Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G025908.322ON28628614690.0
TDEL0F044808.322ON2602856555e-85
KAFR0H022708.322ON2682866131e-78
YLR128W (DCN1)8.322ON2692826011e-76
Kpol_1036.688.322ON2562865903e-75
CAGL0M04257g8.322ON2732845853e-74
NCAS0C032708.322ON1842155755e-74
KNAG0G024408.322ON2652835611e-70
ZYRO0F10362g8.322ON2512855224e-65
TPHA0C008208.322ON2662945159e-64
SAKL0H15576g8.322ON2822865054e-62
Suva_10.2218.322ON1782104679e-58
Skud_12.1978.322ON1792104619e-57
TBLA0A039308.322ON2662894472e-53
Kwal_56.239148.322ON2652864402e-52
AGL194C8.322ON2562794271e-50
Ecym_42538.322ON2582824183e-49
KLLA0D16346g8.322ON3012904143e-48
KLTH0G12320g8.322ON2542734043e-47
Smik_12.1918.322ON1251553072e-34
AGL058Cna 1ON96979770.37
KAFR0I02140singletonON12064710.54
Ecym_7269na 1ON98079740.88
KLTH0F07656g7.456ON20184720.96
Suva_5.2257.401ON138681712.1
KLLA0D00792g6.7ON102089703.0
CAGL0K05401g7.456ON20737673.6
TPHA0A016108.313ON168967668.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G02590
         (286 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON...   570   0.0  
TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa...   256   5e-85
KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON...   240   1e-78
YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {...   236   1e-76
Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 ...   231   3e-75
CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} simila...   229   3e-74
NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON...   226   5e-74
KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.32...   220   1e-70
ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 a...   205   4e-65
TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 ...   202   9e-64
SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa] ...   199   4e-62
Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W...   184   9e-58
Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W...   182   9e-57
TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.32...   176   2e-53
Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W...   174   2e-52
AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, ...   169   1e-50
Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa] ...   165   3e-49
KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 3...   164   3e-48
KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315) ...   160   3e-47
Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W...   122   2e-34
AGL058C Chr7 complement(599289..602198) [2910 bp, 969 aa] {ON} N...    34   0.37 
KAFR0I02140 Chr9 complement(439942..440304) [363 bp, 120 aa] {ON}      32   0.54 
Ecym_7269 Chr7 complement(566660..569602) [2943 bp, 980 aa] {ON}...    33   0.88 
KLTH0F07656g Chr6 (663648..664253) [606 bp, 201 aa] {ON} similar...    32   0.96 
Suva_5.225 Chr5 complement(342111..346271) [4161 bp, 1386 aa] {O...    32   2.1  
KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar...    32   3.0  
CAGL0K05401g Chr11 complement(531444..532067) [624 bp, 207 aa] {...    30   3.6  
TPHA0A01610 Chr1 (319885..324954) [5070 bp, 1689 aa] {ON} Anc_8....    30   8.3  

>NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON}
           Anc_8.322 YLR128W
          Length = 286

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/286 (97%), Positives = 280/286 (97%)

Query: 1   MAKKYLSRNNWRLNYALNEYYDKEIGSFIGXXXXXXGCKTILPDLNKYPQELIALFKKYS 60
           MAKKYLSRNNWRLNYALNEYYDKEIGSFIG      GCKTILPDLNKYPQELIALFKKYS
Sbjct: 1   MAKKYLSRNNWRLNYALNEYYDKEIGSFIGDDDDDDGCKTILPDLNKYPQELIALFKKYS 60

Query: 61  SKNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQ 120
           SKNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQ
Sbjct: 61  SKNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQ 120

Query: 121 GCSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSN 180
           GCSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSN
Sbjct: 121 GCSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSN 180

Query: 181 DTSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKEITK 240
           DTSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKEITK
Sbjct: 181 DTSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKEITK 240

Query: 241 DQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGRI 286
           DQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGRI
Sbjct: 241 DQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGRI 286

>TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa]
           {ON} Anc_8.322 YLR128W
          Length = 260

 Score =  256 bits (655), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 136/285 (47%), Positives = 172/285 (60%), Gaps = 46/285 (16%)

Query: 2   AKKYLSRNNWRLNYALNEYYDKEIGSFIGXXXXXXGCKTILPDLNKYPQELIALFKKYSS 61
           AK +L RN W+L YALN+YYD+  G FI                  YP+EL+AL+ KY  
Sbjct: 22  AKDFLRRNQWKLEYALNDYYDQMPGGFIEEPHTPV----------TYPEELLALYDKYVL 71

Query: 62  KNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQG 121
           ++ +     ID+DG+I  I DL Y LEDLVTICLAKLLHC  L DGI+K QFL NWY+QG
Sbjct: 72  EDQNK----IDIDGMIQLIEDLDYKLEDLVTICLAKLLHCTRLADGISKDQFLHNWYMQG 127

Query: 122 CSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSND 181
           CSTL QM+HVL+DLD KLH D  Y T IYNYTFDL +D +  D                 
Sbjct: 128 CSTLPQMRHVLDDLDTKLHTDLEYMTDIYNYTFDLALDQNKRD----------------- 170

Query: 182 TSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKEITKD 241
                        LD +TA  YW++FF       V VN  LL+ W  FL+ E+K  +T+D
Sbjct: 171 -------------LDTDTAAEYWRLFFQPGTA--VHVNPALLNSWLAFLDSEQKTVVTRD 215

Query: 242 QWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGRI 286
            W+MLLEFFK+F +L  +K +Y+E  AWPY+IDE+YEYL+D+  I
Sbjct: 216 TWKMLLEFFKQFPSLSAVKTSYNEADAWPYIIDEYYEYLEDSRLI 260

>KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON}
           Anc_8.322 YLR128W
          Length = 268

 Score =  240 bits (613), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 128/286 (44%), Positives = 177/286 (61%), Gaps = 40/286 (13%)

Query: 1   MAKKYLSRNNWRLNYALNEYYDKEIGSFIGXXXXXXGCKTILPDLNKYPQELIALFKKYS 60
           MA+KYLS+N W +NYALN++YD E+G F                   YP+EL+ LF+ Y 
Sbjct: 23  MARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNRRAV-------YPKELVQLFRDYC 75

Query: 61  SKNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQ 120
           S++      +ID  G+I  I D    +EDL TICLA +LH ENL+D I +  FL   + Q
Sbjct: 76  SEDT-----YIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDFLQYLFEQ 130

Query: 121 GCSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSN 180
           GC T+  ++ VL DL+ KL+ D +YFT IYN++F LI+D    D TRN +          
Sbjct: 131 GCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILD----DDTRNQS---------- 176

Query: 181 DTSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKEITK 240
                         +D++ AI YWK+FF       V+++ ELLSLWFQFL +ERKK+++K
Sbjct: 177 --------------IDMDIAIEYWKLFFLNESIQSVEISNELLSLWFQFLADERKKQVSK 222

Query: 241 DQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGRI 286
           D WQM+LEFF+KF +LE +K++YDE   WP++IDEFYEYLQDTG++
Sbjct: 223 DIWQMILEFFRKFKDLESLKESYDENDPWPFVIDEFYEYLQDTGKL 268

>YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {ON}
            DCN1Scaffold-type E3 ligase required for cullin
           neddylation and ubiquitin ligase activation; contains a
           ubiquitin-binding domain (UBA) for ubiquitin and Nedd8
           (Rub1p) interaction and a PONY domain involved in cullin
           binding and neddylation
          Length = 269

 Score =  236 bits (601), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 122/282 (43%), Positives = 170/282 (60%), Gaps = 45/282 (15%)

Query: 1   MAKKYLSRNNWRLNYALNEYYDKEIGSFIGXXXXXXGCKTILPDLNKYPQELIALFKKYS 60
           +++KYL RN+W +NYALN+YYDKEIG+F                   YP+EL  +F+ Y 
Sbjct: 31  VSRKYLQRNHWNINYALNDYYDKEIGTFTDEVSTVAHPPV-------YPKELTQVFEHYI 83

Query: 61  SKNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQ 120
           + N        D+D L+ +I +L YNLEDL T+CLA LL  + L++ + ++ FLS W++Q
Sbjct: 84  NNN------LFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQ 137

Query: 121 GCSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSN 180
           GCST+  MQ  +  LDVKLH+D  YFTQIYNY F+LI+D                     
Sbjct: 138 GCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILD--------------------- 176

Query: 181 DTSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKEITK 240
                  P  KD  +D +  I YWK+FF    +YPV++  +LL  WF+FL +E K  I+K
Sbjct: 177 -------PNRKD--IDTDEGIQYWKLFF--QPEYPVRMEPDLLEAWFRFLRDEGKTTISK 225

Query: 241 DQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQD 282
           D W+MLL FFK++  ++ +  +YDETAAWP++IDEFYE LQD
Sbjct: 226 DTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQD 267

>Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 aa]
           {ON} (188159..188161,188259..189026) [771 nt, 257 aa]
          Length = 256

 Score =  231 bits (590), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 132/286 (46%), Positives = 180/286 (62%), Gaps = 47/286 (16%)

Query: 1   MAKKYLSRNNWRLNYALNEYYDKEIGSFIGXXXXXXGCKTILPDLNKYPQELIALFKKYS 60
           +A KYL RNNW LNYALNEYYDKE+GSF+           +  ++ +YP+ELI +FKKYS
Sbjct: 18  VATKYLKRNNWNLNYALNEYYDKEVGSFL-----------VEEEVIEYPEELIQIFKKYS 66

Query: 61  SKNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQ 120
           + N +S    ID DG I  INDL Y LED+VTICLA+L+HC++L   I K QFLS WY Q
Sbjct: 67  NDNGES----IDTDGFIQLINDLDYQLEDIVTICLAELMHCKSLSLPITKDQFLSTWYEQ 122

Query: 121 GCSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSN 180
           GCS L+ M+ +L+DLD KL  D  Y+T IY Y+FDLI D                   SN
Sbjct: 123 GCSQLKHMKILLDDLDHKLQNDIRYYTHIYRYSFDLIRD-------------------SN 163

Query: 181 DTSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKEITK 240
           +  I           + + AI YWK+FF  + + P+ +N+  L+ W +F+N    + IT+
Sbjct: 164 EKCI-----------EKDMAIEYWKLFF--SSKCPITINELQLNSWIEFINVNEIESITR 210

Query: 241 DQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGRI 286
           D W+ LLE+FKK+  LE++ +NY+E   WPY++DE+YE+L+DT RI
Sbjct: 211 DVWERLLEYFKKYPTLEILSKNYNELDPWPYIMDEYYEFLEDTKRI 256

>CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} similar
           to uniprot|Q12395 Saccharomyces cerevisiae YLR128w
          Length = 273

 Score =  229 bits (585), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 131/284 (46%), Positives = 169/284 (59%), Gaps = 42/284 (14%)

Query: 2   AKKYLSRNNWRLNYALNEYYDKEIGSFIGXXXXXXGCKTILPDLNKYPQELIALFKKYSS 61
           AK+YLS NNW +NYALNEYYDKE+G F            ++    KYP EL++LF  Y++
Sbjct: 25  AKRYLSANNWNINYALNEYYDKEVGGFTEDH--------MIRHQFKYPDELVSLFGHYAA 76

Query: 62  KNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQG 121
              +   + I  DGLI+YI DL YNLEDLVTI LA  L C+NL++ I ++QFL  WY +G
Sbjct: 77  LIEEDGTQSITPDGLIDYIQDLGYNLEDLVTISLAHFLQCKNLENPITEKQFLYFWYNEG 136

Query: 122 CSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSND 181
           C TLEQM+H L D + KL  D  YFT IYNY+FDL                     N++ 
Sbjct: 137 CYTLEQMRHYLEDCERKLCNDWKYFTTIYNYSFDL---------------------NASK 175

Query: 182 TSIVIVPRMKDNNLDVETAIAYWKVFFNVNE---QYPVKVNKELLSLWFQFLNEERKKEI 238
             +V          + + AI YWK+FF  N       +KV++  L LW +FL +E KK I
Sbjct: 176 QGVV----------ETDIAIEYWKLFFEENRTKLSGIIKVDQAHLDLWCKFLQDEHKKLI 225

Query: 239 TKDQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQD 282
            KD WQMLL FFKKF +L+ +K  Y+E  AWPY IDEFYEYL++
Sbjct: 226 HKDTWQMLLLFFKKFPSLDAIKTEYNEADAWPYTIDEFYEYLEE 269

>NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON}
           Anc_8.322 YLR128W
          Length = 184

 Score =  226 bits (575), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 145/215 (67%), Gaps = 32/215 (14%)

Query: 73  VDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQGCSTLEQMQHVL 132
           +DGL+NY++DL  +LEDLVTICL  LLHC+N+KD I + QFL NW+LQGCS + QM+ VL
Sbjct: 1   MDGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVL 60

Query: 133 NDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSNDTSIVIVPRMKD 192
            DL+ KLH D  YF  IYNYTF LI D                                D
Sbjct: 61  VDLNDKLHSDKQYFIDIYNYTFGLITD-------------------------------PD 89

Query: 193 NNLDVETAIAYWKVFFNVNE-QYPVKVNKELLSLWFQFLNEERKKEITKDQWQMLLEFFK 251
            +L+VETA+AYWK+F    E ++PV+V+  LL+LWFQFL+EE KK IT+D W ML+ FF+
Sbjct: 90  KDLEVETAVAYWKLFLQPKEGEFPVRVDPTLLNLWFQFLDEENKKFITQDYWHMLVVFFQ 149

Query: 252 KFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGRI 286
           KF NL ++K+ YDETAAWPY+IDE+YEYLQDT  I
Sbjct: 150 KFPNLNVIKEGYDETAAWPYIIDEYYEYLQDTNHI 184

>KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.322
           YLR128W
          Length = 265

 Score =  220 bits (561), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 118/283 (41%), Positives = 170/283 (60%), Gaps = 43/283 (15%)

Query: 2   AKKYLSRNNWRLNYALNEYYDKEIGSFIGXXXXXXGCKTILPDLNKYPQELIALFKKYSS 61
           A++YL  ++W +NYALN++YDKE+G+F          K +  D   YP ELI +F +YS 
Sbjct: 21  AERYLRESHWNVNYALNDFYDKEVGNFFSTY------KDVPQDNVVYPPELIHVFDQYSE 74

Query: 62  KNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQG 121
                    I  +G+I YI DL  +++DLVTICLA+LL  ENL   I ++QFL+ W+LQG
Sbjct: 75  AG------VITFEGMITYIGDLSLSIDDLVTICLAQLLGWENLLAPITREQFLAQWFLQG 128

Query: 122 CSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSND 181
           CST+ +M+ VL DL+ KL +D  YF +IY YTF L+++ D                    
Sbjct: 129 CSTINEMKTVLADLNGKLEKDRGYFKEIYMYTFPLLVEPD-------------------- 168

Query: 182 TSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKK-EITK 240
                      N LD  + I YWK+FF+  ++YP+ +++ELL  WF +L E+ +   +T+
Sbjct: 169 ----------QNKLDAASTIEYWKLFFDQEKKYPMIIDQELLDPWFVYLGEQSENMSVTE 218

Query: 241 DQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQDT 283
           D W+M+ +FF +F +L  +KQ YDE AAWP +IDEF EYLQDT
Sbjct: 219 DIWKMVYQFFNRFRSLGDVKQGYDEMAAWPILIDEFIEYLQDT 261

>ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 251

 Score =  205 bits (522), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 115/285 (40%), Positives = 152/285 (53%), Gaps = 52/285 (18%)

Query: 2   AKKYLSRNNWRLNYALNEYYDKEIGSFIGXXXXXXGCKTILPDLNKYPQELIALFKKYSS 61
           A+ YL+ +NW +N ALN+YYD E                       Y  EL  LF+KY+ 
Sbjct: 19  ARDYLNTHNWDVNQALNDYYDSEHDQ-----------------DQSYSPELPQLFRKYAV 61

Query: 62  KNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQG 121
                    +D DGLI YI DL Y +++L TICLA+LLHC+ L DGI + QF  NW   G
Sbjct: 62  VTPHGF--IMDTDGLIRYIGDLGYEIDNLATICLAQLLHCQRLTDGITEGQFSYNWQQNG 119

Query: 122 CSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSND 181
           C++L QM  ++  LD KL  D  Y  QIYNYTF+L +D                      
Sbjct: 120 CTSLHQMGKLVQRLDHKLRTDQDYTAQIYNYTFELALD---------------------- 157

Query: 182 TSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKEITKD 241
                 P  K   L+  TA+ YW +FF    QYPV V ++   LW  F+ +E  + I++D
Sbjct: 158 ------PGAK--TLETHTAVQYWTLFFATG-QYPVIVEQQFFQLWISFVQQE--QSISRD 206

Query: 242 QWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGRI 286
            W+ML  FF +FSNL+ ++ NY+E  AWPY+IDEFYEYL D G I
Sbjct: 207 TWRMLFPFFNRFSNLQSVRDNYNEADAWPYIIDEFYEYLADKGEI 251

>TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 bp,
           266 aa] {ON} Anc_8.322 YLR128W
          Length = 266

 Score =  202 bits (515), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 120/294 (40%), Positives = 164/294 (55%), Gaps = 54/294 (18%)

Query: 1   MAKKYLSRNNWRLNYALNEYYDKEIGSFIGXXXXXXGCKTILPDLNKYPQELIALFKKY- 59
           +A+KYLS N+W LNYALNE+YD+E+G F+            +P   +YP ELI LF++Y 
Sbjct: 18  VARKYLSGNDWNLNYALNEFYDQELGGFVHD----------VP--REYPAELIELFERYN 65

Query: 60  -------SSKNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQ 112
                  SS N + +   ID DGLI +I DL Y LEDL T+CLA ++ C NL D I + Q
Sbjct: 66  NQKYVDGSSGNEEDV--GIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCITRNQ 123

Query: 113 FLSNWYLQGCSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNI 172
           FL  WY + CS ++ ++  L  +   L  D +YFT IYNY+F LI               
Sbjct: 124 FLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLI--------------- 168

Query: 173 GDDTTNSNDTSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNE 232
               T  N  SI I           +TA  YWK+FF   +  P+ + KE L  W +FL  
Sbjct: 169 ----TEENMKSIQI-----------DTAKEYWKLFF--GDGTPLHIEKEQLDNWNKFLTI 211

Query: 233 ERKKEITKDQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGRI 286
             KK ITKD+W+M+LEFFKKF  +   K  YD    WPY++DE++EYL++ G++
Sbjct: 212 SGKKTITKDEWKMILEFFKKFPTVTEFKDEYDPMDPWPYIMDEYHEYLEENGKL 265

>SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 282

 Score =  199 bits (505), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 156/286 (54%), Gaps = 49/286 (17%)

Query: 2   AKKYLSRNNWRLNYALNEYYDKEIGSFIGXXXXXXGCKTILPDLNKYPQELIALFKKYSS 61
           A KYLSRN+W L+YALNEYYDK+ G F+                 KY  EL+  F KY+ 
Sbjct: 44  ATKYLSRNSWALSYALNEYYDKKQGGFVNKKPV------------KYSHELVETFDKYAD 91

Query: 62  KNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQG 121
                    I V+ L+ YI DL Y LEDL TICLA+LL CE +   I +QQFLS+W   G
Sbjct: 92  SKR-----CITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQFLSSWTEHG 146

Query: 122 CSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSND 181
           C  +  M+H L DL+ +LHQD  YF+ IYNYT+DLI++    +S R              
Sbjct: 147 CKNMIHMKHELQDLEEQLHQDQDYFSHIYNYTYDLIVE----ESER-------------- 188

Query: 182 TSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEER-KKEITK 240
                       +L+++TA  YW++FF+ N  Y V ++   L  W +F  ++  +  +TK
Sbjct: 189 ------------HLNIDTAAEYWELFFH-NSHYAVTISDSRLKTWIEFYTKKSGRSTVTK 235

Query: 241 DQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGRI 286
           D W M L+F  KF + E + + YDE  AWP + DE+YEY+ +   I
Sbjct: 236 DTWTMFLKFIIKFPDDESLIRGYDEMDAWPLVFDEYYEYMDEALGI 281

>Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W
           (REAL)
          Length = 178

 Score =  184 bits (467), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 92/210 (43%), Positives = 129/210 (61%), Gaps = 32/210 (15%)

Query: 73  VDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQGCSTLEQMQHVL 132
           +D LI +I DL YNLEDL T+CL  LL  + L++ ++++ FLS W++QGCSTL  M+  +
Sbjct: 1   MDSLIKFIEDLGYNLEDLATLCLVHLLGYKKLEEPLDRETFLSAWFMQGCSTLPNMKKCV 60

Query: 133 NDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSNDTSIVIVPRMKD 192
             LD KLH+D  YFT+IY+YTF LI+D                 TN  D           
Sbjct: 61  KGLDAKLHEDLQYFTEIYDYTFHLILD-----------------TNRKD----------- 92

Query: 193 NNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKEITKDQWQMLLEFFKK 252
             +D E AI YW + F    +YP+ +   LL  WF+FL++E K+ ITKD W MLL+FFK+
Sbjct: 93  --IDTEEAIQYWTLLFQ--PEYPIHMEPGLLEAWFRFLHDEGKRTITKDAWHMLLQFFKQ 148

Query: 253 FSNLEMMKQNYDETAAWPYMIDEFYEYLQD 282
           +  +  +  +YDE AAWP++IDEFYE+L+D
Sbjct: 149 YPTIRSIIDDYDEAAAWPFIIDEFYEFLRD 178

>Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W
           (REAL)
          Length = 179

 Score =  182 bits (461), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 94/210 (44%), Positives = 126/210 (60%), Gaps = 32/210 (15%)

Query: 73  VDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQGCSTLEQMQHVL 132
           +D L+ +I DL Y+LEDL T+CL  LL  +NL++ + ++ FLS W++QGCSTL  MQ  +
Sbjct: 1   MDSLVKFIEDLGYSLEDLATLCLVDLLGYKNLEEPLKRETFLSTWFMQGCSTLPDMQGCI 60

Query: 133 NDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSNDTSIVIVPRMKD 192
             LDVKLH+D  Y+TQ+Y+Y F LI+     DS R N +I D                  
Sbjct: 61  KRLDVKLHEDLQYYTQVYDYAFRLIL-----DSNRKNIDIDD------------------ 97

Query: 193 NNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKEITKDQWQMLLEFFKK 252
                  AI YW +FF     YPV +   LL  WF FL +E K  I+KD W MLL FF++
Sbjct: 98  -------AIQYWTLFF--QPVYPVHIESNLLESWFHFLRDEGKTLISKDTWHMLLLFFQQ 148

Query: 253 FSNLEMMKQNYDETAAWPYMIDEFYEYLQD 282
           +  ++ +   YDETAAWP++IDEFYEYLQD
Sbjct: 149 YLTIQSIIDGYDETAAWPFIIDEFYEYLQD 178

>TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.322
           YLR128W
          Length = 266

 Score =  176 bits (447), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 103/289 (35%), Positives = 155/289 (53%), Gaps = 48/289 (16%)

Query: 2   AKKYLSRNNWRLNYALNEYYDKEIGSFI----GXXXXXXGCKTILPDLNKYPQELIALFK 57
           A+KYL RN WRL YALN++YD EIGSF+           G + + P        L  L+ 
Sbjct: 22  AQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKILGIEYVRP--------LTELYN 73

Query: 58  KYSSKNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNW 117
            Y+  +       +  +GL+  ++DL Y ++ LVT+CLAKL+ C +    I    F+ + 
Sbjct: 74  HYAIDSG-----VLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLSNFIDSL 128

Query: 118 YLQGCSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTT 177
               C +LE ++++LN+ D KL  +  Y+T IY+  F+L+++  +G  T           
Sbjct: 129 KANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLE--EGKKT----------- 175

Query: 178 NSNDTSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKE 237
                            +D ETA  YW +FF   + YP+KV  +    WF++L+    KE
Sbjct: 176 -----------------IDSETAQEYWDLFFAC-QNYPIKVQSDQYQQWFKYLSNANIKE 217

Query: 238 ITKDQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGRI 286
           ITKDQW MLL FFKKF +L  +++ Y E +AWPY+ DE+YEYL+D  +I
Sbjct: 218 ITKDQWAMLLRFFKKFPSLSELQRKYSEDSAWPYIFDEYYEYLEDNNKI 266

>Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W -
           Hypothetical ORF [contig 171] FULL
          Length = 265

 Score =  174 bits (440), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 102/286 (35%), Positives = 154/286 (53%), Gaps = 48/286 (16%)

Query: 1   MAKKYLSRNNWRLNYALNEYYDKEIGSFIGXXXXXXGCKTILPDLNKYPQELIALFKKYS 60
           +A+++LS NNW L+YALN+YYD   G F               D   Y  EL+ +F+KY 
Sbjct: 28  IAQQFLSNNNWALDYALNDYYDTVHGGFTT-------------DDRPYSPELLKVFQKYK 74

Query: 61  SKNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQ 120
           S++ +S    I + GL  +I DL   LED VT+CLA+L+ C +L++ I+   F+ +W+ +
Sbjct: 75  SEDKNS----ITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDTFIQSWHDR 130

Query: 121 GCSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSN 180
            C     M+  + +L+ KL  D SYF  IYNYTF L ++                     
Sbjct: 131 LCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALE--------------------- 169

Query: 181 DTSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKEITK 240
                  P+ K   L +ET+IAYW++ F+  + Y +KV +E L  W Q+L+ E  K + +
Sbjct: 170 -------PQQK--QLGLETSIAYWELLFSPAKPYAIKVPQERLQSWIQYLSGEVAK-VHR 219

Query: 241 DQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGRI 286
           D W+M L+F   F + E +K+ Y E  AWP +IDE+YEYL   G +
Sbjct: 220 DVWKMFLKFAVAFPDNEALKKGYSEDDAWPLVIDEYYEYLVARGDV 265

>AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, 256
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR128W (DCN1); 1-intron
          Length = 256

 Score =  169 bits (427), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 90/279 (32%), Positives = 146/279 (52%), Gaps = 53/279 (18%)

Query: 3   KKYLSRNNWRLNYALNEYYDKEIGSFIGXXXXXXGCKTILPDLNKYPQELIALFKKYSSK 62
           + YL RN+W L++AL+++Y +  G          G +       +Y  EL+A F++Y++ 
Sbjct: 26  ETYLERNHWSLDHALDDFYTQSGG----------GGRA-----EQYSAELVATFERYAAG 70

Query: 63  NNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQGC 122
                   +D + L+ Y+ DL + LED+ T+CLA+LL  E L   I++ QFLS W+  GC
Sbjct: 71  GA------MDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLSTWHGLGC 124

Query: 123 STLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSNDT 182
           S+L  M+  ++ L+++L  DA+YF  +Y YTF L +D                       
Sbjct: 125 SSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDA---------------------- 162

Query: 183 SIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKEITKDQ 242
                       L VETAIAYW +FF ++  Y V V    L  WF+FL       +++D 
Sbjct: 163 --------GGRRLSVETAIAYWSLFF-LDHTYAVTVPAPRLRSWFEFLRAG-DHSVSRDT 212

Query: 243 WQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQ 281
           W M   F ++F +   + ++Y+E A+WP +IDE+YE+++
Sbjct: 213 WDMFPRFAQRFPDDTELLEHYNELASWPLVIDEYYEWVK 251

>Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa]
           {ON} similar to Ashbya gossypii AGL194C 1-intron
          Length = 258

 Score =  165 bits (418), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 97/282 (34%), Positives = 143/282 (50%), Gaps = 51/282 (18%)

Query: 2   AKKYLSRNNWRLNYALNEYYDKEIGSFIGXXXXXXGCKTILPDLNKYPQELIALFKKYSS 61
           A+K+L+ N W L+YAL++ Y +                + L     Y  EL + F+ Y+S
Sbjct: 25  AEKFLNDNRWSLDYALDDLYTR--------------GTSYLNTERTYDAELYSTFQNYAS 70

Query: 62  KNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQG 121
           +N       +D D LI Y+ DL Y LED VTICLA+LL  ENL   I ++QFLS W   G
Sbjct: 71  ENGR-----MDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWADLG 125

Query: 122 CSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSND 181
           CS L  M   +N LD KLH+D  YF  IY+YTF + +D                      
Sbjct: 126 CSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDG--------------------- 164

Query: 182 TSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKE-ITK 240
                    K   L ++TAI+YW + F ++  +  K+ +  L  WF+FL E+     +T+
Sbjct: 165 ---------KRRQLSIDTAISYWTLLF-LDHSFATKIPRTRLESWFRFLREQNDANFVTR 214

Query: 241 DQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQD 282
           D W ML +F  KF + + +   Y E  AWP ++DE+Y ++++
Sbjct: 215 DTWDMLFKFALKFPDDKTLLSEYSEMGAWPLIMDEYYGWIKE 256

>KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 301
           aa] {ON} similar to uniprot|Q12395 Saccharomyces
           cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 301

 Score =  164 bits (414), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 159/290 (54%), Gaps = 52/290 (17%)

Query: 1   MAKKYLSRNNWRLNYALNEYYDKEIGSFIGXXXXXXGCKTILPDLNKYPQELIALFKKYS 60
           +A++YL +N  R+ YALN+YYD                 TI      Y   L+A+F+KYS
Sbjct: 60  VAQEYLRKNGGRVEYALNDYYD--------------NVDTIGGMRQSYNPSLVAIFEKYS 105

Query: 61  SKNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQ 120
             N  S  E+ D  GLI +I DL  ++ED +T+CL+++L  ++L   ++++QFL+ W   
Sbjct: 106 --NGVSATEW-DSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWSDL 162

Query: 121 GCSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSN 180
            C TL +M+  L+ L+ +L  D  YF  IY+YTF L            NT+ G       
Sbjct: 163 CCDTLRKMKAYLHTLEERLETDKDYFKSIYSYTFPL------------NTDEGS------ 204

Query: 181 DTSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEE----RKK 236
                        +L  + AI YW +FF  N +Y +K++KE L+ W +F+N +    RK+
Sbjct: 205 ------------RHLPKDVAIEYWNIFFKDN-KYALKISKERLNSWLEFINSDDSDPRKQ 251

Query: 237 EITKDQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGRI 286
            I+ D W M  +F +++ N E +KQNYDE AAWP +IDE+YE+L++  ++
Sbjct: 252 NISNDIWLMFYKFIEQYPNDESLKQNYDEMAAWPLLIDEYYEFLEENDKL 301

>KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315)
           [765 bp, 254 aa] {ON} similar to uniprot|Q12395
           Saccharomyces cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 254

 Score =  160 bits (404), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 87/273 (31%), Positives = 137/273 (50%), Gaps = 50/273 (18%)

Query: 2   AKKYLSRNNWRLNYALNEYYDKEIGSFIGXXXXXXGCKTILPDLNKYPQELIALFKKYSS 61
           A+ YLS NNW L YALN++YD   G F                    P +L+ LF +Y  
Sbjct: 20  ARAYLSNNNWALEYALNDFYDTVQGGFTS---------------RPPPPQLLTLFNEYKK 64

Query: 62  KNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQG 121
              D+    I  DGLI +I DL  +LED  T+C+A  +HC +L   ++K+ F+  W+   
Sbjct: 65  GEEDT----ISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDNL 120

Query: 122 CSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSND 181
           C  L+Q++  + +LD KL +D++YF  IY++T+ L ++ +                    
Sbjct: 121 CENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPN-------------------- 160

Query: 182 TSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKEITKD 241
                     +  LD+ETAIAYW + F  +  Y +++ ++ L  W  FL     + I  D
Sbjct: 161 ----------EKQLDLETAIAYWHLLFPTDGAYAIQIPQKRLCSWTAFLTRNVSR-IHHD 209

Query: 242 QWQMLLEFFKKFSNLEMMKQNYDETAAWPYMID 274
            W+M L+F + F + + +KQ Y+E  AWP +ID
Sbjct: 210 IWKMFLKFARMFPDNKTLKQGYNEDDAWPVLID 242

>Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W
           (REAL)
          Length = 125

 Score =  122 bits (307), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 68/155 (43%), Positives = 90/155 (58%), Gaps = 32/155 (20%)

Query: 128 MQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSNDTSIVIV 187
           MQ  +  LD+KL Q+  YFT IYNYTF L++     DS R                    
Sbjct: 1   MQECMKRLDIKLRQNLQYFTLIYNYTFHLLL-----DSYR-------------------- 35

Query: 188 PRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKEITKDQWQMLL 247
                 ++D+   I YWK+FF    +YPV + + LL  WF+FL++E K  I KD WQMLL
Sbjct: 36  -----KDIDINECIQYWKLFF--RPEYPVSIEQNLLEAWFRFLHDEGKMMINKDTWQMLL 88

Query: 248 EFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQD 282
            FFKK+S +  +  +YDE+AAWP++IDEFYEYLQD
Sbjct: 89  VFFKKYSTVREIMDDYDESAAWPFIIDEFYEYLQD 123

>AGL058C Chr7 complement(599289..602198) [2910 bp, 969 aa] {ON}
           NOHBY706; No homolog in Saccharomyces cerevisiae
          Length = 969

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 39/79 (49%), Gaps = 7/79 (8%)

Query: 67  LYEFIDVDGLINYINDLKYNLEDLVTICLA----KLLHCENLKDGINKQQFLSNWYLQGC 122
           LY  +  D  +  +NDL +NLE LV  C+A    K++    L D   +  FL N     C
Sbjct: 338 LYNVVGYDTELADVNDLAFNLEVLVA-CIASNNKKVMR--RLLDKNKETAFLRNSIRDLC 394

Query: 123 STLEQMQHVLNDLDVKLHQ 141
             + +MQ  + +LD K+ Q
Sbjct: 395 YQINEMQITIEELDFKVSQ 413

>KAFR0I02140 Chr9 complement(439942..440304) [363 bp, 120 aa] {ON} 
          Length = 120

 Score = 32.0 bits (71), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 3/64 (4%)

Query: 45  LNKYPQELIALFKKYSSKNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENL 104
           +N     LIAL    S  +  +LYE  +V+GL   + D+  NL D V++  +  L   +L
Sbjct: 1   MNPKFASLIALGSAISVASATTLYEVAEVEGL---LEDVSNNLSDYVSLITSGKLSFTDL 57

Query: 105 KDGI 108
             G+
Sbjct: 58  PTGV 61

>Ecym_7269 Chr7 complement(566660..569602) [2943 bp, 980 aa] {ON}
           similar to Ashbya gossypii AGL058C
          Length = 980

 Score = 33.1 bits (74), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 7/79 (8%)

Query: 67  LYEFIDVDGLINYINDLKYNLEDLVTICLA----KLLHCENLKDGINKQQFLSNWYLQGC 122
           LY  +  D  +  +NDL +NLE ++  C+A    K++  + L D   +  FL N     C
Sbjct: 358 LYNIVGYDTELADVNDLAFNLE-VLAACIASNNKKVM--KRLMDKNKESAFLRNSIRDLC 414

Query: 123 STLEQMQHVLNDLDVKLHQ 141
             + +MQ  + +LD K+ Q
Sbjct: 415 YQINEMQVTIEELDYKVSQ 433

>KLTH0F07656g Chr6 (663648..664253) [606 bp, 201 aa] {ON} similar to
           uniprot|Q12284 Saccharomyces cerevisiae YPR037C ERV2
           Flavin-linked sulfhydryl oxidase localized to the
           endoplasmic reticulum lumen involved in disulfide bond
           formation within the ER
          Length = 201

 Score = 32.3 bits (72), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 34/84 (40%), Gaps = 7/84 (8%)

Query: 150 YNYTFDLIIDVDDGDSTRNNTNIGDDTTNSNDTSI---VIVPRMKDNNLDVETAIAYWKV 206
           Y+   D ++D+D    T  NT   D    +    +    I+P M D     E   A WK 
Sbjct: 30  YSTPNDPVVDLD----TNTNTEHTDPQGQNKQAKLKFQSIMPSMPDQKAKQELGRASWKY 85

Query: 207 FFNVNEQYPVKVNKELLSLWFQFL 230
           F  V  ++P +  +E      QFL
Sbjct: 86  FHTVLSRFPDEPTQEERDKLAQFL 109

>Suva_5.225 Chr5 complement(342111..346271) [4161 bp, 1386 aa] {ON}
            YER105C (REAL)
          Length = 1386

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 38/81 (46%), Gaps = 11/81 (13%)

Query: 104  LKDGINKQQFLSNWYLQGCSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDG 163
            + DGI+K+     +  +GC         +ND   K ++       +YN  FD++  VD+ 
Sbjct: 962  VADGIDKENQAQGYAAEGCR--------INDPRKKFYEKR---ISVYNLIFDILKTVDEN 1010

Query: 164  DSTRNNTNIGDDTTNSNDTSI 184
             S   ++++G  T +S   S+
Sbjct: 1011 TSVEQSSSVGKITISSPAMSL 1031

>KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar to
           uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1020

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 46/89 (51%), Gaps = 5/89 (5%)

Query: 37  GCKTILPDLNKYPQELIAL-----FKKYSSKNNDSLYEFIDVDGLINYINDLKYNLEDLV 91
             K+I+ +  + P +++ L     F +  S N D L +   V+ LI+  +  K +L DLV
Sbjct: 397 ALKSIVAECERSPAKVVPLVEVFWFGRNGSINFDKLIKSKLVNSLISTSSLEKEHLVDLV 456

Query: 92  TICLAKLLHCENLKDGINKQQFLSNWYLQ 120
            + +++L   ++ KD  N  +F+ + +L 
Sbjct: 457 NLLISQLPQDQSTKDSFNLTRFIFDTFLH 485

>CAGL0K05401g Chr11 complement(531444..532067) [624 bp, 207 aa] {ON}
           similar to uniprot|Q12284 Saccharomyces cerevisiae
           YPR037c ERV2
          Length = 207

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 19/37 (51%)

Query: 185 VIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKE 221
            I+P M+D    VE   A WK F  +  ++P K  KE
Sbjct: 76  TIMPLMEDKQAKVELGRASWKYFHTLLARFPDKPTKE 112

>TPHA0A01610 Chr1 (319885..324954) [5070 bp, 1689 aa] {ON} Anc_8.313
            YDR141C
          Length = 1689

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 220  KELLSLWFQFLNEERKKEITKDQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEY 279
            K++L+L   ++ E +  EI    W +L     KFSN   M    + T A    I EFYE 
Sbjct: 1490 KDMLTLVLNYI-ELKNDEIRSMAWLLLRVMLMKFSNSHFMNHWNNITFALQIQIQEFYEK 1548

Query: 280  LQDTGRI 286
            L+   +I
Sbjct: 1549 LRFQEKI 1555

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,298,132
Number of extensions: 1837948
Number of successful extensions: 9041
Number of sequences better than 10.0: 111
Number of HSP's gapped: 9291
Number of HSP's successfully gapped: 117
Length of query: 286
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 178
Effective length of database: 41,097,471
Effective search space: 7315349838
Effective search space used: 7315349838
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)