y+VLE        +    +   
Sbjct: 635 EQIVD---NVKMEKALVTSILQFWCKKNAIYYDDRYNTYRVLEYY------EPNSALSAS 685

Query: 797 TVI--KSDARMGIDHDYVQEAAEDDDIAGFETHKDVISRANDEIKNILDRIFPFINGMLE 854
           TVI  K +   GI+        +D D AG +  ++ I          + +I+PFI GML 
Sbjct: 686 TVISSKGNTNGGIN------PMDDQDNAGDKQQQEFIQS--------MSKIWPFIQGMLT 731

Query: 855 NLGSMKLEKIHSFLKMTVPRDFEYNRIAIHQLENYLNGLVEDEKLETTTDGAFK 908
           NLGSMK EKIHSFLKM VP+D  Y    ++QLE+YLN LV+++KL    +G++K
Sbjct: 732 NLGSMKPEKIHSFLKMAVPKDIGYTA-TVNQLESYLNVLVDEDKLAAVPNGSYK 784

>Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {ON}
           YLR127C (APC2) - subunit of the anaphase promoting
           complex (APC) [contig 171] FULL
          Length = 776

 Score =  211 bits (538), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 216/888 (24%), Positives = 369/888 (41%), Gaps = 155/888 (17%)

Query: 30  LQTMLLWLNPNE-TTTQSATTMTIDLKNCINIIVSTYGKDDQIRLLFKKYYSFVIKLHFM 88
           L+++L W+NPNE T+       ++ LK+ I I+++  G    +  + ++Y  F  + HF 
Sbjct: 29  LESVLTWINPNEPTSNHQLRPPSLRLKSAIKILINENGNGPALTDILRQYLIFQTRKHFF 88

Query: 89  KDNRPKNMTSIREFHKLENLYLTPLRFTYDLIDTNEMQSLINIFKRYLINNNFTFRKNVL 148
                 ++   ++  KLE  Y  PLRF   L +  E    IN  + YLI+ N  F +N  
Sbjct: 89  AHYY--SLCHFKDVQKLERYYEFPLRFV-RLFNREEWAEEINGLRNYLISKNLVFNRNAR 145

Query: 149 HSMETLFLTEDQFEFQYNMNSLNEIVIWLNDANGNVSPIXXXXXXXXRKIEKFCQREMAG 208
             +  L L ED FE    +        WL  A G +            K++ F  + M  
Sbjct: 146 LRLRQLVL-EDDFEMACKLYE------WLCRAEGRLL-THLLVDAVLSKVKAFALKHMEE 197

Query: 209 LWNGRFIIMEKFNLFINQYWKLISKLFHHQQFDYGDVENDHALTNLIYYFFTQQFIKIRI 268
            W+ RF+ +E +NLFI++YW  +S++           E+DH +TN IY  F ++FI+IR 
Sbjct: 198 AWSKRFVTVELYNLFISKYWSTLSQMLQCP-------EDDHDVTNEIYRCFEEEFIRIRT 250

Query: 269 NESLKIMVSNFPISTPTIIELKNVLITSSMPRENVSTTATTTFRDTNLSEEYXXXXXXXX 328
            ++ KI V+ +P S PT++EL++VL           T A  T   T L  ++        
Sbjct: 251 QQAFKIFVTGYPESEPTLLELRSVL----------KTPAKYTQLVTELLSQF-------- 292

Query: 329 XXXXQRKFLNPCIPTIPLIRALVKMTNSFLILDPRGQXXXXXXXXXXXXXQRRTTDIVNI 388
               + + LNP I T  ++ + VK   S L +D   +               R  D V  
Sbjct: 293 ----EARMLNPSITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMER-RDTVVT 347

Query: 389 LLYAMLNLNEMELH---KLGCNIDFDIESFNILVSELYPTIIKSMNQNQNNPSVVPYTTA 445
            LYAML L+  E       G +     +    L     P    +++++  +P        
Sbjct: 348 FLYAMLGLDASETRGPKPTGAHASIASQLSAELKDSHQPIFRSALDKSAQSP-------- 399

Query: 446 GTGTTCSNERITNDDIPYQNVKDMANANTMEYLARRKPETKPFFDLFKQYLEWVPPMNKI 505
                               V DMA+ N         P+   +  +   YL W P  +  
Sbjct: 400 --------------------VDDMASVN---------PKEPVYQQVINFYLHWTPEPSDS 430

Query: 506 YDSTSKNTVVDDEETSRIRSRHAIDYLFRFFDSIDXXXXXXXXXXTEKFIHSKNY----- 560
             + + +T+++         +   D +   FDS D          T+K +  K Y     
Sbjct: 431 IQANNSDTLMN---------KGLFDIIVELFDSKDIIIGEFLTLFTDKLLDLKGYRLEQN 481

Query: 561 YTXXXXXXXXXXXXKEKSNSSNVPDENVKSTINTIDIMLNDMKRSASYGKDKKHTKENNM 620
           +             K  SN+  V      S IN ID+ML D+K S           E   
Sbjct: 482 WVKSLKILKNRFDFKNYSNAQGV------SNINNIDVMLRDVKHSEELCAQMHSVPE--- 532

Query: 621 VQGDIGFYPKEVSKLYWKINSTNIAKWRMNMKGDFFHLLKYSKTAEPNHTMDIKLNRFFN 680
           +  ++   P  +S L+W            N    F  L K  +      +   K    + 
Sbjct: 533 ISREV--IPMFISYLFW------------NAGSKFSTLPKDCRLPSQLESEIRKYKDMYA 578

Query: 681 ELGRKGKKMELYKDKSLMEMKISFDDGRELFFDNITIEQYDVLSLFTVEKGAAFTLEKAY 740
           ++ + G+K+ L++++S + +++ F D R + F+ +++++  VL+   V +    + +K  
Sbjct: 579 QI-KPGRKLRLHQEQSTVVLQLHFADKRVMDFE-VSMDKSSVLA--CVAETTGISRDKIV 634

Query: 741 DFFSGLKRGKQKLEECIQFWXXXXXXXXXXXXGCYKVLERLTFLDEIKQRKKMQEETVIK 800
           +  +GL+  K ++++ ++FW              Y  LER    D   +R+         
Sbjct: 635 E-ATGLE--KAQVDQNLRFWLDASVLRFDSKTSLYSSLERQD-TDNASERE--------- 681

Query: 801 SDARMGIDHDYVQEAAEDDDIAGFETHKDVISRANDEIKNILDRIFPFINGMLENLGSMK 860
                       Q  AED   + F++ +     +       +++++PFI GML NLG++K
Sbjct: 682 -----------AQMRAEDQARSAFDSQQQQFVES-------MEKVWPFIRGMLTNLGTLK 723

Query: 861 LEKIHSFLKMTVPRDFEYNRIAIHQLENYLNGLVEDEKLETTTDGAFK 908
           +EKIHSFLK+ VP++  +N     QLE YL  LV++ KL  + + AFK
Sbjct: 724 VEKIHSFLKVAVPKEIGFN-ATTAQLEAYLRLLVDENKLVCSANNAFK 770

>KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 774

 Score =  210 bits (535), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 224/921 (24%), Positives = 371/921 (40%), Gaps = 162/921 (17%)

Query: 4   LLDTDVDLSRITESIFVSIDPQYHPQLQTMLLWLNPNE-TTTQSATTMTIDLKNCINIIV 62
           L D   +LS    S+   +D      L+ +L W+NPNE  +       ++ +K+ I  ++
Sbjct: 3   LSDEGRELSEQLHSLLHDVDSSLEDDLEGILTWVNPNEPGSNHQMRPPSLRVKSAIKSLL 62

Query: 63  STYGKDDQIRLLFKKYYSFVIKLHFMKDNRPKNMTSIREFHKLENLYLTPLRFTYDLIDT 122
           +     +    L  KY  F  + HF  +   +++   ++  KLE  Y  P R+  ++  +
Sbjct: 63  NGVVTSESFIDLLGKYMIFQTRKHFFLNY--QSLLYFKDVQKLERYYEFPTRYV-NIFSS 119

Query: 123 NEMQSLINIFKRYLINNNFTFRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLNDANG 182
            E    ++  + YLI  N   + N+   +E L + ED F+         +I  WL  A G
Sbjct: 120 EEWCDEMSGLRNYLIRQNSGLKNNIQLRLEQL-VHEDDFDMAC------KIYEWLCQAEG 172

Query: 183 NVSPIXXXXXXXXRKIEKFCQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQFDY 242
            + P          K++ F  + M   W  RF IME +NLF+  YW +  ++        
Sbjct: 173 RLLP-EILVDVLLSKVKLFASKNMNSAWTQRFTIMEAYNLFVTNYWSVFCRMLQC----- 226

Query: 243 GDVENDHALTNLIYYFFTQQFIKIRINESLKIMVSNFPISTPTIIELKNVLITSSMPREN 302
             +E+DH +TN IY  F ++FI+IR ++   I V+ FP + PT++EL++VL TS      
Sbjct: 227 --MEDDHEITNEIYRCFEEEFIRIRTSQVFDIFVTGFPTTKPTLLELRSVLKTS------ 278

Query: 303 VSTTATTTFRDTNLSEEYXXXXXXXXXXXXQRKFLNPCIPTIPLIRALVKMTNSFLILDP 362
                    + T L  E+            + K LNP I T  ++ + V+   S LI+D 
Sbjct: 279 --------VKYTELITEF--------LYQFESKMLNPSITTAEILLSYVRAIKSILIVDV 322

Query: 363 RGQXXXXXXXXXXXXXQRRTTDIVNILLYAMLNLNEMELHKLGCNIDFDIESFNILVSEL 422
             +               R  D V   LYAML L+  +L                     
Sbjct: 323 SFRYFQLLTNFVRPYLMER-HDTVATFLYAMLGLDASDL--------------------- 360

Query: 423 YPTIIKSMNQNQNNPSVVPYTTAGTGTTCSNERITNDDIPYQNVKDMANANTMEYLARRK 482
                 S N    + S+    +A      S++ I++      N+    +A +M       
Sbjct: 361 -----SSKNSTSTHMSIASQLSA--ELRGSHQPISSSTAERGNLPHGKHALSM------N 407

Query: 483 PETKPFFDLFKQYLEWVP-PMNKIYDSTSKNTVVDDEETSRIRSRHAIDYLFRFFDSIDX 541
           P    +  +   YL W P P + I  +  +  +          S+   D +   FDS D 
Sbjct: 408 PYEPAYQQIIDYYLHWNPEPADSIQANNDQALI----------SKELFDIIVELFDSKDV 457

Query: 542 XXXXXXXXXTEKFIHSKNYYTXXXXXXXXXXXXKEKSNSSNVPDENVKSTINTIDIMLND 601
                    T K +  +  Y             K+K +          S IN ID+ML D
Sbjct: 458 IVREFLGLFTRKLLGLRG-YKLESNWVQSLKVVKKKLDFKTYSSAQEFSNINNIDVMLRD 516

Query: 602 MKRSASYGKDKKHTKE-NNMVQGDIGF----YPKEVSKLYWKINSTNIAKWRMNMKGDFF 656
           +          KH++E  +++   +G      PK VS L+W            N   DF 
Sbjct: 517 V----------KHSEELCSLMHEKLGLSDRIIPKFVSYLFW------------NAHSDFS 554

Query: 657 HLLKYSKTAEPNHTMDIKLNRFFNELG------RKGKKMELYKDKSLMEMKISFDDGREL 710
            L K       +H +  +L    N         +KG+K+ L+ ++S++E+++   DGR+L
Sbjct: 555 ALPK-------DHPLPKELEADINNYKKAYTNVKKGRKLRLHPEQSIVELQLRLADGRDL 607

Query: 711 FFDNITIEQYDVLSLFTVEKGAAFTLEKAYDFFSGLKRGKQKLEECIQFWXXXXXXXXXX 770
            ++ +T+++  VLS  +       T+E   +          ++E+ ++FW          
Sbjct: 608 NYE-VTLDEALVLSYLSSNGDG--TVE---EIVKQTNLDISQVEKSLKFWVKSSILRYST 661

Query: 771 XXGCYKVLERLTFLDEIKQRKKMQEETVIKSDARMGIDHDYVQEAAEDDDIAGFETHKDV 830
               Y V E                        R  +D   V+ A E    +      D 
Sbjct: 662 ETSRYSVEE------------------------RQNVD---VKHAVERQSSSEIVNATDS 694

Query: 831 ISRANDEIKNILDRIFPFINGMLENLGSMKLEKIHSFLKMTVPRDFEYNRIAIHQLENYL 890
           +     +  + + ++ PFI GML NLGS+K +KIHSFLKM VP++  Y+     QL+ YL
Sbjct: 695 VDLQQQQFIDSMQKVLPFIKGMLTNLGSLKADKIHSFLKMAVPKEIGYSATP-SQLQLYL 753

Query: 891 NGLVEDEKLETTTDGAFKKPK 911
           N LVE+ KL  T +GAF+  K
Sbjct: 754 NALVEESKLVKTPNGAFRLAK 774

>CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa]
           {ON} similar to uniprot|Q12440 Saccharomyces cerevisiae
           YLR127c APC2 component of the anaphase promoting complex
          Length = 783

 Score =  209 bits (532), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 215/885 (24%), Positives = 375/885 (42%), Gaps = 140/885 (15%)

Query: 32  TMLLWLNPNETTTQSATTMTIDLKNCINIIVSTYGKDD-QIRLLFKKYYSFVIKLHFMKD 90
            +L WL+P            + +K  I  ++   G +D Q+    + YY +  +++F   
Sbjct: 32  VLLQWLDPAGKKNHQLKPPNLLVKTMIEKLL--LGSNDYQLLSNIQDYYCWQCRVYFY-- 87

Query: 91  NRPKNMTSIREFHKLENLYLTPLRFTYDLIDTNEMQSLINIFKRYLINNNFTFRKNVLHS 150
           N  K + ++ E  ++E   L PL++       N +++ + +F  YL+  N       +  
Sbjct: 88  NEYKRIETLNELKRIERHVLFPLKYIPIFEGNNRVENEVRLFGNYLLKTNKKVMSRAVER 147

Query: 151 METLFLTEDQFEFQYNMNSLNEIVIWLNDANGNVSPIXXXXXXXXRKIEKFCQREMAGLW 210
           +    L ED FE         EIV + +    + + I         KIE+FCQ      W
Sbjct: 148 LRNRML-EDDFELA------TEIVDYFDYCQTDSTSIVLDIILD--KIEQFCQLHYTRKW 198

Query: 211 NGRFIIMEKFNLFINQYWKLISKLFHHQQFDYGDVENDHALTNLIYYFFTQQFIKIRINE 270
           N R++IME FN FI+QYW  +S L   Q       E++H +TN +Y +F +QFI IR NE
Sbjct: 199 NKRYLIMETFNQFISQYWDQLSSLLFCQ-------EDNHTITNTLYKYFEKQFISIRTNE 251

Query: 271 SLKIMVSNFPISTPTIIELKNVLITSSMPRENVSTTATTTFRDTNLSEEYXXXXXXXXXX 330
              I +SN     PT++EL          R+ +ST          L  ++          
Sbjct: 252 IFDICISNPASVQPTLLEL----------RKEISTVNDFNCVVVELLSKFNL-------- 293

Query: 331 XXQRKFLNPCIPTIPLIRALVKMTNSFLILDPRGQXXXXXXXXXXXXXQRRTTDIVNILL 390
               K +NP I T   +   ++   +F ILDP G+             ++R  D+V++LL
Sbjct: 294 ----KVINPSIVTADALFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQRK-DLVHLLL 348

Query: 391 YAMLNLNEMELHKLGCNIDFDIESFNILVSELYPTIIKSMNQNQNNPSVVPYTTAGTGTT 450
           ++ML L+E +               N + S++    + ++     +  +  YT       
Sbjct: 349 FSMLGLDETD-------------QLNTMPSQVSEEKLTALTNELKDTEICSYTEE----- 390

Query: 451 CSNERITNDDIPYQNVKDMANANTMEYLARRKPETKPFFDLFKQYLEWVPPMNKIYDSTS 510
                  +DD+    V  M  + + E       ++     + K+Y+EW+P   ++  S  
Sbjct: 391 -------SDDV----VDPMIGSFSKE------EDSMVLEQVIKRYMEWIP---EVPTSFG 430

Query: 511 KNTVVDDEETSRIRSRHAIDYLFRFFDSIDXXXXXXXXXXTEKFIHSKNYYTXXXXXXXX 570
           K  + D             D L    +S +          T+K +  + Y          
Sbjct: 431 KGILSD-------HKLDLFDILLELLESKETLVIEFKNLLTKKLLDLRGYTLDKKWSKFL 483

Query: 571 XXXXKEKSN-SSNVPDENVKSTINTIDIMLNDMKRSASYGKDKKHTKENNMVQGDIGFYP 629
               K   N S+   DE   + INTIDIML D+ +S     D +    N     ++  YP
Sbjct: 484 SLLKKRFDNRSTETMDEEDLNNINTIDIMLRDIYKSRQIATDMQLDLHNT----NVKVYP 539

Query: 630 KEVSKLYWKINSTNIAKWRMNMKGDFFHLLKYSKTAEPNHTMDIKLNRFFNELGRKGKKM 689
           K VS LYW  NS   +K      GDF          E  H +++  +RF+++  + G+K+
Sbjct: 540 KIVSALYWSNNSDTQSK-----AGDF------EMDGELEHLLEL-YSRFYSQ-KQIGQKL 586

Query: 690 ELYKDKSLMEMKISFDDGRELFFDNITIEQYDVLSLFTVEK-GAAFTLEKAYDFFSGLKR 748
           EL +D   + + +SF DGR +     ++ QY VL+LF   K  + F  E         + 
Sbjct: 587 ELRRDNGSVSLNLSFLDGRTVHC-KASLRQYSVLTLFKSPKHDSNFPTEGLTISELCARS 645

Query: 749 GKQ--KLEECIQFWXXXXXXXXXXXXGCYKVLERLTFLDEIKQRKKMQEETVIKSDARMG 806
           G Q  ++ + +++W            G Y+ LE L +                K D+   
Sbjct: 646 GMQSKQMADILRYW--VSKDVLYFSDGKYRTLEFLRW----------------KGDSTYA 687

Query: 807 IDHDYVQEAAEDDDIAGFETHKDVISRANDEIKNILDRIFPFINGMLENLGSMKLEKIHS 866
              D ++E+  +             S+  D+ +N ++R  P+I  +L NLG++K++K+H+
Sbjct: 688 AIPDVLEESVVERS-----------SQHEDKQENHVERALPYIKDILLNLGTLKIDKLHA 736

Query: 867 FLKMTVPRDFEYNRIAIHQLENYLNGLVEDEKLETTTDGAFKKPK 911
            L+  +P+D  Y+ +   QL++YL+ LVE+  L + ++ ++K P+
Sbjct: 737 LLQSAMPKDSHYSTVNQKQLQDYLDTLVEEGVLSSASNDSYKLPQ 781

>ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {ON}
           similar to uniprot|Q7LGV7 Saccharomyces cerevisiae
           YLR127C
          Length = 818

 Score =  178 bits (451), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 158/560 (28%), Positives = 248/560 (44%), Gaps = 100/560 (17%)

Query: 1   MTPLLDTDVDLSRI---TESIFVSIDPQYHPQLQTMLLWLNPNET-TTQSATTMTIDLKN 56
           M  ++    DL R+    + + +   P     L+++L W+NPNE  +       T+ LKN
Sbjct: 1   MNAVMRAGEDLKRLLVQIQEVALRTHPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKN 60

Query: 57  CINIIVSTYG----KDDQ-------IRLLFKKYYSFVIKLHFMKDNRPKNMTSIREFHKL 105
            I ++V+ Y     ++D+       I+L+ +++Y + ++LHF       N+ + ++  +L
Sbjct: 61  SIKMLVNQYYNMELREDERDTGYLFIQLV-RQFYVYQVRLHFFAS--LSNLHTFKDVQRL 117

Query: 106 ENLYLTPLRFTYDLIDTNEMQSLI---NIFKRYLINNNFTFRKNVLHSMETLFLTEDQFE 162
              Y  PL++ Y  I  N  +  I   +    YL+N +   R NV+  ++ L + ED F+
Sbjct: 118 VKYYEFPLKYVY--IFENCPEEWIGERDGLMHYLLNRHKKLRINVVSRLKDLVM-EDDFD 174

Query: 163 FQYNMNSLNEIVIWLNDANGNVSPIXXXXXXXXRKIEKFCQREMAGLWNGRFIIMEKFNL 222
              +      +V WLN++N NVS +         KI +FCQ +M G WN RF+IME FN 
Sbjct: 175 LAMD------VVKWLNESNSNVSSMDLMLDLIVEKISRFCQDQMTGTWNNRFLIMETFNR 228

Query: 223 FINQYWKLISKLFHHQQFDYGDVENDHALTNLIYYFFTQQFIKIRINESLKIMVSNFPIS 282
           FI  YW     L           E++H LT ++Y+ F +QF+K+R  E   I+V  +P S
Sbjct: 229 FITSYWSQFCLLL-------ACPEDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYPDS 281

Query: 283 TPTIIELKNVLITSSMPRENVSTTATTTFRD-TNLSEEYXXXXXXXXXXXXQRKFLNPCI 341
            PT++EL+ VL+ S               +D T +  E+            +R+ LNP I
Sbjct: 282 KPTLLELRRVLVKS---------------KDFTQIVVEF--------LSNFERQILNPSI 318

Query: 342 PTIPLIRALVKMTNSFLILDPRGQXXXXXXXXXXXXXQRRTTDIVNILLYAMLNLNEMEL 401
            T+  + A VK   +FL LDP G+             Q R  D+V +LLYA+L L   E 
Sbjct: 319 STVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVKPYFQER-NDLVTVLLYAILELQSEEF 377

Query: 402 HKLGCNIDFDIESFNILVSELYPTIIKSMNQNQNNPSVVPYTTAGTGTTCSNERITNDDI 461
                    D  S N L  EL             +P          G   S E I   D+
Sbjct: 378 EG-PARAYLDTNSLNQLSQEL------------KDPEF--------GIESSFETIPQADL 416

Query: 462 PYQNVKDMANANTMEYLARRKPETKPFFDLFKQYLEWVP-PMNKIYDSTSKNTVVDDEET 520
                +  + A T   L  R     P+  + K +L+W P PM+ I  + SK+        
Sbjct: 417 L---SRPASTATTAAMLDPR----LPYKSVIKNFLQWTPEPMDTISKNYSKSLSA----- 464

Query: 521 SRIRSRHAIDYLFRFFDSID 540
               SR+ +D L   F+S D
Sbjct: 465 ----SRNLLDILMDMFESKD 480

 Score =  116 bits (291), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 93/325 (28%), Positives = 154/325 (47%), Gaps = 56/325 (17%)

Query: 590 STINTIDIMLNDMKRSASYGKDKKHTKENNMVQGDIGFYPKEVSKLYW-KINSTNIAKWR 648
           S IN ID+ML D++ S+   K     + + +   D   YPK +S LYW + NS+N     
Sbjct: 547 SNINNIDVMLRDVRGSSELCK-----RMHQVAGLDQRIYPKFISPLYWNRDNSSN----- 596

Query: 649 MNMKGDFFHLLKYSKTAEPNHTMDI-KLNRFFNELGRKGKKMELYKDKSLMEMKISFDDG 707
               G  F L       +P   +++ K  + ++E+ + G+ + LYKD+ ++ + +SF DG
Sbjct: 597 ----GWTFQL-------DPQMALELDKYCQVYSEI-KPGRALHLYKDQGIVVLTLSFQDG 644

Query: 708 RELFFDNITIEQYDVLSLFTVEKGAAFTLEKAYDFFSGLKRGKQKLEECIQFWXXXXXXX 767
           R+   +  T+EQ  V+  F         L +     + L+    +    +Q W       
Sbjct: 645 RKKRCE-ATLEQCSVIQQFDASTATTTGLTEQM-IGARLQMDPARARAALQHWVQEGVLY 702

Query: 768 XXXXXGCYKVLERLTFLDEIKQRKKMQEETVIKSDAR-MGIDHDYVQEAAEDDDIAGFET 826
                  YK  E L   D+  +     +++   S AR M  D D                
Sbjct: 703 YDG--NAYKTREYLD--DQPAENLPASKDSSASSQARTMSPDRD---------------- 742

Query: 827 HKDVISRANDEIKNILDRIFPFINGMLENLGSMKLEKIHSFLKMTVPRDFEYNRIAIHQL 886
                      + +IL++ +PFI GML NLG++K++KIHSFLK+T P++  ++ +   QL
Sbjct: 743 ---------SRLTSILEQTWPFIQGMLTNLGALKVKKIHSFLKVTTPKELGFSMVTPSQL 793

Query: 887 ENYLNGLVEDEKLETTTDGAFKKPK 911
           E+YL+ LVE+E+L  TT+  +K PK
Sbjct: 794 ESYLHSLVEEERLICTTNDTYKLPK 818

>TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.321
           YLR127C
          Length = 842

 Score =  162 bits (411), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 216/913 (23%), Positives = 395/913 (43%), Gaps = 129/913 (14%)

Query: 30  LQTMLLWLNPNE-TTTQSATTMTIDLKNCINII---VSTYGKDDQIRLL---FKKYYSFV 82
           + ++L WLNPN+  +       TI LK  I  I   V+T G  D I  L    + YY F 
Sbjct: 28  IDSLLDWLNPNDPKSNHQLKPPTIRLKKVIKKILLDVNTLGDYDSIETLNSLLRYYYIFQ 87

Query: 83  IKLHFMKDNRPKNMTSIREFHKLENLYLTPLRFTYDLIDTNEM-QSLINIFKRYLINNNF 141
           ++L+F  +   +++T  ++  KLE  Y  P+      ++ N + ++ +N  + YL+  N 
Sbjct: 88  VRLNFFSN--LQSITYFKDIIKLEKYYEFPILHVPIFLNNNYIWETELNKIRHYLLRTNL 145

Query: 142 TFRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLNDANGNV-SPIXXXXXXXXRKIEK 200
           TFR N+++ ++ L + ED F+         EI+ W N+AN ++ S           KI  
Sbjct: 146 TFRSNLINRLKKL-VKEDDFDLA------QEIIKWSNEANFSLLSSKQIILNALLDKITM 198

Query: 201 FCQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQFDYGDVENDHALTNLIYYFFT 260
           +  ++    W+ RFIIME +N FIN+YW   + L +         E+DH +T ++Y +F 
Sbjct: 199 YADKQFTNAWSQRFIIMETYNKFINKYWSNFAVLLNC-------AEDDHEITKVLYKYFE 251

Query: 261 QQFIKIRINESLKIMVSNFPISTPTIIELKNVLITSSMPRENVSTTATTTFRDTNLSEEY 320
           +QF++IR  E   I V ++P S PTI+EL+  L+T S    N+     + F         
Sbjct: 252 KQFLRIRSEEIFDICVISYPDSKPTIMELRG-LLTQSKISTNILIRLLSEF--------- 301

Query: 321 XXXXXXXXXXXXQRKFLNPCIPTIPLIRALVKMTNSFLILDPRGQXXXXXXXXXXXXXQR 380
                       Q K LN  IPT  ++ A +K   S LILDP  +             Q+
Sbjct: 302 ------------QLKVLNLSIPTCTILIAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQ 349

Query: 381 RTTDIVNILLYAMLNLNEMELHKLGCNIDFDIESFNILVSELYPTIIKSMNQNQNNPSVV 440
           + +DI+ ILL+A+L+L   ++ K    +  D     +L  EL                  
Sbjct: 350 K-SDIIYILLFAILDLRTDDI-KTNPIVKVDQNLLKLLSEELRE---------------- 391

Query: 441 PYTTAGTGTTCSNERITNDDIPYQNVKDMANANTMEYLARRKPETKPFFDLFKQYLEWVP 500
             +  G     S+  I+++     N K+++    ++Y A ++     +  +  + L W+P
Sbjct: 392 --SHFGINLNFSDVDISDNLENGNNNKNISQ---LDY-AGQESSQLLYSQILNRALTWLP 445

Query: 501 PMNKIYDSTSKNTVVDDEETSRIRSRHAIDYLFRFFDSIDXXXXXXXXXXTEKFIHSKNY 560
                        V  ++    +R ++ +D LF  FD  +           +K    K  
Sbjct: 446 ---------ESKLVSPNKSIKMMRKKNLLDILFAIFDDHELFLKRFVELLKQKLFVIKG- 495

Query: 561 YTXXXXXXXXXXXXKEKSNSSNVPDENVKSTINT------------IDIMLNDMKRSASY 608
           Y             K K + +++ D    + + T            ID+ML DM+ S   
Sbjct: 496 YNLEESWVQCLRLFKTKFSPNSLDDAPTSTNLETLTGNNDSMYMTNIDVMLWDMRGS--- 552

Query: 609 GKDKKHTKENNMV-QGDIGFYPKEVSKLYWKINSTNIAKWRMNMKGDFFHLLKYSKTAEP 667
              KK T++ +++ + D     K +S LYW+ +  N        +  ++ LL        
Sbjct: 553 ---KKLTEQMHLIDELDNRINLKIISSLYWQYDMKN------EKRKTYYGLLNKMDQTLF 603

Query: 668 NHTMDIKLNRFFNELGRKGKKMELYKDKSLMEMKISFDDGRELFFDNITIEQYDVLSLFT 727
           N  +D K ++ ++ L + G+ + L  D+S +E+  +F+D R +  +  T E Y  +  F 
Sbjct: 604 NQ-LD-KYSKLYSRL-KPGRVLNLLTDQSTIEIDFNFEDNRTVTCE-CTFENYMSICPFL 659

Query: 728 VEKG-AAFTLEKAYDFFSGLKRGKQKLEECIQFWXXXXXXXXXXXXGCYKVLE---RLTF 783
             +G +++TLE+     S    G + L+  ++FW              Y+ LE   R   
Sbjct: 660 ENEGTSSYTLEELSIITSF---GLEDLKISLKFW--LDQKILYFDGKTYRPLEYLDRSEI 714

Query: 784 LDEIKQRKKMQEETVIKSD-----ARMGIDHDYVQEAAEDDDIAGFETHKDVISRANDEI 838
           + E  +   +     I ++     A +G  +D +   ++++       H    +  + E+
Sbjct: 715 IIESPESNNVNSVMSITNNPLNGFAILGKGNDTIDRPSQENITKCTPDHDKTFNATSQEV 774

Query: 839 KNILDRIFPFINGMLENLGSMKLEKIHSFLKMTVPRDFEYNRIAIHQLENYLNGLVEDEK 898
                +I  ++  +L NLG   +EK+++ L+ T   D    +++   LEN +  LVE+ +
Sbjct: 775 S----KIKEYVLSILTNLGEQNIEKLYNVLQ-TTSHDTAIKKVSSVTLENIVTELVENGQ 829

Query: 899 LETTTDGAFKKPK 911
           +    +G ++ P+
Sbjct: 830 ILCLPNGLYQLPE 842

>TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {ON}
           Anc_8.321 YLR127C
          Length = 732

 Score =  159 bits (402), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 180/765 (23%), Positives = 331/765 (43%), Gaps = 116/765 (15%)

Query: 29  QLQTMLLWLNPNE-TTTQSATTMTIDLKNCINIIV--STYGKD------DQIRLLFKKYY 79
           +L+T+L+WL+PN+  +       T+ LK  I  I   S   KD      + I+   K +Y
Sbjct: 32  ELETLLIWLDPNDPNSNHHLHPPTLQLKTIIKQITPSSDIYKDPSNSIKNNIQNWLKLFY 91

Query: 80  SFVIKLHFMKDNRPKNMTSIREFHKLENLYLTPLRFTYDLIDTNEMQSLINIFKRYLINN 139
            + ++ +F K  +  N+   ++  KLE  Y  PL+F   L    E    +   + Y+++ 
Sbjct: 92  VYQVRTYFFK--KIDNIRQYKDMIKLEKYYQFPLQFI-PLFTFQEWCFELLSLRHYILHQ 148

Query: 140 NFTFRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLNDANGNVSPIXXXXXXXXRKIE 199
           N  F + ++  +  L   ED   F+ ++    +IV W+ + + N+            KI 
Sbjct: 149 NKEFTQKIILELRQLIKEED---FETSL----DIVTWIREVDSNLLSENFILDILLEKIT 201

Query: 200 KFCQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQFDYGDVENDHALTNLIYYFF 259
            +C++ M G W  R+++ME +N F+  YW   ++L + +       E++H +TN+++ +F
Sbjct: 202 LYCEQTMKGNWTRRYLVMETYNTFMMNYWLNFTQLLNCK-------EDNHKITNILFKYF 254

Query: 260 TQQFIKIRINESLKIMVSNFPISTPTIIELKNVLITSSMPRENVSTTATTTFRDTNLSEE 319
            +QFIKIRI E  KI + ++P + PT++EL+N+L+T +  ++ V    +           
Sbjct: 255 EKQFIKIRIQEIFKICILSYPDTKPTLLELRNLLVTYNFFQKLVVNFLSA---------- 304

Query: 320 YXXXXXXXXXXXXQRKFLNPCIPTIPLIRALVKMTNSFLILDPRGQXXXXXXXXXXXXXQ 379
                        +R  L P I TI  + A ++   SF ILDP G+             +
Sbjct: 305 ------------FERIVLTPTINTIDCLLAYIRTVKSFQILDPSGRYLYSITNYINPHFR 352

Query: 380 RRTTDIVNILLYAMLNLNEMELHKLGCNIDFDIESFNILVSELYPTIIKSMNQNQNNPSV 439
            R   +  ILL+A+L L +++L      I     S  ++++EL    +   N +    S+
Sbjct: 353 ERKM-LAPILLHAILALPKIDLENAIYPIKVSSISLKLIINELEDPELGIENTSTKKNSI 411

Query: 440 VPYTTAGTGTTCSNERITNDDIP--YQNVKDMANANTMEYLARRKPETKPFFDLFKQYLE 497
             +    +    +N   +++ +P   QN     + +T+  L ++         + KQ+L 
Sbjct: 412 KKFNEILSPKRFNNHN-SSEYLPDLLQNTSSEDSNSTL--LVQK---------VVKQFLT 459

Query: 498 WVPPMNKIYDSTSKNTVVDDEETSRIRSRHAIDYLFRFFDSIDXXXXXXXXXXTEKFIHS 557
           WVP  N I  + +K             S + +D L   F+S +          +++ + +
Sbjct: 460 WVPIPNDIATNDTKKLY---------SSTNLLDILLNIFESKEFLLTEFSKLLSKRLLIT 510

Query: 558 KNYYTXXXXXXXXXXXXKE-KSNSSNVPDENVKST----------INTIDIMLNDMKRSA 606
           KNY              K   S S N  + N+  T          I  +++ML+D+  S+
Sbjct: 511 KNYKLEGKWGACLQLLRKRFSSGSDNYTNTNLADTDNLVNGENLKITNMNVMLSDLNYSS 570

Query: 607 SYGKDKKHTKENNMVQGDIGFYPKEVSKLYW-KINSTNIAKWRMNMKGDFFHLLKYSKTA 665
              K   H    N        YPK +S  YW  ++  N++                    
Sbjct: 571 ELCKIFHHANGVNT-----RVYPKFISSHYWVDLDDENVSN---------------GPNE 610

Query: 666 EPNH-TMDIKLNRFFNELGR------KGKKMELYKDKSLMEMKISFDDGRELFFDNITIE 718
           E NH  +   L  +F E  +      +G+K++++ ++ ++E+K+SF+DGR L  D  T+ 
Sbjct: 611 ETNHFQIPPSLLGYFEEYAKLYEDLNEGRKVDIWPNEGVIEIKLSFEDGRVLEID-ATLP 669

Query: 719 QYDVLSLFTVEKGAAFTLEKAY---DFFSGLKRGKQKLEECIQFW 760
           QY +L  +  EK A     + +   +    L    Q + E + FW
Sbjct: 670 QYALLQ-YIQEKNAIMQNNQGFTVNELSVPLNLSLQNVTELVDFW 713

>Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGL193W
          Length = 689

 Score =  157 bits (398), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 162/758 (21%), Positives = 322/758 (42%), Gaps = 109/758 (14%)

Query: 30  LQTMLLWLNPNETTTQSATTM-TIDLKNCINIIVSTYGKDDQIRLLFKKYYSFVIKLHFM 88
           L+ +L W+NPN+        + ++ +KN I ++     +   +  L +++    ++ HF 
Sbjct: 29  LENLLTWINPNDDHNNHQMRLPSLRIKNSIKLLKLDDAEQVFLLQLLRQWTLSQLRYHFF 88

Query: 89  KDNRPKNMTSIREFHKLENLYLTPLRFTYDLIDTNEMQSLINIFKRYLINNNFTFRKNVL 148
            +   +++   ++  +LE  Y  PL++   L    E+ + +   ++YL+N N TFR N+ 
Sbjct: 89  HN--WESLMQYKDMLRLERYYEFPLKYV-GLFTAEELSNELIGLRKYLLNRNSTFRNNME 145

Query: 149 HSMETLFLTEDQFEFQYNMNSLNEIVIWLNDANGNVSPIXXXXXXXXRKIEKFCQREMAG 208
             +  L L ED FE        +++  W+    G+   +         KIE FC+  M G
Sbjct: 146 SRIRVLILEEDDFEMS------SKLYKWMVQGLGH-PMVKFVIDLLTNKIELFCKSRMEG 198

Query: 209 LWNGRFIIMEKFNLFINQYWKLISKLFHHQQFDYGDVENDHALTNLIYYFFTQQFIKIRI 268
             + + +I E FN FI++ W    +L           E+D  L NLIY  F  +FI+++ 
Sbjct: 199 NVDQKHVIEEVFNAFIDKCWNQFIQLLQFPN------EDDQELNNLIYRCFENKFIEMKT 252

Query: 269 NESLKIMVSNFPISTPTIIELKNVLITSSMPRENVSTTATTTFRDTNLSEEYXXXXXXXX 328
            E    ++  FP+S P+++E+K+V+  ++   + +       F                 
Sbjct: 253 KELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRLVAQICNDFHS--------------- 297

Query: 329 XXXXQRKFLNPCIPTIPLIRALVKMTNSFLILDPRGQXXXXXXXXXXXXXQRRTTDIVNI 388
                 + L P + TI ++   VK     +++DP G+             + R +D++  
Sbjct: 298 ------ELLIPSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKER-SDLITT 350

Query: 389 LLYAMLNLNEMELHKLGCNIDFDIESFNILVSELYPTIIKSMNQNQNNPSVVPYTTAGTG 448
           +L A+L L + E+H        ++ S N L     P ++  +++   N + + + +  T 
Sbjct: 351 VLCAILELTKDEIH--------EVISKNTLTEN--PQLLDQLSKELKNSTALNFHSVTT- 399

Query: 449 TTCSNERITNDDIPYQNVKDMANANTMEYLARRKPETKPFFDLFKQYLEWVP---PMNKI 505
                            +K  A   ++    R+ P       L KQ+LEW P   P N+ 
Sbjct: 400 -----------------IKSKAAIYSVAQ-ERQNP-------LVKQFLEWTPEPGPFNED 434

Query: 506 YDSTSKNTVVDDEETSRIRSRHAIDYLFRFFDSIDXXXXXXXXXXTEKFIHSKNYYTXXX 565
                 N   D  ET  +  +  ++ +F+ FDS +          T   +  + Y     
Sbjct: 435 ISKLGNNDTDDTTETLEL-PKDVLEVVFQVFDSPEILINEFIKLITNHMLQMEGYILSAK 493

Query: 566 XXXXXXXXXKE--KSNSSNVPDENVKSTINTIDIMLNDMKRSASYGKDKKHTKENNMVQG 623
                    K+  K+N   +     +S +  + +M +D+++SAS+   +  + +  ++  
Sbjct: 494 WSQLLKTLMKKYFKNNKQVLKSICEESNLVNVFVMWSDLEKSASF---QNWSTKLQLIPS 550

Query: 624 DIGFYPKEVSKLYWKINSTNIAKWRMNMKGDFFHLLKYSKTAEPNHTMDIKLNRFFNELG 683
           ++  YPK +S LYWKI+       R ++ GD+       + +     +  ++ + F E+ 
Sbjct: 551 NV--YPKIISYLYWKIS-------RKSLYGDY-------RISSALAIIFQQMEKAF-EMK 593

Query: 684 RKGKKMELYKDKSLMEMKISFDDGRELFFDNITIEQYDVLSLFT-VEKGAAFTLEKAYDF 742
             G+K+    D+  +E+ ++FDDGR  + + +++ +Y V+ LF  V +G      +  D 
Sbjct: 594 SPGRKLRFQNDQGTVEIALTFDDGRH-WSNKVSLPKYTVIELFQKVPRGL-----RTADI 647

Query: 743 FSGLKRGKQKLEECIQFWXXXXXXXXXXXXGCYKVLER 780
                  +  +E  +Q+W             CY++LER
Sbjct: 648 VQQTDMAQHHVEAIVQYW-CQEHVLYSTGDDCYRILER 684

>KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.321
           YLR127C
          Length = 817

 Score =  156 bits (395), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 214/934 (22%), Positives = 366/934 (39%), Gaps = 182/934 (19%)

Query: 23  DPQYHPQLQTMLLWLNPNETTTQSATTMTIDLKNCINIIVSTYGKDDQIRLLFKKYYSFV 82
           + ++   L  +LLWL+P E   +  +   + +K  I  I   +           K Y  +
Sbjct: 13  NAKFAEDLDRLLLWLSPAEHQCKPPS---LRIKKSIQRIRECFQLSSDFTNCLVKLYIDL 69

Query: 83  IKLHF---MKDNRPKNMTSIREFHKLENLYLTPLRFTYDLIDTNEMQSLINIFKRYLINN 139
           I+  F   MK+N   N     +  KLEN    P  F  +L    E    +++ + YL+++
Sbjct: 70  IRFEFISYMKEN--ANCLKFNDVLKLENRIEHPRLFIPEL--EFEYFKNLHMLRHYLLDS 125

Query: 140 NFTFRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLNDANG-NVSPIXXXXXXXXRKI 198
           + +F+  +  S+E L + +D +       S   I+ W++ A   ++SP         +KI
Sbjct: 126 DKSFKTALCTSIENLIMEDDFY-------SATIILDWIDSAYSIDLSPKDLVLDMLVKKI 178

Query: 199 EKFCQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQFDYGDVENDHALTNLIYYF 258
              C   + G W  RFI++E FN FI  YW   ++L           ENDH LT  ++  
Sbjct: 179 AGICSGSIRGSWTRRFIVIETFNDFIEVYWSHFAQLLKCP-------ENDHELTKTVFKC 231

Query: 259 FTQQFIKIRINESLKIMVSNFPISTPTIIELKNVLITSSMPRENVSTTATTTFRDTNLSE 318
           F ++FI IRINE  +I  S +P S PTI+EL+ V+  +    + ++ T   TF+D     
Sbjct: 232 FEREFINIRINEIFEIFTSAYPESKPTILELRKVM-KAPKDLQRLTYTFLDTFKD----- 285

Query: 319 EYXXXXXXXXXXXXQRKFLNPCIPTIPLIRALVKMTNSFLILDPRGQXXXXXXXXXXXXX 378
                           + LNPC+ TI  + + +K    FL+LDP G+             
Sbjct: 286 ----------------EMLNPCVTTIDALTSYLKAIKGFLLLDPAGRYLNLVTTFVKPYF 329

Query: 379 QRRTTDIVNILLYAMLNLNEMELHKLGCNIDFDIESFNILVSELYPTIIKSMNQNQNN-P 437
           Q + +D++NILLYA+L+L   +   L  +    +   ++ + E     I+++  N NN  
Sbjct: 330 QDK-SDLINILLYAILDLKPKDFEDLNISYIPGLNKLSLDMREDPEFSIENVEPNDNNYK 388

Query: 438 SVVP-YTTAGTGTTCSNERITNDDIPYQNVKDMANANTMEYLARRKPETKPFFDLFKQYL 496
             VP   + G  +      +  D I                               KQ++
Sbjct: 389 RTVPNLESIGANSLHDKGTLIQDHI------------------------------MKQFM 418

Query: 497 EWVPP--MNKIY-DSTSKNTVVDDEE-----TSRIRSRHAIDYLFRFFDSIDXXXXXXXX 548
            WVP   MN +  D  + N   +D        S   + + +D L   F+S +        
Sbjct: 419 MWVPEPNMNNLENDHDNGNDFEEDNNDVTAVNSIFYNVNLLDILLDLFESKEIFIGKFVN 478

Query: 549 XXTEKFIHSKNYYTXXXXXXXXXXXXKEKSNSSNVP----------------------DE 586
             T KF   +NY                K NSSN+                       DE
Sbjct: 479 LLTIKFFKLQNYRV-DPNWQKCLELINSKFNSSNISMDEKMEEDVAIGTVNPTNENYVDE 537

Query: 587 NVKS-----------TINTIDIMLNDMKRSASYG-KDKKHTKENNMVQGDIGFYPKEVSK 634
             K+           ++N I++MLND++ S  +  +         +   ++G  PK +S 
Sbjct: 538 KRKTNASNDMEEIQISLNKIEVMLNDIRHSEKFSFQISSELNRYGLRSNNVGIKPKFISP 597

Query: 635 LYWKINSTNIAKWRMNMKGDFFHLLKYSKTAEPNHTMDIKLNRFFNELGRKGKKMELYKD 694
           LYW      +            + LK +   E      ++    +  +  KG  +   K 
Sbjct: 598 LYWDYEDNELG---------VNNFLKENVFDEECTKAILQYASEYCSIN-KGFALHYCKG 647

Query: 695 KSLMEMKISFDDGRELFFDNITIEQYDVLSLFTVEKGAAFTLEKAYDFFSGLKRGKQKLE 754
           K ++E++ISF+DG    F  +   QY VL+LF        T+E         KR K ++ 
Sbjct: 648 KEMIEVEISFNDGAIKGF-LVNASQYYVLTLFDT-GNEKLTIESILTAGEA-KRSKNEII 704

Query: 755 ECIQFWXXXXXXXXXXXXGCYKVLERLTFLDEIKQRKKMQEETVIKSDARMGIDHDYVQE 814
           + ++FW                                  E+ V+  +      + Y + 
Sbjct: 705 DALKFWV---------------------------------EKNVLVYEG----GYYYSR- 726

Query: 815 AAEDDDIAGFETHKDVISRANDEIKNILDRIFPFINGMLENLGSMKLEKIHSFLKMTVPR 874
                D+   E  K   +   D++  ++    P+I  MLE+ G++   +I +FLK T+P 
Sbjct: 727 -----DLHSIENSKGNTTTRTDDL--LVKEALPYIKTMLESFGNLSASRIQNFLKATLPA 779

Query: 875 DFEYNRIAIHQLENYLNGLVEDEKLETTTDGAFK 908
             + + I I  + + L+ LV D  L   + G++K
Sbjct: 780 AQDSDHI-ITDIHSVLDTLVSDGILFKNSSGSYK 812

>AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR127C (APC2)
          Length = 709

 Score =  140 bits (353), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 153/742 (20%), Positives = 299/742 (40%), Gaps = 103/742 (13%)

Query: 23  DPQYHPQLQTMLLWLNPNET-TTQSATTMTIDLKNCINIIVSTYGKDDQIRLLFKKYYSF 81
           DP    +++ +L W++PN+          ++ +KN I ++            L ++    
Sbjct: 22  DPSLKDEIEAVLEWMDPNDDHNNHQMRPPSLRIKNSIRLLRLGEQAPGTTVGLLRQCAVS 81

Query: 82  VIKLHFMKDNRPKNMTSIREFHKLENLYLTPLRFTYDLIDTNEMQSLINIFKRYLINNNF 141
            ++ HF +    + +    +  KLE  Y  PLR+     +      L+ + ++YL+N N 
Sbjct: 82  QMRQHFFR--HWERLEQYTDMVKLERYYEFPLRYVAVFTEDEVAAELVGL-RKYLLNGNP 138

Query: 142 TFRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLNDANGNVSPIXXXXXXXXRKIEKF 201
            FR N+   +  L L +D FE      +   +  W+    G+   +        +KI  F
Sbjct: 139 GFRANMEARIRALILQDDDFE------TAARLYKWIVQGLGH-PMVKFVIEVLTQKIALF 191

Query: 202 CQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQFDYGDVENDHALTNLIYYFFTQ 261
           C+  M G  + R++IME FN FI + W    +L    QF   D   D  L NLIY  F +
Sbjct: 192 CRNRMDGNVDQRYLIMEVFNSFIARCWAQFIQLL---QFPTAD---DPELNNLIYRCFEK 245

Query: 262 QFIKIRINESLKIMVSNFPISTPTIIELKNVLITSSMPRENVSTTATTTFRDTNLSEEYX 321
           +FI+++  E    ++  FP+S P ++E+K+V+   +   + +       F          
Sbjct: 246 KFIELKTQELFHQIIPKFPMSKPALLEMKSVIKGDTAELDRLVAQIYNDF---------- 295

Query: 322 XXXXXXXXXXXQRKFLNPCIPTIPLIRALVKMTNSFLILDPRGQXXXXXXXXXXXXXQRR 381
                       ++ L P + T+ ++   VK     +++DP G+             + R
Sbjct: 296 -----------HKELLVPSVTTVEILLYYVKTIKCLMVVDPTGRSMNRFTSKLKPKIKER 344

Query: 382 TTDIVNILLYAMLNLNEMELHKLGCNIDFDIESFNILVSELYPTIIKSMNQNQNNPSVVP 441
           +  I+++L  A+L L+  E+H        ++ S N L     P ++  +++   N + + 
Sbjct: 345 SDLIISVLC-AILELDSDEIH--------EVISKNTLTEN--PQLLSQLSKELKNSTALT 393

Query: 442 YTTAGTGTTCSNERITNDDIPYQNVKDMANANTMEYLARRKPETKPFFDLFKQYLEWVPP 501
           + +  T                        A        R+ +      L KQ+LEW P 
Sbjct: 394 FHSMSTSK--------------------GKAAIYSVAFERQDQ------LVKQFLEWTPE 427

Query: 502 MNKIYDSTSKNTVVDDEETSRIR-SRHAIDYLFRFFDSIDXXXXXXXXXXTEKFIHSKNY 560
                   +K    DD+    +   +  ++ +F+ FDS +          T   +    Y
Sbjct: 428 PGPFTADDAKALNSDDDGAETLELPKDVLEVVFQVFDSPEVLINEFIQLVTNHMLQMDGY 487

Query: 561 YTXXXXXXXXXXXXKE--KSNSSNVPDENVKSTINTIDIMLNDMKRSASYGKDKKHTKEN 618
                         K+  K+N   +     +S +  + +M +D+++SA++   +  + + 
Sbjct: 488 VLNAKWSQLLKTVMKKYFKNNKQVLKSMCEESNLVNVFVMWSDLEKSATF---QTWSTKL 544

Query: 619 NMVQGDIGFYPKEVSKLYWKINSTNIAKWRMNMKGDFFHLLKYSKTAEPNHTMDIKLNRF 678
            +V  ++  YPK +S LYWKI        R +  GD+         A     +  ++ + 
Sbjct: 545 QLVPPNV--YPKIISYLYWKIG-------RRSPYGDY-------AVAPGLAAIFDQMEKA 588

Query: 679 FNELGRKGKKMELYKDKSLMEMKISFDDGRELFFDNITIEQYDVLSLFTVEKGAAFTLEK 738
           F E    G+K+   KD+  +++++ F+DGR  +   +++ +Y V+ LF  +         
Sbjct: 589 F-ETRSPGRKLRFQKDQGSVDLQLVFEDGRH-WSSRVSLPKYTVIDLFQRQACPL----S 642

Query: 739 AYDFFSGLKRGKQKLEECIQFW 760
             D  +      + +E+ IQFW
Sbjct: 643 VTDIAAHTNMSPRLVEDIIQFW 664

>KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {ON}
           Anc_8.321 YLR127C possible pseudogene; NNN added to
           avoid internal stop codon
          Length = 797

 Score =  134 bits (338), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 160/707 (22%), Positives = 281/707 (39%), Gaps = 113/707 (15%)

Query: 25  QYHPQLQTMLLWLNPNETTTQSATTMTIDLKNCINIIVSTYGKDDQIRLLFKKYYSFVIK 84
           Q    L+ ++ W++P      +    ++ +K  I    S  GK  ++   FK YY  VIK
Sbjct: 20  QEQDDLERVMGWIHPQ---AHACHPPSLRMKKAIR---SVLGKASELDRQFKIYYIDVIK 73

Query: 85  LHFMKDNRPKNMTSIREFHKLENLYLTPLRFT--YDLIDTNEMQSLINIFKRYLINNNFT 142
             ++ D   +    I+    LE+  + P+ +     + D   ++  I   + YL++N+  
Sbjct: 74  QEYLCDQVKREFKHIQ---VLESKLVYPVTYLPFLSISDQLAIEQTICSLRHYLVDNDDN 130

Query: 143 FRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLNDANGNV-SPIXXXXXXXXRKIEKF 201
            R +++   ETL + +D FE  Y      +I+ WL  AN  +  P          KI   
Sbjct: 131 LRNSLVAEFETL-MQDDDFESGY------QIIEWLYTANAKLLRPWNLALDTIVSKISTL 183

Query: 202 CQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQFDYGDVENDHALTNLIYYFFTQ 261
           C  EM   W  +F++M  FN FIN YW  ++K  H         E++H  T ++Y  F +
Sbjct: 184 CDNEMRRNWEAKFLVMNTFNKFINLYWSHLAKFLHLS-------EDNHDFTKVLYKCFEK 236

Query: 262 QFIKIRINESLKIMVSNFPISTPTIIELKNVLITSSMPRENVSTTATTTFRDTNLSEEYX 321
           +F++IR  E  +I+V ++  +  TI+EL+  +       E +S       +   +     
Sbjct: 237 EFVRIRTEEIFEIVVESYQAAKTTILELRTFM----SGYERLSKLVNQFLKQFKI----- 287

Query: 322 XXXXXXXXXXXQRKFLNPCIPTIPLIRALVKMTNSFLILDPRGQXXXXXXXXXXXXXQRR 381
                        K LNP + T+  + A ++    F+ILDPR +              +R
Sbjct: 288 -------------KVLNPSVNTVEALVAFIRSVKCFVILDPRARHMHTITNFVKPFFHQR 334

Query: 382 TTDIVNILLYAMLNLNEMELHKLGCNIDFDIESFNILVSELYPTIIKSMNQNQNNPSVVP 441
             D V I+LYA+L+L +++  K+G +    ++  + L  EL      ++N     P+  P
Sbjct: 335 -GDAVQIILYAILDLRDVDFEKMGVS---PVKGLSELSHELREDPYVNINAKCQTPTPSP 390

Query: 442 YTTAGTGTTCSNERITNDDIPYQNVKDMANANTM-EYLARRKPETKPFFDLFKQYLEWVP 500
              +      S+    +D +      D+     + ++  R   ET               
Sbjct: 391 SKISSPHLNDSSSMDVDDKLD-DGTTDLVYKQVLNQFXXRGHHETN-------------- 435

Query: 501 PMNKIYDSTSKNTVVDDEETSRIRSRHAIDYLFRFFDSIDXXXXXXXXXXTEKFIHSKNY 560
                   T     V+ + + R    + +D LF  FD  D          T K       
Sbjct: 436 ------QGTRDYVGVNVKFSQRSNRTNLLDPLFELFDKKDELLSCFLKLLTLKLFKLSG- 488

Query: 561 YTXXXXXXXXXXXXKEKSNSSNVPD-----------------ENVKSTINTIDIMLNDMK 603
           YT            K K    +V D                 E V  ++N ID+ML+D++
Sbjct: 489 YTLEPNWNECYQLIKRKVTKGDVGDGGPLSRDTADAPVSSNNEQVLLSLNKIDVMLHDLR 548

Query: 604 RSASYGKDKKHTKENNMVQGDIGFYPKEVSKLYWKINSTNIAKW--RMNMKGDFFHLLKY 661
            +A   K  +     +M+ G++  +PK +S  YW        K   R  +K D       
Sbjct: 549 ENA---KITRRLHRTSMLNGNV--FPKFISSQYWSYRDDTFTKAGNRDQIKID------- 596

Query: 662 SKTAEPNHTMDI-KLNRFFNELGRKGKKMELYKDKSLMEMKISFDDG 707
                P    DI +    F EL + G+ + L K+K++ E++++ +DG
Sbjct: 597 -----PVLETDILQYGGRFCEL-KYGRMVRLCKEKTIFEIELTVNDG 637

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 845 IFPFINGMLENLGSMKLEKIHSFLKMTVPRDFEYNR-IAIHQLENYLNGLVEDEK-LETT 902
           ++ FI GMLE+LG++   +IH +L  TVP    Y   + + QL+ YL+  V+    L+ T
Sbjct: 730 VWTFIRGMLESLGTLSCAEIHEYLAATVPATIRYQETVTMLQLQGYLDYNVQSTHLLQQT 789

Query: 903 TDGAFK 908
            +G +K
Sbjct: 790 PEGEYK 795

>Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 511
           aa] {ON} ANNOTATED BY YGOB -
          Length = 511

 Score =  120 bits (300), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 99/321 (30%), Positives = 161/321 (50%), Gaps = 40/321 (12%)

Query: 592 INTIDIMLNDMKRSASYGKDKKHTKENNMVQG-DIGFYPKEVSKLYWKINSTNIAKWRMN 650
           IN ID+ML D+K S         T   + ++G D    PK +S LYW     + +K    
Sbjct: 224 INNIDVMLWDLKTSGDL------TSRMHQIEGLDRRIQPKFISSLYWDQAKESKSKGNNA 277

Query: 651 MKGDFFHLLKYSKTAEPNHTMDIKLNRFFNELGRKGKKMELYKDKSLMEMKISFDDGREL 710
            +     LL          T   K  R ++EL + G+ + L KD   +E++ +F+DGR +
Sbjct: 278 KQTQIDPLLS---------TQLEKYIRVYSEL-KPGRTLHLLKDHGTVELEFTFEDGRTI 327

Query: 711 FFDNITIEQYDVLSLFTVEKGA-AFTLEKAYDFFSGLKRGKQKLEECIQFWXXXXXXXXX 769
             D  T+EQ ++++ F+        +LE+ +   SG++     L++ +QFW         
Sbjct: 328 SCD-ATLEQSNIINYFSEAVSENGLSLEQLH-ILSGIE--STGLKKILQFWVDEKVLYFD 383

Query: 770 XXXGCYKVLERLTFLDEIKQRKKMQEETVIKSDARMGIDHDYVQEAAEDDDIAGFETHKD 829
                Y++LE   +LD        Q E +++S    G   + ++E  + + ++      D
Sbjct: 384 GQ--LYRILE---YLD--------QPEIIVQSLTHTG---EVLKEEQKLNPLSSSSITSD 427

Query: 830 VISRANDEIKNILDRIFPFINGMLENLGSMKLEKIHSFLKMTVPRDFEYNRIAIHQLENY 889
           +     ++I   L+ ++P+I GML NLGS+KLEKIHSFL+ TVP+D  YN I +  LE Y
Sbjct: 428 IDQM--NKIHETLNNVWPYIKGMLTNLGSLKLEKIHSFLRATVPKDVNYNSITVSSLEVY 485

Query: 890 LNGLVEDEKLETTTDGAFKKP 910
           LN LVED+ LE    G+++ P
Sbjct: 486 LNSLVEDDVLELLASGSYRLP 506

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 43/86 (50%), Gaps = 2/86 (2%)

Query: 337 LNPCIPTIPLIRALVKMTNSFLILDPRGQXXXXXXXXXXXXXQRRTTDIVNILLYAMLNL 396
           +NP I T+  + A VK   SFL LDP G+             Q R  D+V++LLYA+L+L
Sbjct: 1   MNPSITTVDALIAYVKTVKSFLTLDPSGKYLHSISTFVNPYLQER-NDLVSVLLYAILDL 59

Query: 397 NEMELHKLGCNIDFDIESFNILVSEL 422
                 +   NI  D +S  IL  EL
Sbjct: 60  QSENFQEEAQNI-LDADSLVILSDEL 84

>KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]
           {ON} weakly similar to uniprot|Q7LGV7 Saccharomyces
           cerevisiae YLR127C
          Length = 697

 Score =  112 bits (280), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 165/734 (22%), Positives = 285/734 (38%), Gaps = 110/734 (14%)

Query: 7   TDVDLSRITESIFVSIDPQYHPQLQTMLLWLNPNETTTQSATTMTIDLKNCINIIVSTYG 66
           TD +L  + E I +++      ++  +L WLNP    T      T+ +K C+ +++    
Sbjct: 4   TDDELKLLHEKILLNLASNLEEEVDMVLAWLNP----TFQPQIPTLRIKQCLKVVLEQ-- 57

Query: 67  KDDQIRLLFKKYYSFVIKLHFMKDNRPKNMTSIREFHKLENLYLTPLRFTYDLIDTNEMQ 126
            D++ R L ++YY  +I+ HF    +  ++ + ++  KLE LY++ + F +        +
Sbjct: 58  SDERTRFLIEQYYLTLIRTHFFL--QFDDIVNWKDMIKLEKLYISKVEFMFGTSVYWIKE 115

Query: 127 SLINIFKRYLINNNFTFRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLNDANGNVSP 186
            +I+ FKR L+  N  FRK +   +E+  L  D   F       +++  WL  A      
Sbjct: 116 EMIS-FKRLLMKKNNEFRKQLHAKLESHILDNDLVRF-------DQMYQWLAPAFDG-QE 166

Query: 187 IXXXXXXXXRKIEKFCQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQFDYGDVE 246
           I         K+++  Q+ M    + R+++M  +N FI  +W   SKL          +E
Sbjct: 167 IEFNVRIINLKVDQMSQKLMKNKIDDRYLVMNTYNHFIKDFWSKFSKLL--------IIE 218

Query: 247 NDHALTNLIYYFFTQQFIKIRINESLKIMVSNFPISTPTIIELKNVLITSSMPRENVSTT 306
           +DH LT +IY  F + +IK + +E    +V  FP S   ++EL+++L       +++ T 
Sbjct: 219 DDHELTAIIYQSFEKNYIKYKCDEFYTDIVPKFPASRKCLLELRSIL------NKDIKTV 272

Query: 307 ATTTFRDTNLSEEYXXXXXXXXXXXXQRKFLNPCIPTIPLIRALVKMTNSFLILDPRGQX 366
            T       L   +              +FL   + T  ++   +K      I+DP G  
Sbjct: 273 GTKVLE--TLYHGFVS------------RFLTSSLLTCEILYYYIKTVKCLKIIDPMGIC 318

Query: 367 XXXXXXXXXXXXQRRTTDIVNILLYAMLNLNEMELHKLGCNIDFDIESFNILVSELYPTI 426
                         R  DI+  LL  +      E  K+  + D    S ++   E +   
Sbjct: 319 LRSLSKAVRVYLNPR-PDIIKTLLLGIFPFQNNERFKIASSTDG--SSVHLEKLEQFSRE 375

Query: 427 IKSMNQNQNNPSVVPYTTAGTGTTCSNERITNDDIPYQNVKDMANANTMEYLARRKPETK 486
           +   +     P+ +P+        C+ +    DD                          
Sbjct: 376 VGDFSMGPELPTALPWFNQPHLPRCTYD---GDD-------------------------- 406

Query: 487 PFFDLFKQYLEWVPPMNKIYDSTSKNTVVD--DEETSRIRSRHAIDYLFRFFDSIDXXXX 544
               L KQYL WVP   +I     K  V D  D +   +     I  L    +S      
Sbjct: 407 ---QLLKQYLNWVPEPPRI-----KLDVEDFADNDGKYVPPVDLIHVLLDVLESKRTLVD 458

Query: 545 XXXXXXTEKFIHSKNYYTXXXXXXXXXXXXK--EKSNSSNVPDENVKST-INTIDIMLND 601
                 + KFI S+ Y                 E +    V  E    T +N +DIML D
Sbjct: 459 DLLGVVSGKFIESEEYSLDPEWQRIMDIILNHLEGTRKGTVTSEEADLTHLNDVDIMLED 518

Query: 602 MKRSASYGKDKKHTKENNMVQGDIGFYP--KEVSKLYWKINSTNIAKWRMNMKGDFFHLL 659
           ++ S+ +     H K N+  +     +P  K +SKLYW+ +  N+    +  K       
Sbjct: 519 LRLSSQFRNQVAH-KNNSHFEN----FPHIKILSKLYWR-HYQNLNGRLVTTK------Y 566

Query: 660 KYSKTAEPNHTMDIKLNRFFNELGRKGKKMEL-YKDKSLMEMKISFDDGRELFFDNITIE 718
           K+    EP   +  KL + +  L   G+ ++      S + + I    G   FF  +T+E
Sbjct: 567 KWDSEMEP---LIQKLTKVYERLN-TGRTLKFDTGSSSRVSINIVTKSGERRFF-KVTME 621

Query: 719 QYDVLSLFTVEKGA 732
           QY V+S F  E   
Sbjct: 622 QYLVISHFQNETNG 635

>TDEL0E03780 Chr5 (712981..713625) [645 bp, 214 aa] {ON} Anc_5.248
           YKL142W
          Length = 214

 Score = 31.6 bits (70), Expect = 6.1,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 40/85 (47%), Gaps = 8/85 (9%)

Query: 828 KDVIS---RANDEIKNILDRIFPFINGMLENLGSMKLEKIHSFLKMTVPRDFEYNRIAIH 884
           KD++S    A+ EI  + D +FP   G  ENL ++ L ++  F ++  P   E       
Sbjct: 103 KDLLSPLPNADAEIPVVGDGLFPRSLGDFENLSNVALFRLAKFYELMPPSLKEQ-----E 157

Query: 885 QLENYLNGLVEDEKLETTTDGAFKK 909
             EN+L G VE+  +    D   KK
Sbjct: 158 HFENFLEGKVEEFHISELKDEEVKK 182

>KNAG0F02390 Chr6 complement(447686..449221) [1536 bp, 511 aa] {ON}
           Anc_6.139 YBR233W
          Length = 511

 Score = 32.3 bits (72), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 10/84 (11%)

Query: 828 KDVISRAN--DEIKNILDRIFPFINGMLENLGSMKLEKIHSFLKMTVPRDFEYNRIAIHQ 885
           +D  +R N  D +KN+ +R+  ++ G  EN+ S   E+I + +     R    N      
Sbjct: 135 RDTNTRINVSDNLKNVRERVI-YVRGQCENVASA-FEQISNCIYNKCKRGLSKNG----- 187

Query: 886 LENYLNGLVEDEKLETTTDGAFKK 909
            +N  N  + DEK  T+TDG+  K
Sbjct: 188 -KNDSNNSLSDEKSTTSTDGSITK 210

>NCAS0B05570 Chr2 (1052241..1057049) [4809 bp, 1602 aa] {ON}
           Anc_8.163
          Length = 1602

 Score = 32.3 bits (72), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 661 YSKTAEPNHTMDIKLNRFF--NELGRKGKKMELYKDKSLMEMKISFDDGR 708
           YS+ ++P H     L  FF  N   RKG K +  K  S    KIS D+G+
Sbjct: 389 YSQLSQPKHLKGTMLGSFFPRNRRARKGSKKQQEKSSSKGITKISVDNGQ 438

>Skud_12.40 Chr12 (79588..82314) [2727 bp, 908 aa] {ON} YLL026W
           (REAL)
          Length = 908

 Score = 32.3 bits (72), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 43/91 (47%), Gaps = 15/91 (16%)

Query: 25  QYHPQLQTMLLWLNPNETTTQSATTMTIDLKNCINIIVSTYGKD-------DQIRLLFKK 77
           + HP + T++L +  +   T S    TID  NCI I+ S  G +        +I+ L K 
Sbjct: 690 KAHPDVLTVMLQMLDDGRIT-SGQGKTIDCSNCIIIMTSNLGAEFINSQQGSKIQELTKN 748

Query: 78  YYSFVIKLHFMKDNRPK---NMTSIREFHKL 105
                +K HF    RP+    ++SI  F+KL
Sbjct: 749 LVMNAVKQHF----RPEFLNRISSIVIFNKL 775

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 96,542,969
Number of extensions: 4421474
Number of successful extensions: 16247
Number of sequences better than 10.0: 48
Number of HSP's gapped: 16702
Number of HSP's successfully gapped: 69
Length of query: 911
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 792
Effective length of database: 39,836,145
Effective search space: 31550226840
Effective search space used: 31550226840
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)