Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G025708.325ON42942919700.0
Suva_10.2238.325ON42044314420.0
Smik_12.1938.325ON42243114350.0
Skud_12.1998.325ON42243214290.0
YLR130C (ZRT2)8.325ON42243014230.0
NCAS0C032508.325ON42943113820.0
KNAG0G024608.325ON40342813630.0
Kpol_543.648.325ON42443512821e-175
KAFR0H022508.325ON37941712011e-163
TPHA0A015508.325ON41144211891e-161
KAFR0B057308.325ON37243211741e-159
SAKL0H15510g8.325ON39943411601e-157
SAKL0H14388gna 1ON38042211511e-156
NDAI0J010108.325ON38441810991e-148
CAGL0E01353g8.325ON43344510941e-146
KNAG0A051808.325ON39543010741e-144
TBLA0H012708.325ON40142310711e-144
CAGL0M04301g8.325ON38943310591e-142
KLLA0D16434g8.325ON41441410561e-141
TPHA0D00970na 2ON38341910481e-140
TBLA0F02390singletonON4274409511e-125
Kpol_1006.10na 2ON3914239191e-121
SAKL0F16346gsingletonON3794218281e-107
NCAS0B035808.325ON3471987481e-95
AGL143Cna 1ON3742165849e-71
Ecym_4202na 1ON3752275779e-70
KLTH0F09064gna 1ON3611955708e-69
TDEL0D06550singletonON3813844907e-57
ZYRO0F02200gsingletonON3813854584e-52
ZYRO0D17732gsingletonON3993854332e-48
YGL255W (ZRT1)na 3ON3761823543e-37
Smik_7.6na 3ON3721573534e-37
Suva_7.6na 3ON3721733519e-37
Skud_7.12na 3ON3721973465e-36
KLTH0C00374gsingletonON3761883184e-32
KLTH0A07722gna 4ON3922013161e-31
Kwal_14.824singletonON3741623027e-30
Kwal_23.6522na 4ON3891322975e-29
KLLA0B02607g4.285ON68799704.5
NDAI0G039803.50ON57090704.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G02570
         (429 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G02570 Chr7 (588135..589424) [1290 bp, 429 aa] {ON} Anc_8.325    763   0.0  
Suva_10.223 Chr10 complement(411354..412616) [1263 bp, 420 aa] {...   560   0.0  
Smik_12.193 Chr12 complement(384118..385386) [1269 bp, 422 aa] {...   557   0.0  
Skud_12.199 Chr12 complement(385437..386705) [1269 bp, 422 aa] {...   555   0.0  
YLR130C Chr12 complement(402794..404062) [1269 bp, 422 aa] {ON} ...   552   0.0  
NCAS0C03250 Chr3 (638559..639848) [1290 bp, 429 aa] {ON} Anc_8.325    536   0.0  
KNAG0G02460 Chr7 complement(560626..561837) [1212 bp, 403 aa] {O...   529   0.0  
Kpol_543.64 s543 complement(147560..148834) [1275 bp, 424 aa] {O...   498   e-175
KAFR0H02250 Chr8 (429002..430141) [1140 bp, 379 aa] {ON} Anc_8.3...   467   e-163
TPHA0A01550 Chr1 (310086..311321) [1236 bp, 411 aa] {ON} Anc_8.3...   462   e-161
KAFR0B05730 Chr2 complement(1182121..1183239) [1119 bp, 372 aa] ...   456   e-159
SAKL0H15510g Chr8 (1350297..1351496) [1200 bp, 399 aa] {ON} simi...   451   e-157
SAKL0H14388g Chr8 (1247106..1248248) [1143 bp, 380 aa] {ON} simi...   447   e-156
NDAI0J01010 Chr10 (230625..231779) [1155 bp, 384 aa] {ON} Anc_8....   427   e-148
CAGL0E01353g Chr5 (127845..129146) [1302 bp, 433 aa] {ON} simila...   426   e-146
KNAG0A05180 Chr1 (764235..765422) [1188 bp, 395 aa] {ON} Anc_8.3...   418   e-144
TBLA0H01270 Chr8 (286413..287618) [1206 bp, 401 aa] {ON} Anc_8.3...   417   e-144
CAGL0M04301g Chr13 complement(472227..473396) [1170 bp, 389 aa] ...   412   e-142
KLLA0D16434g Chr4 complement(1384826..1386070) [1245 bp, 414 aa]...   411   e-141
TPHA0D00970 Chr4 complement(195530..196681) [1152 bp, 383 aa] {O...   408   e-140
TBLA0F02390 Chr6 (588534..589817) [1284 bp, 427 aa] {ON}              370   e-125
Kpol_1006.10 s1006 complement(43032..44207) [1176 bp, 391 aa] {O...   358   e-121
SAKL0F16346g Chr6 complement(1331198..1332337) [1140 bp, 379 aa]...   323   e-107
NCAS0B03580 Chr2 complement(635005..636048) [1044 bp, 347 aa] {O...   292   1e-95
AGL143C Chr7 complement(431959..433083) [1125 bp, 374 aa] {ON} N...   229   9e-71
Ecym_4202 Chr4 (419650..420777) [1128 bp, 375 aa] {ON} similar t...   226   9e-70
KLTH0F09064g Chr6 (779431..780516) [1086 bp, 361 aa] {ON} simila...   224   8e-69
TDEL0D06550 Chr4 (1177932..1179077) [1146 bp, 381 aa] {ON}            193   7e-57
ZYRO0F02200g Chr6 (178997..180142) [1146 bp, 381 aa] {ON} simila...   181   4e-52
ZYRO0D17732g Chr4 complement(1471224..1472423) [1200 bp, 399 aa]...   171   2e-48
YGL255W Chr7 (20978..22108) [1131 bp, 376 aa] {ON}  ZRT1High-aff...   140   3e-37
Smik_7.6 Chr7 (15678..16796) [1119 bp, 372 aa] {ON} YGL255W (REAL)    140   4e-37
Suva_7.6 Chr7 (15340..16458) [1119 bp, 372 aa] {ON} YGL255W (REAL)    139   9e-37
Skud_7.12 Chr7 (25081..26199) [1119 bp, 372 aa] {ON} YGL255W (REAL)   137   5e-36
KLTH0C00374g Chr3 complement(32017..33147) [1131 bp, 376 aa] {ON...   127   4e-32
KLTH0A07722g Chr1 (650427..651605) [1179 bp, 392 aa] {ON} simila...   126   1e-31
Kwal_14.824 s14 complement(65415..66539) [1125 bp, 374 aa] {ON} ...   120   7e-30
Kwal_23.6522 s23 (1624044..1625213) [1170 bp, 389 aa] {ON} YGL25...   119   5e-29
KLLA0B02607g Chr2 complement(228049..230112) [2064 bp, 687 aa] {...    32   4.5  
NDAI0G03980 Chr7 complement(947806..949518) [1713 bp, 570 aa] {O...    32   4.6  

>NDAI0G02570 Chr7 (588135..589424) [1290 bp, 429 aa] {ON} Anc_8.325
          Length = 429

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/429 (89%), Positives = 386/429 (89%)

Query: 1   MLELLARDDAVVCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCF 60
           MLELLARDDAVVCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCF
Sbjct: 1   MLELLARDDAVVCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCF 60

Query: 61  FLAKFFGSGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVT 120
           FLAKFFGSGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVT
Sbjct: 61  FLAKFFGSGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVT 120

Query: 121 HYFVAKSFGDEHHDHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQFQKS 180
           HYFVAKSFGDEHHDHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQFQKS
Sbjct: 121 HYFVAKSFGDEHHDHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQFQKS 180

Query: 181 NCKLAQSAQNPXXXXXXXXXXXXXXXXXXXXXALQDRQNISGNNKNNDNMTRFNSIPGKD 240
           NCKLAQSAQNP                     ALQDRQNISGNNKNNDNMTRFNSIPGKD
Sbjct: 181 NCKLAQSAQNPDDDDDDEEEEDDKLKEEKEREALQDRQNISGNNKNNDNMTRFNSIPGKD 240

Query: 241 HFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXXXXXXXXEEFET 300
           HFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFH            EEFET
Sbjct: 241 HFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHSVFVGLSLSVSGEEFET 300

Query: 301 LFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSWIP 360
           LFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSWIP
Sbjct: 301 LFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSWIP 360

Query: 361 GSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCXXXX 420
           GSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMC    
Sbjct: 361 GSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCLGAG 420

Query: 421 XXXXXXKWA 429
                 KWA
Sbjct: 421 LMALLGKWA 429

>Suva_10.223 Chr10 complement(411354..412616) [1263 bp, 420 aa] {ON}
           YLR130C (REAL)
          Length = 420

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/443 (63%), Positives = 323/443 (72%), Gaps = 37/443 (8%)

Query: 1   MLELLARDDAV-VCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWC 59
           M++LL RDD+   C+ SNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLP  C
Sbjct: 1   MIDLLIRDDSTDSCQASNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPDCC 60

Query: 60  FFLAKFFGSGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIV 119
           FF+AKFFGSGVIV+TAFIHLL PAAEALGNECLGGTF EYPWAFGICL+SLFLLFF EI+
Sbjct: 61  FFIAKFFGSGVIVATAFIHLLQPAAEALGNECLGGTFAEYPWAFGICLISLFLLFFTEII 120

Query: 120 THYFVAKSFGDEHHDHGN-------------NINSVHDDDADSSDESITSYTEDHPVILP 166
           THYFVAK+ G +H DHG               I ++H D A  +DE++ S          
Sbjct: 121 THYFVAKTLGHDHGDHGEVAAIDSRVPSSEYTIGNLHSDTASFNDEAVYSI--------- 171

Query: 167 RRSHNDIENQFQKSNCKLAQSAQNPXXXXXXXXXXXXXXXXXXXXXALQDRQNISGNNKN 226
              HN+ +N +   N +L  ++                          +     +G   +
Sbjct: 172 ---HNN-KNSYTAKNEELVATSVKEKESDMLKYDLEVG----------KTESIANGIVPS 217

Query: 227 NDNMTRFNSIPGKDHFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXX 286
           + +M+ F S+PGKDH+SH+ DHQD +QLGT IEEEDKEQY+NQM AVFILEFGIIFH   
Sbjct: 218 SSHMSNFASVPGKDHYSHENDHQDASQLGTQIEEEDKEQYINQMLAVFILEFGIIFHSVF 277

Query: 287 XXXXXXXXXEEFETLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPI 346
                    EEFETLFIVLTFHQMFEGLGLGTRVAETNWP ++RYTPWLMGLAFT+TSPI
Sbjct: 278 VGLSLSVAGEEFETLFIVLTFHQMFEGLGLGTRVAETNWPDSKRYTPWLMGLAFTLTSPI 337

Query: 347 AVAIGIGVRHSWIPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFK 406
           AVA+GIGVRHSWIPGSR+ALIANG+FDSISSGILIYTGLVELMAHEFLYSNQFKGPDG +
Sbjct: 338 AVAVGIGVRHSWIPGSRRALIANGIFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLR 397

Query: 407 KMLAAYFIMCXXXXXXXXXXKWA 429
           KML+AYFIMC          KWA
Sbjct: 398 KMLSAYFIMCCGAALMALLGKWA 420

>Smik_12.193 Chr12 complement(384118..385386) [1269 bp, 422 aa] {ON}
           YLR130C (REAL)
          Length = 422

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/431 (65%), Positives = 323/431 (74%), Gaps = 11/431 (2%)

Query: 1   MLELLARDDAV-VCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWC 59
           M++L+ RDD+   C+ SNDYNGH+GLRILAVFIILISSGLGVYFPILSSRYSFIRLP+WC
Sbjct: 1   MIDLIVRDDSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWC 60

Query: 60  FFLAKFFGSGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIV 119
           FF+AKFFGSGVIV+TAF+HLL PAAEALG+ECLGGTF EYPWAFGICLMSLFLLFF EI+
Sbjct: 61  FFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEII 120

Query: 120 THYFVAKSFGDEHHDHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQFQK 179
           THY+VAK+ G +H DHG N +   D D  SSD ++++  +  P      S N+ E  +  
Sbjct: 121 THYYVAKTLGHDHGDHGENTSI--DVDVPSSDLAVSN-IDSQPA-----SFNN-EAVYFI 171

Query: 180 SNCKLAQSAQNPXXXXXXXXXXXXXXXXXXXXXALQDRQNISGNN-KNNDNMTRFNSIPG 238
            N K   + +N                         + ++I+      + + T   S+PG
Sbjct: 172 HNNKTPYTTRNEEIGATPIKEKEPSSNITNYDLEAGNTESIANELFPMSSHATNIPSVPG 231

Query: 239 KDHFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXXXXXXXXEEF 298
           KDHFSH+ DHQD +QLGT IEEEDKEQYLNQM AVFILEFGIIFH            EEF
Sbjct: 232 KDHFSHENDHQDASQLGTRIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEF 291

Query: 299 ETLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSW 358
           ETLFIVLTFHQMFEGLGLGTRVAETNWP ++RYTPWLMGLAFT+TSPIAVA+GIGVRHSW
Sbjct: 292 ETLFIVLTFHQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAVGIGVRHSW 351

Query: 359 IPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCXX 418
           IPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGP G KKML+AYFIMC  
Sbjct: 352 IPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLSAYFIMCCG 411

Query: 419 XXXXXXXXKWA 429
                   KWA
Sbjct: 412 AALMALLGKWA 422

>Skud_12.199 Chr12 complement(385437..386705) [1269 bp, 422 aa] {ON}
           YLR130C (REAL)
          Length = 422

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/432 (65%), Positives = 320/432 (74%), Gaps = 13/432 (3%)

Query: 1   MLELLARDDAV-VCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWC 59
           M++L+ RDD+   C+ SNDYNGH+GLRILAVFIILISSGLGVYFPILSSRYSFIRLP+WC
Sbjct: 1   MIDLVVRDDSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWC 60

Query: 60  FFLAKFFGSGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIV 119
           FF+AKFFGSGVIV+TAF+HLL PAAEALG+ECLGGTF EYPWAFGICLMSLFLLFF EI+
Sbjct: 61  FFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEII 120

Query: 120 THYFVAKSFGDEHHDHGNNINSVHDDDAD-SSDESITSYTEDHPVILPRRSHNDIENQFQ 178
           THYFVAK+ G   HDHG+N   V   DAD +S ES       +P  L   +   I N   
Sbjct: 121 THYFVAKTLG---HDHGDN-EGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNN-- 174

Query: 179 KSNCKLAQSAQNPXXXXXXXXXXXXXXXXXXXXXALQDRQNIS-GNNKNNDNMTRFNSIP 237
               K+  + +N                         + ++I+ G    N + T   S+P
Sbjct: 175 ----KIPYTTRNEEIVGTPVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVP 230

Query: 238 GKDHFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXXXXXXXXEE 297
           GKDH+SH+  HQD ++LG  IEEEDKEQYLNQM AVFILEFGIIFH            EE
Sbjct: 231 GKDHYSHENYHQDASELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEE 290

Query: 298 FETLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHS 357
           FETLFIVLTFHQMFEGLGLGTRVAETNWP ++RYTPWLMGLAFT+TSPIAVAIGIGVRHS
Sbjct: 291 FETLFIVLTFHQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHS 350

Query: 358 WIPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCX 417
           W+PGSR+ALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDG KKML+AYFIMC 
Sbjct: 351 WVPGSRRALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCC 410

Query: 418 XXXXXXXXXKWA 429
                    KWA
Sbjct: 411 GAALMALLGKWA 422

>YLR130C Chr12 complement(402794..404062) [1269 bp, 422 aa] {ON}
           ZRT2Low-affinity zinc transporter of the plasma
           membrane; transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 422

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/430 (65%), Positives = 317/430 (73%), Gaps = 9/430 (2%)

Query: 1   MLELLARDDAV-VCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWC 59
           M++L+ARDD+V  C+ SN YNGH+GLRILAVFIILISSGLGVYFPILSSRYSFIRLP+WC
Sbjct: 1   MVDLIARDDSVDTCQASNGYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWC 60

Query: 60  FFLAKFFGSGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIV 119
           FF+AKFFGSGVIV+TAF+HLL PAAEALG+ECLGGTF EYPWAFGICLMSLFLLFF EI+
Sbjct: 61  FFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEII 120

Query: 120 THYFVAKSFGDEHHDHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQFQK 179
           THYFVAK+ G +H DHG  + S+ D DA SS   I +   D PV     +   I N    
Sbjct: 121 THYFVAKTLGHDHGDHG-EVTSI-DVDAPSSGFVIRNMDSD-PVSFNNEAAYSIHNDKTP 177

Query: 180 SNCKLAQSAQNPXXXXXXXXXXXXXXXXXXXXXALQDRQNISGNNKNNDNMTRFNSIPGK 239
              +  +    P                     +L +    + ++  N       S+PGK
Sbjct: 178 YTTRNEEIVATPIKEKEPGSNVTNYDLEPGKTESLANELVPTSSHATN-----LASVPGK 232

Query: 240 DHFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXXXXXXXXEEFE 299
           DH+SH+ DHQD +QL T IEEEDKEQYLNQ+ AVFILEFGIIFH            EEFE
Sbjct: 233 DHYSHENDHQDVSQLATRIEEEDKEQYLNQILAVFILEFGIIFHSVFVGLSLSVAGEEFE 292

Query: 300 TLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSWI 359
           TLFIVLTFHQMFEGLGLGTRVAETNWP +++Y PWLMGLAFT+TSPIAVA+GIGVRHSWI
Sbjct: 293 TLFIVLTFHQMFEGLGLGTRVAETNWPESKKYMPWLMGLAFTLTSPIAVAVGIGVRHSWI 352

Query: 360 PGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCXXX 419
           PGSR+ALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDG KKML+AY IMC   
Sbjct: 353 PGSRRALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYLIMCCGA 412

Query: 420 XXXXXXXKWA 429
                  KWA
Sbjct: 413 ALMALLGKWA 422

>NCAS0C03250 Chr3 (638559..639848) [1290 bp, 429 aa] {ON} Anc_8.325
          Length = 429

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/431 (64%), Positives = 312/431 (72%), Gaps = 4/431 (0%)

Query: 1   MLELLARDDAVVCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCF 60
           M++++   D   CE+SN YNGH+GLRILA+FIILISSGLGV+FPI++SRYSFI LP WCF
Sbjct: 1   MIDIILARDVDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCF 60

Query: 61  FLAKFFGSGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVT 120
           FLAKFFGSGVIV+TAFIHLLDPAAEALGN CLGGTF EYPWAFGICLMSLF+LF +EIVT
Sbjct: 61  FLAKFFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVT 120

Query: 121 HYFVAKSFGDEHHDHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQFQKS 180
           HY+VAKSFGD  HD G++ +  H+DD  S +    +  E    I+    HN+  N     
Sbjct: 121 HYYVAKSFGDHDHDGGHSNH--HEDDITSFEADGFTDLERQNGIVRSTDHNNNSNNNNVL 178

Query: 181 NCKLAQSAQNPXXXXXXXXXXXXXXXXXXXXXALQDR-QNISGNNKNNDNMTRF-NSIPG 238
             K  Q  +                       A   R  N       N N++RF +S+PG
Sbjct: 179 PMKKNQVDEKSIDEDDDGDDEDKEQDPASNDLASSSRINNNDNLVNTNTNISRFVSSVPG 238

Query: 239 KDHFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXXXXXXXXEEF 298
           KDHF HD  HQD +Q+GTP+EEE+KEQYLNQM AVFILEFGIIFH            EEF
Sbjct: 239 KDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHSVFVGLSLSVSGEEF 298

Query: 299 ETLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSW 358
           ETLFIVL FHQMFEGLGLGTRVAETNWP ++RYTPWLMGLAFTITSPIAVAIGIGVR SW
Sbjct: 299 ETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKSW 358

Query: 359 IPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCXX 418
           IPGSR ALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGP G KKML AYFIMC  
Sbjct: 359 IPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCMG 418

Query: 419 XXXXXXXXKWA 429
                   KWA
Sbjct: 419 AGLMALLGKWA 429

>KNAG0G02460 Chr7 complement(560626..561837) [1212 bp, 403 aa] {ON}
           Anc_8.325 YLR130C
          Length = 403

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/428 (62%), Positives = 314/428 (73%), Gaps = 35/428 (8%)

Query: 4   LLARDD--AVVCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFF 61
           LL RDD   V C +SN YNGH+GLRILAVFIILISSG+GV+FPI++SRYSFIRLP WCFF
Sbjct: 9   LLPRDDDDVVACAVSNSYNGHNGLRILAVFIILISSGVGVFFPIMASRYSFIRLPDWCFF 68

Query: 62  LAKFFGSGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVTH 121
           +AKFFGSGVIV+TAFIHLL PA+EALG+ CLGGTF EYPWAFGICLMSLF+LFF EIV+H
Sbjct: 69  IAKFFGSGVIVATAFIHLLQPASEALGDPCLGGTFAEYPWAFGICLMSLFMLFFTEIVSH 128

Query: 122 YFVAKSFGDEHHDHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQFQKSN 181
           +F++KS GD H  HG   +SV+ DD    D+S  S ++   ++  ++    I+++F++  
Sbjct: 129 HFISKSLGDSHESHGGA-DSVYGDD----DDSEFSVSKQREIVDSQKGELFIKDKFEQ-E 182

Query: 182 CKLAQSAQNPXXXXXXXXXXXXXXXXXXXXXALQDRQNISGNNKNNDNMTRFNSIPGKDH 241
             L+Q                          + +D  N++             +IPGKDH
Sbjct: 183 VDLSQGITT--------------------VPSTRDYANLTSTELEP-------TIPGKDH 215

Query: 242 FSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXXXXXXXXEEFETL 301
           F+HDT+HQD +QLGTP++E+DKEQYLNQ+ AV ILE GIIFH            EEFETL
Sbjct: 216 FAHDTEHQDPSQLGTPVQEQDKEQYLNQIVAVTILEAGIIFHSVFVGLSLSVSGEEFETL 275

Query: 302 FIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSWIPG 361
           FIVLTFHQMFEGLGLGTRVAETNWP NR+ TPWLMGLAF +TSPIAVAIGIGVRHSW+PG
Sbjct: 276 FIVLTFHQMFEGLGLGTRVAETNWPENRKNTPWLMGLAFMLTSPIAVAIGIGVRHSWVPG 335

Query: 362 SRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCXXXXX 421
           SRK+LIANGVFD+ISSGILIYTGLVELMAHEFL+SNQFKGP G KKML AYFIMC     
Sbjct: 336 SRKSLIANGVFDAISSGILIYTGLVELMAHEFLFSNQFKGPGGLKKMLYAYFIMCLGAGL 395

Query: 422 XXXXXKWA 429
                KWA
Sbjct: 396 MALLGKWA 403

>Kpol_543.64 s543 complement(147560..148834) [1275 bp, 424 aa] {ON}
           complement(147560..148834) [1275 nt, 425 aa]
          Length = 424

 Score =  498 bits (1282), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 252/435 (57%), Positives = 308/435 (70%), Gaps = 19/435 (4%)

Query: 1   MLELLARD-DAVV--CEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPS 57
           +L LL RD + VV  CE +ND++G   LR+L++F+I+ISSGLGV+FP+L+SRYSFIRLP 
Sbjct: 3   VLRLLVRDTEGVVDTCEATNDFDGRINLRVLSIFMIMISSGLGVFFPLLASRYSFIRLPE 62

Query: 58  WCFFLAKFFGSGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVE 117
           WCFF+AKFFGSGVIVSTAFIHLL PAAEALGN+CLGGTFVEYPWAFGICLMSLFLLFF E
Sbjct: 63  WCFFIAKFFGSGVIVSTAFIHLLVPAAEALGNDCLGGTFVEYPWAFGICLMSLFLLFFTE 122

Query: 118 IVTHYFVAKSFGDEHHDHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDI--EN 175
           I+THYF++KS  ++H D G++ +   + + D    S  S  ED         + DI  E 
Sbjct: 123 IITHYFMSKSLDNDHGDSGHSHSHFGNQNKDIEINSHFSSDED------EVDNKDISEER 176

Query: 176 QFQ-KSNCKLAQSAQNPXXXXXXXXXXXXXXXXXXXXXALQDRQNISGNNKNNDNMTRFN 234
            +Q K + +L     N                      ++  ++        N  + +  
Sbjct: 177 TYQMKYDFELDTKKVNEQTSPLYSVSSYAQVGTSSSKNSILPKET-------NIKLKQLE 229

Query: 235 SIPGKDHFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXXXXXXX 294
           SIPGK+H+SHD +HQD +QLGTP+EE DKEQYL Q+  V ILE G+IFH           
Sbjct: 230 SIPGKNHYSHDKNHQDPSQLGTPVEEIDKEQYLGQIVGVTILEIGVIFHSIFVGLSLAVS 289

Query: 295 XEEFETLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGV 354
            EEF TLFIVL FHQMFEGLGLGTR+AE NWP ++RYTPWLM L FT+T+PIA+AIGIGV
Sbjct: 290 GEEFITLFIVLVFHQMFEGLGLGTRLAEANWPHSKRYTPWLMALGFTLTTPIAIAIGIGV 349

Query: 355 RHSWIPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFI 414
           R+SWIPGSRK+LIANGVFD+ISSGILIYTGLVELMAHEFL+SNQFKGP GFK+ML+AYF+
Sbjct: 350 RYSWIPGSRKSLIANGVFDAISSGILIYTGLVELMAHEFLFSNQFKGPGGFKRMLSAYFV 409

Query: 415 MCXXXXXXXXXXKWA 429
           MC          +WA
Sbjct: 410 MCCGAALMAVLGRWA 424

>KAFR0H02250 Chr8 (429002..430141) [1140 bp, 379 aa] {ON} Anc_8.325
           YLR130C
          Length = 379

 Score =  467 bits (1201), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 239/417 (57%), Positives = 285/417 (68%), Gaps = 52/417 (12%)

Query: 13  CEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVIV 72
           C  SNDY+G++ LRIL+VFI+LIS+ +GV+FPIL+SRYSFI LP WCFF+AKFFGSGVIV
Sbjct: 15  CSTSNDYDGNNNLRILSVFILLISASIGVFFPILASRYSFINLPGWCFFIAKFFGSGVIV 74

Query: 73  STAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKSFGDEH 132
           +TAFIHLL+PA+E LG++CLGGTF EYPWAFGICLMSLF LF VEI++HYFV K+FG   
Sbjct: 75  ATAFIHLLEPASEELGDDCLGGTFAEYPWAFGICLMSLFFLFLVEIISHYFVNKNFG--- 131

Query: 133 HDHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQFQKSNCKLAQSAQNPX 192
           HDHG      HD+          +     P        + ++  F+K +    +S  +P 
Sbjct: 132 HDHG------HDETG--------TIVHHIPREEDEEEEDSLDEDFKKGDI---ESQTSP- 173

Query: 193 XXXXXXXXXXXXXXXXXXXXALQDRQNISGNNKNNDNMTRFNSIPGKDHFSHDTDHQDQT 252
                                          +     + R  SI GKDHFSHD+ HQD +
Sbjct: 174 -------------------------------DIRTHKLDRLASILGKDHFSHDSTHQDPS 202

Query: 253 QLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXXXXXXXXEEFETLFIVLTFHQMFE 312
           QLGT  EE  KEQYLNQ+ A+FILE GIIFH             EF+TLFIVLTFHQMFE
Sbjct: 203 QLGTSTEEFQKEQYLNQIVALFILESGIIFHSIFIGLSLAVTGAEFKTLFIVLTFHQMFE 262

Query: 313 GLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSWIPGSRKALIANGVF 372
           GLGLGTR++E NWP +++Y PWLMGLAF +T+ IAVAIGIGVRHSW+PGSR ALIA+G+F
Sbjct: 263 GLGLGTRISEANWPQSKKYIPWLMGLAFALTTAIAVAIGIGVRHSWVPGSRNALIASGIF 322

Query: 373 DSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCXXXXXXXXXXKWA 429
           DSIS+GILIYTGLVELMAHEFLYSNQFKGPDGFK+ML AYFIMC          KWA
Sbjct: 323 DSISAGILIYTGLVELMAHEFLYSNQFKGPDGFKRMLFAYFIMCCGAALMALLGKWA 379

>TPHA0A01550 Chr1 (310086..311321) [1236 bp, 411 aa] {ON} Anc_8.325
           YLR130C
          Length = 411

 Score =  462 bits (1189), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 237/442 (53%), Positives = 295/442 (66%), Gaps = 50/442 (11%)

Query: 2   LELLARD--DAVVCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWC 59
           +EL+ RD      C+  + YNG + +R+LA+FIILISSGLG +FPIL+S YSFIRLP  C
Sbjct: 6   IELVLRDGDSTDTCDTQSSYNGSTNMRVLALFIILISSGLGSFFPILASTYSFIRLPDCC 65

Query: 60  FFLAKFFGSGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIV 119
           FF+AKFFGSGVIV+TAFIHLLDPA EAL N CLGGTF EYPWAFGICLMSLFLLF +EI+
Sbjct: 66  FFVAKFFGSGVIVATAFIHLLDPAVEALSNTCLGGTFTEYPWAFGICLMSLFLLFLIEIM 125

Query: 120 THYFVA-KSFGDEHHDHGNNIN----SVHDDDADSSDESIT------SYTEDHPVILPRR 168
           TH+ +     GD  H HG++ +    S+ D +ADS D  +       SY  +  +   + 
Sbjct: 126 THHMLTHDEHGDGGHSHGDDTSYTASSIDDKEADSIDADVRKDANDDSYDINSILNFDKN 185

Query: 169 SHNDIE-NQFQKSNCKLAQSAQNPXXXXXXXXXXXXXXXXXXXXXALQDRQNISGNNKNN 227
              DIE N ++ S                                 ++DR N      +N
Sbjct: 186 KDYDIEANHYEVS---------------------------------MEDRNN---TKMDN 209

Query: 228 DNMTRFNSIPGKDHFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXX 287
             +++  S PG+DHFSHD++HQD  QLGTP+E+ DKE+Y+ Q+ +V ILEFG+IFH    
Sbjct: 210 YKISQTKSTPGQDHFSHDSEHQDLVQLGTPVEQLDKEKYMGQIVSVIILEFGVIFHSIFT 269

Query: 288 XXXXXXXXEEFETLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIA 347
                   +EFETLFIVL FHQMFEGLGLGTR+AETNWP +++ TPWL+ L FTI++PIA
Sbjct: 270 GLSLAVSGDEFETLFIVLVFHQMFEGLGLGTRIAETNWPKSKKNTPWLLALGFTISTPIA 329

Query: 348 VAIGIGVRHSWIPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKK 407
           + IGIGVR+++IPGSR ALI NG+FDSISSGILIYTGLVELMAHEFL+S QF G DGFKK
Sbjct: 330 IGIGIGVRYTFIPGSRTALITNGIFDSISSGILIYTGLVELMAHEFLFSKQFSGRDGFKK 389

Query: 408 MLAAYFIMCXXXXXXXXXXKWA 429
           M+ AY IMC          KWA
Sbjct: 390 MIFAYVIMCCGAALMALLGKWA 411

>KAFR0B05730 Chr2 complement(1182121..1183239) [1119 bp, 372 aa]
           {ON} Anc_8.325 YLR130C
          Length = 372

 Score =  456 bits (1174), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 233/432 (53%), Positives = 287/432 (66%), Gaps = 63/432 (14%)

Query: 1   MLELLARDDAVVCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCF 60
           M EL+ RD    C+ SNDYNG   LRILAVF+ILISS LG +FP+LSS+YSFI+LP+WCF
Sbjct: 1   MSELIPRD---TCQTSNDYNGSDNLRILAVFMILISSALGAFFPLLSSKYSFIKLPNWCF 57

Query: 61  FLAKFFGSGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVT 120
           F+AKFFGSGVIV+TAFIHLL+PA++AL N+CLGGTF +YPWAFGICLMSLF LFF EI +
Sbjct: 58  FIAKFFGSGVIVATAFIHLLEPASDALTNDCLGGTFADYPWAFGICLMSLFFLFFSEICS 117

Query: 121 HYFVAKSFGDEHHDH---GNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQF 177
           HYF+ +++G+E H H   GN+ + + D D+D + E+  S            +H DIE+  
Sbjct: 118 HYFILRAYGNEDHSHFPSGNDDSKLSDVDSDKNTETRIS------------NHRDIESG- 164

Query: 178 QKSNCKLAQSAQNPXXXXXXXXXXXXXXXXXXXXXALQDRQNISGNNKNNDNMTRFNSIP 237
                                               ++D    SGN+           IP
Sbjct: 165 ----------------------------------SFIRDAGPTSGNS----------FIP 180

Query: 238 GKDHFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXXXXXXXXEE 297
           G+DH+SHD  HQD +QLGTP E  DKE Y NQ+FAV ILEFGI+FH            EE
Sbjct: 181 GRDHYSHDAVHQDPSQLGTPAESSDKENYANQIFAVSILEFGIVFHSVFIGLSLAVAGEE 240

Query: 298 FETLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHS 357
           F+TLF+VL FHQMFEGLGLGTR+AETNWP +++ TPW+M L ++IT+PI+ AIGIGVRHS
Sbjct: 241 FKTLFVVLIFHQMFEGLGLGTRLAETNWPKSKKLTPWIMALGYSITTPISTAIGIGVRHS 300

Query: 358 WIPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCX 417
           ++P SRKALI NGVFD+ S+GILIYTGLVELMAHEFLYS+ FK  DG K+ML AY  M  
Sbjct: 301 FLPESRKALIVNGVFDAFSAGILIYTGLVELMAHEFLYSSTFKQKDGLKRMLLAYLCMAT 360

Query: 418 XXXXXXXXXKWA 429
                    KWA
Sbjct: 361 GAGIMALLGKWA 372

>SAKL0H15510g Chr8 (1350297..1351496) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q12436 Saccharomyces cerevisiae YLR130C ZRT2
           Low-affinity zinc transporter of the plasma membrane
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 399

 Score =  451 bits (1160), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 233/434 (53%), Positives = 293/434 (67%), Gaps = 41/434 (9%)

Query: 2   LELLARDDAV-VCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCF 60
           ++  ARDD V VC+  N+Y+G   LRILAVF+ILISSGLG +FPILSSRYS IRLP+WCF
Sbjct: 1   MQFSARDDEVDVCDNDNEYDGRDSLRILAVFMILISSGLGAFFPILSSRYSVIRLPAWCF 60

Query: 61  FLAKFFGSGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVT 120
           F+AKFFGSGVIV+T FIHLL PA + LGN CLGGTF +YPWAFGICLMSLF LFF EI+T
Sbjct: 61  FIAKFFGSGVIVATGFIHLLKPATDNLGNTCLGGTFADYPWAFGICLMSLFALFFSEIIT 120

Query: 121 HYFVAKSFGDE-----HHDHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIEN 175
           H+F  K+ G+      H   G   ++ H    D S++       D   +     +  ++ 
Sbjct: 121 HHFFIKANGNSDHTNSHSHFGEPNHTTHQQFPDESEKKDDEEEAD---VECAAEYIPLKV 177

Query: 176 QFQKSNCKLAQSAQNPXXXXXXXXXXXXXXXXXXXXXALQDRQNISGNNKNNDNMTRFNS 235
            + K + +L  SA                             Q +S  +    ++    S
Sbjct: 178 GYFKDDEELRCSAS----------------------------QGVSRKSDRKPSV----S 205

Query: 236 IPGKDHFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXXXXXXXX 295
           +PGKDHFSH+ DHQD +QLGT + ++++EQYL+Q+FAVFILEFG++FH            
Sbjct: 206 VPGKDHFSHEQDHQDLSQLGTLVRQKEREQYLSQVFAVFILEFGVVFHSVFVGLSLAVAG 265

Query: 296 EEFETLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVR 355
           +EF TLFIVL FHQMFEGLGLGTR+AET WP+++RYTPWL+GL +T+++PIA+AIGIGVR
Sbjct: 266 DEFNTLFIVLVFHQMFEGLGLGTRIAETTWPASKRYTPWLLGLGYTLSTPIAIAIGIGVR 325

Query: 356 HSWIPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIM 415
           HS+ PGS+KALI NGVFDSIS+GILIYTGLVELMAHEFLYS QFKG  G K+M+ AYFIM
Sbjct: 326 HSFAPGSKKALITNGVFDSISAGILIYTGLVELMAHEFLYSQQFKGEGGCKRMIGAYFIM 385

Query: 416 CXXXXXXXXXXKWA 429
           C          +WA
Sbjct: 386 CLGAGLMALLGRWA 399

>SAKL0H14388g Chr8 (1247106..1248248) [1143 bp, 380 aa] {ON} similar
           to uniprot|Q12436 Saccharomyces cerevisiae YLR130C ZRT2
           Low-affinity zinc transporter of the plasma membrane
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 380

 Score =  447 bits (1151), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 228/422 (54%), Positives = 279/422 (66%), Gaps = 68/422 (16%)

Query: 8   DDAVVCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFG 67
           ++ V C I NDY+G   LRILAVF+ILISS LG +FPILSSRYSFIRLP WCFF+AK+FG
Sbjct: 27  EEPVACPIDNDYDGRDNLRILAVFMILISSALGTFFPILSSRYSFIRLPDWCFFIAKYFG 86

Query: 68  SGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKS 127
           SGVIV+T FIHLL+PA++ALG ECLGGTF +YPWAFGICLMSLF LFFVEI+THYF AK+
Sbjct: 87  SGVIVATGFIHLLEPASDALGEECLGGTFADYPWAFGICLMSLFALFFVEIITHYFAAKA 146

Query: 128 FGDEHHDHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQFQKSNCKLAQS 187
            G+              D ++ SDE               +S  D     ++++ +LA S
Sbjct: 147 AGN--------------DSSNYSDE---------------KSVKD-----EEADSQLAYS 172

Query: 188 AQNPXXXXXXXXXXXXXXXXXXXXXALQDRQNISGNNKNNDNMTRFNSIPGKDHFSHDTD 247
           A                          Q ++N+             NS+PG DH+ HD  
Sbjct: 173 A---------------------VIKVDQQQENV-------------NSVPGADHYGHDEV 198

Query: 248 HQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXXXXXXXXEEFETLFIVLTF 307
           HQD  Q    + ++DKE+YLNQ+ AVFILEFG++FH            +EF TLFIVL F
Sbjct: 199 HQDPAQAQNLVSQKDKEKYLNQIVAVFILEFGVVFHSVFVGLSLAVAGDEFNTLFIVLVF 258

Query: 308 HQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSWIPGSRKALI 367
           HQMFEGLGLGTR+AET WP + R+TPWL+ L +TI +PIA+AIGIGVRHS+ PGSRKALI
Sbjct: 259 HQMFEGLGLGTRIAETPWPESERFTPWLLALGYTIATPIAIAIGIGVRHSFAPGSRKALI 318

Query: 368 ANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCXXXXXXXXXXK 427
           +NG FD+IS+GILIYTGLVELMAHEFLY+N FKGP+GFK M+ A+FIMC          K
Sbjct: 319 SNGCFDAISAGILIYTGLVELMAHEFLYANSFKGPNGFKWMMLAFFIMCLGAGLMALLGK 378

Query: 428 WA 429
           WA
Sbjct: 379 WA 380

>NDAI0J01010 Chr10 (230625..231779) [1155 bp, 384 aa] {ON} Anc_8.325
          Length = 384

 Score =  427 bits (1099), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 216/418 (51%), Positives = 279/418 (66%), Gaps = 37/418 (8%)

Query: 12  VCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVI 71
            C  +ND+NG + +RIL++F+IL+SS +G +FP+LS+RYS+IRLP WCFFLAKFFGSGVI
Sbjct: 4   TCLNTNDFNGRTNIRILSIFMILLSSAIGTFFPLLSTRYSYIRLPPWCFFLAKFFGSGVI 63

Query: 72  VSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKSFGDE 131
           V+TAFIHLL+PA++ALG+ CLGGTF +YPWAFGICLMSLF LFF EIV+H++V K+F   
Sbjct: 64  VATAFIHLLEPASDALGDPCLGGTFADYPWAFGICLMSLFFLFFTEIVSHFYVNKAFETV 123

Query: 132 HHDHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQFQKSNCKLAQSAQNP 191
            H    NI+S  ++D D  D    S               DI+N+   +N  L +S Q+ 
Sbjct: 124 SHSASGNIHSHSNEDDDDHDHDKDSV--------------DIKNKHTTTNNDL-ESLQST 168

Query: 192 XXXXXXXXXXXXXXXXXXXXXALQDRQNISGNNKNNDNMTRFNSIPGKDHFSHDTDHQDQ 251
                                       ++   +++DN+ +     G +H+ H   HQD 
Sbjct: 169 SPGII----------------------GLATFTRSHDNVNKQMGTIGSNHYDHALVHQDP 206

Query: 252 TQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXXXXXXXXEEFETLFIVLTFHQMF 311
            Q+GT + +  KEQY NQ+ AV ILEFGI+FH            EEF TLFIVL FHQMF
Sbjct: 207 GQMGTSLNDSAKEQYANQLLAVTILEFGIVFHSVFIGLSLAVSGEEFTTLFIVLIFHQMF 266

Query: 312 EGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSWIPGSRKALIANGV 371
           EGLGLGTR+AE  W  ++R+TPWLM L F++T+PIA+AIG+GVRHS++P SR+ALI+NG 
Sbjct: 267 EGLGLGTRLAEVPWDKSKRFTPWLMALGFSLTTPIAIAIGLGVRHSFVPTSRRALISNGC 326

Query: 372 FDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCXXXXXXXXXXKWA 429
           FD+IS+GILIYTGLVELMAHEFLYSNQFKG +GFKKM++AY  MC          KWA
Sbjct: 327 FDAISAGILIYTGLVELMAHEFLYSNQFKGENGFKKMISAYICMCFGAGLMALLGKWA 384

>CAGL0E01353g Chr5 (127845..129146) [1302 bp, 433 aa] {ON} similar
           to uniprot|Q12436 Saccharomyces cerevisiae YLR130c ZRT2
           or uniprot|P32804 Saccharomyces cerevisiae YGL255w ZRT1
          Length = 433

 Score =  426 bits (1094), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 218/445 (48%), Positives = 290/445 (65%), Gaps = 37/445 (8%)

Query: 4   LLARDD----AVVCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWC 59
           L  RDD       C + ND+NGH+ LRIL+VF++LISS +GVYFP+L+SRYSFI LPSW 
Sbjct: 7   LFKRDDDDGPPPACAVDNDFNGHTNLRILSVFMVLISSAIGVYFPLLASRYSFINLPSWV 66

Query: 60  FFLAKFFGSGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIV 119
           FF+AKFFGSGVIV+TAFIHLL+PA+++LGN CLGGTF  YPWAFGICLM+LF LF +EIV
Sbjct: 67  FFIAKFFGSGVIVATAFIHLLEPASDSLGNPCLGGTFANYPWAFGICLMALFALFLIEIV 126

Query: 120 THYFVAKSFGDEHHDHGNNINS------VHDDDADSSDESITSYTEDHPVILPRRSHNDI 173
           +H++V K+ G  H +H +N+ +      +H  + D  DE  +S T  H  +     + D+
Sbjct: 127 SHHYVGKTMGGGH-NHSHNMPTTFGQTHMHGVEDDMVDEDGSSSTHSHSHVAMDDKYGDV 185

Query: 174 ---ENQFQKSNCKLAQSAQNPXXXXXXXXXXXXXXXXXXXXXALQDRQNISGNNKN---- 226
               N          +S + P                     A Q  +N S  N +    
Sbjct: 186 VKNNNYNYDDGSDDIESQKRPAFNV-----------------AQQKVRNDSNENDSLVGH 228

Query: 227 --NDNMTRFNSIPGKDHFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHX 284
             N  +     +PG +HFSHD  HQD TQ+G+   ++ KEQYLNQ+ ++FILEFGI+FH 
Sbjct: 229 VHNTTVDPLEHMPGHNHFSHDEVHQDITQIGSKANDQQKEQYLNQLTSLFILEFGILFHS 288

Query: 285 XXXXXXXXXXXEEFETLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITS 344
                      +EF+TLF+V+ FHQMFEG+GLG R+ E  WP ++R+ P+L+G  +TIT+
Sbjct: 289 VFVGLSLSVSGDEFKTLFVVIVFHQMFEGMGLGARITECYWPHSKRWLPYLLGFGYTITT 348

Query: 345 PIAVAIGIGVRHSWIPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDG 404
           PIA+AIGIGVRHS++PGSR++LI NGVFD+IS+GIL+Y GLVELMAHEFL++NQFKG  G
Sbjct: 349 PIAIAIGIGVRHSFVPGSRRSLIVNGVFDAISAGILVYAGLVELMAHEFLFTNQFKGEHG 408

Query: 405 FKKMLAAYFIMCXXXXXXXXXXKWA 429
            + MLAAYF+M           +WA
Sbjct: 409 LRNMLAAYFVMALGAGLMALLGRWA 433

>KNAG0A05180 Chr1 (764235..765422) [1188 bp, 395 aa] {ON} Anc_8.325
           YLR130C
          Length = 395

 Score =  418 bits (1074), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 238/430 (55%), Positives = 285/430 (66%), Gaps = 46/430 (10%)

Query: 4   LLARDD----AVVCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWC 59
           L  RDD    A  C  +N+Y+G S LRIL++FIILISS +G +FPILSS+YSFIRLP WC
Sbjct: 8   LFKRDDDSGPAPACADTNEYDGRSNLRILSIFIILISSAMGSFFPILSSKYSFIRLPDWC 67

Query: 60  FFLAKFFGSGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIV 119
           FFLAKFFGSGVIV+TAF+HLL PA EAL +ECL GTF  YPWAFGICLMSLFLLF +E+V
Sbjct: 68  FFLAKFFGSGVIVATAFVHLLQPANEALTDECLTGTFQSYPWAFGICLMSLFLLFLMELV 127

Query: 120 THYFVAKSFGDEHHDHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQFQK 179
           +HY +AK+FG   HDH +  N V  D  +  DES +       +     S++  E   + 
Sbjct: 128 SHYLIAKTFGHAAHDHSDFGNFVRKDSKELIDESDSESLHKGSLRFEVNSNSAPEEDIE- 186

Query: 180 SNCKLAQSAQNPXXXXXXXXXXXXXXXXXXXXXALQDRQNISGNNKNNDNMTRFNSIPGK 239
                    +NP                            I GN+   D M    S+PGK
Sbjct: 187 ---------ENP--------------------------HTILGNS---DKMA---SMPGK 205

Query: 240 DHFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXXXXXXXXEEFE 299
            H+ H   HQD  QLG+P+EE +KE+Y NQ+ AV  LEFGI+FH            +EF+
Sbjct: 206 GHYDHAVFHQDPAQLGSPLEEPNKEKYANQIMAVLFLEFGILFHSVFIGLSLAVAGDEFK 265

Query: 300 TLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSWI 359
           TLFIVL FHQMFEGLGLGTR+AET WP NRR TPW++ L FT+T+P+A+AIG+GVRHS+I
Sbjct: 266 TLFIVLVFHQMFEGLGLGTRIAETKWPENRRLTPWMLALGFTLTTPVAIAIGLGVRHSFI 325

Query: 360 PGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCXXX 419
           PGSRKAL++NGVFDSISSGILIYTGLVELMAHEFLYSNQF G DGFKKM+ AY IMC   
Sbjct: 326 PGSRKALVSNGVFDSISSGILIYTGLVELMAHEFLYSNQFNGADGFKKMILAYVIMCFGV 385

Query: 420 XXXXXXXKWA 429
                  KWA
Sbjct: 386 GLMALLGKWA 395

>TBLA0H01270 Chr8 (286413..287618) [1206 bp, 401 aa] {ON} Anc_8.325
           YLR130C
          Length = 401

 Score =  417 bits (1071), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 211/423 (49%), Positives = 267/423 (63%), Gaps = 44/423 (10%)

Query: 8   DDAVVCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFG 67
           D    CE SNDY+G   LRIL+VFI+LISSG+GV FPIL+S+YSFIRLP WCFF+AKFFG
Sbjct: 22  DHVPACETSNDYDGRMNLRILSVFILLISSGIGVNFPILASQYSFIRLPKWCFFIAKFFG 81

Query: 68  SGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKS 127
           SGVI++TAF+HLL+PAA+ALGN CLGGTF EYPWAFGICLMSLF LFF EI++H+ + + 
Sbjct: 82  SGVIIATAFVHLLEPAADALGNACLGGTFAEYPWAFGICLMSLFFLFFTEIISHHIIDQR 141

Query: 128 FGDEH-HDHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQFQKSNCKLAQ 186
              EH H H     ++   D     E  +   E +P+++   +        +  + K A 
Sbjct: 142 LAKEHGHGHDEEHAAIERVDTIECCEENSCDEEPNPMVIQEENSATTYIDSKNKDEKKAA 201

Query: 187 SAQNPXXXXXXXXXXXXXXXXXXXXXALQDRQNISGNNKNNDNMTRFNSIPGKDHFSHDT 246
             Q                       + +   ++  +  ++D MTR              
Sbjct: 202 DVQ---------------INEHLQYDSQEKTVDLENSISHHDGMTR-------------- 232

Query: 247 DHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXXXXXXXXEEFETLFIVLT 306
                          ++EQYLNQ+ AV +LE G+I H            + F TLFIVLT
Sbjct: 233 --------------AEREQYLNQLVAVMVLEAGVIVHSVFIGLSLAVTGDNFVTLFIVLT 278

Query: 307 FHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSWIPGSRKAL 366
           FHQMFEGLGLGTRVAET WP ++R TPWLM LAFT+T+P+AVAIG+GVR+SW+PGSR +L
Sbjct: 279 FHQMFEGLGLGTRVAETPWPKSKRMTPWLMALAFTLTTPVAVAIGLGVRNSWVPGSRTSL 338

Query: 367 IANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCXXXXXXXXXX 426
           IANG+FD+IS+GILIYTGLVELMAHEFLYS QFKG +G K+ML+AYF+MC          
Sbjct: 339 IANGIFDAISAGILIYTGLVELMAHEFLYSGQFKGENGLKQMLSAYFVMCCGAALMALLG 398

Query: 427 KWA 429
           KWA
Sbjct: 399 KWA 401

>CAGL0M04301g Chr13 complement(472227..473396) [1170 bp, 389 aa]
           {ON} similar to uniprot|Q12436 Saccharomyces cerevisiae
           YLR130c ZRT2 or uniprot|P32804 Saccharomyces cerevisiae
           YGL255w ZRT1
          Length = 389

 Score =  412 bits (1059), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 222/433 (51%), Positives = 270/433 (62%), Gaps = 53/433 (12%)

Query: 3   ELLARDDAVVCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFL 62
           ELL R     C   NDYNG   LRILAVFI++ISSGLG YFPILSS+YSFIRLP+WCFF+
Sbjct: 4   ELLGRS-VDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFV 62

Query: 63  AKFFGSGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVTHY 122
           AKFFGSGVI++TAFIHLL PAAEAL ++CLGGTF +YPWAFGICLMSLF+LF  EIV H+
Sbjct: 63  AKFFGSGVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHH 122

Query: 123 FVAKSFGDEHHDHGNNINSVHDDDADSSDESITSYTEDHPVILP--RRSHNDIENQFQKS 180
           FV K F +  H   +N N++ D                  +IL   + S +D+       
Sbjct: 123 FVDKKF-NHSHAETDNANALPD------------------IILKDIQISTDDLSEGML-- 161

Query: 181 NCKLAQSAQNPXXXXXXXXXXXXXXXXXXXXXALQDRQNISGNNKNNDNMTRFNSIPGKD 240
           NC   Q +                         LQD + I      N      +   G+ 
Sbjct: 162 NCAGHQDS-------------------------LQDSKKIETGVSTNLKRVDDSGFEGQY 196

Query: 241 HFSHDTDHQ---DQTQLGTPIEEED-KEQYLNQMFAVFILEFGIIFHXXXXXXXXXXXXE 296
            +  ++  +   D+  L T   E      Y++++F + +LEFGIIFH             
Sbjct: 197 EYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLAVAGS 256

Query: 297 EFETLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRH 356
           EF+ LFIV+TFHQMFEGLGLGTR+AET WP ++ YTPW+M  AFTITSPIA+AIGIGVRH
Sbjct: 257 EFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIGIGVRH 316

Query: 357 SWIPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMC 416
           SW+PGSRKALIANGVFDSISSGILIYTGL+ELMAHEF++SNQFKG    + ML AYFIMC
Sbjct: 317 SWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYFIMC 376

Query: 417 XXXXXXXXXXKWA 429
                     +WA
Sbjct: 377 CGAALMALLGRWA 389

>KLLA0D16434g Chr4 complement(1384826..1386070) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q12436 Saccharomyces cerevisiae
           YLR130C ZRT2 Low-affinity zinc transporter of the plasma
           membrane transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 414

 Score =  411 bits (1056), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 216/414 (52%), Positives = 262/414 (63%), Gaps = 47/414 (11%)

Query: 17  NDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVIVSTAF 76
           NDY+G   +R+ A+FIILIS GLG YFPILSSRYSFIRLP WCFF+AKFFGSGVIV+T F
Sbjct: 47  NDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVATGF 106

Query: 77  IHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKSFGDEHHDHG 136
           IHLL+PAA+ALG ECLGGTF +YPWAFGICLMSLF LF  E V  Y+  KS+G + +DH 
Sbjct: 107 IHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQ-NDH- 164

Query: 137 NNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQFQKSNCKLAQSAQNPXXXXX 196
                VH     S D+     + +         +N + ++    N  L  +  N      
Sbjct: 165 -----VHSHFPSSKDQK----SLEDEDDEDSDKYNQVVDE---ENVSLTVANNN------ 206

Query: 197 XXXXXXXXXXXXXXXXALQDRQNISGNNKNNDNMTRFNSIPGKDHFSHDTDHQDQTQLGT 256
                              +   I+  N +        S+PG +HFSHD  HQD   +GT
Sbjct: 207 -------------------NGAEITATNPH-------PSMPGSNHFSHDKSHQDLATIGT 240

Query: 257 PIEEEDKEQYLNQMFAVFILEFGIIFHXX-XXXXXXXXXXEEFETLFIVLTFHQMFEGLG 315
           P +   KE+Y NQ+ +VFILEFGIIFH             +EF TLFIVL FHQMFEG+G
Sbjct: 241 PAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGMG 300

Query: 316 LGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSWIPGSRKALIANGVFDSI 375
           LG R+AE +W    R+TPWL+   FT+T+PIA+AIGIGVRHS+ PGSR ALIANG FD+I
Sbjct: 301 LGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSYAPGSRTALIANGCFDAI 360

Query: 376 SSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCXXXXXXXXXXKWA 429
           S+GILIYTGLVELMAHEFLYS+ FKG +G KKML A+F MC          KWA
Sbjct: 361 SAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWGAGLMALLGKWA 414

>TPHA0D00970 Chr4 complement(195530..196681) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  408 bits (1048), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 211/419 (50%), Positives = 269/419 (64%), Gaps = 58/419 (13%)

Query: 12  VCEISNDYNGHS-GLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGV 70
           +C+I +DY+G S  LRILAVF++LISSGLG +FPILSS+YS IRLP+WCFF+AKFFGSGV
Sbjct: 22  ICDIESDYDGQSDNLRILAVFMVLISSGLGSFFPILSSKYSVIRLPNWCFFIAKFFGSGV 81

Query: 71  IVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKSFGD 130
           I +TAFIHLL+PA + LGN+CLGGTF EYPWAFGICLMSLF LF VEIVTH+ + K+   
Sbjct: 82  ITATAFIHLLEPATDELGNDCLGGTFAEYPWAFGICLMSLFTLFLVEIVTHHLMEKNVAG 141

Query: 131 EHHDHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQFQKSNCKLAQSAQN 190
                 N +  +HD+   SSDE                   D  N+ + +N +L  +++ 
Sbjct: 142 VTP---NKVVHMHDE-ISSSDEGFDKV--------------DDVNELEVTNTQLTTASE- 182

Query: 191 PXXXXXXXXXXXXXXXXXXXXXALQDRQNISGNNKNNDNMTRFNSIPGKDHFSHDTDHQD 250
                                    DR +             FN I G +H+SH   HQD
Sbjct: 183 -------------------------DRID-------------FNPIIGANHYSHAEHHQD 204

Query: 251 QTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXXXXXXXXEEFETLFIVLTFHQM 310
             Q+ + +EE  KE Y +Q+ ++ ILEFG+IFH            +EF+TLF+V+ FHQM
Sbjct: 205 IEQMNSALEETGKESYSSQIVSLLILEFGVIFHSIFVGLSLAVSGDEFKTLFVVIIFHQM 264

Query: 311 FEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSWIPGSRKALIANG 370
           FEGLGLG+R+AE NW     YTPWL+ L FT+ +PIA+AIGIGVR+S+ PGSR ALI++G
Sbjct: 265 FEGLGLGSRIAEQNWGVRNTYTPWLLALGFTVATPIAIAIGIGVRYSYFPGSRNALISSG 324

Query: 371 VFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCXXXXXXXXXXKWA 429
           +FDS+S+GILIYTGLVELMAHEFL+S QF+G +GFKKML AY  MC          KWA
Sbjct: 325 IFDSLSAGILIYTGLVELMAHEFLFSKQFQGENGFKKMLLAYVCMCCGCALMALIGKWA 383

>TBLA0F02390 Chr6 (588534..589817) [1284 bp, 427 aa] {ON} 
          Length = 427

 Score =  370 bits (951), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 208/440 (47%), Positives = 269/440 (61%), Gaps = 34/440 (7%)

Query: 4   LLARDDAV---VCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCF 60
           L  RDD+     C   NDY+G   LRILAVF++LISS +GV+FPIL+SRYSFIR+P   F
Sbjct: 8   LYRRDDSTPTPACPTQNDYDGRDNLRILAVFMLLISSSIGVFFPILASRYSFIRIPPIFF 67

Query: 61  FLAKFFGSGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVT 120
           F+AKFFGSGVIV+TAFIHLL PA + L + CLGG + EYPWAFGICLM+LFL+FF E++ 
Sbjct: 68  FIAKFFGSGVIVATAFIHLLQPAYDELNDPCLGGVWQEYPWAFGICLMALFLIFFSELMA 127

Query: 121 HYFVAKS-------FGDEHHDHGNNIN-SVHDDDADSSDESITSYTEDHPVILPRRSHND 172
           HYF+ ++         D H  H  N     H   AD  +ES     ++  V  P    +D
Sbjct: 128 HYFIERNERKNGGKVPDPHASHFRNPEFRGHKHGAD--NESGEMMEKEDQVGSPS---DD 182

Query: 173 IENQFQKSNCKLAQSAQNPXXXXXXXXXXXXXXXXXXXXXALQDRQNI-SGNNKNNDNM- 230
           +E+Q   S  +    A +                         DR+N+ S  +  N+N+ 
Sbjct: 183 LESQENDSIVERDAGASDEYRFYNEEEDVKRG-----------DRENVHSVADGKNENLV 231

Query: 231 -TRFNSIPGKDHFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXX 289
            +  N    +D  S D+D     +     E+    +Y+ ++ +V ILE GII H      
Sbjct: 232 FSEHNVEVSED--SEDSDGLFAAERKP--EDVSNSEYVRELVSVMILESGIIAHSIFIGL 287

Query: 290 XXXXXXEEFETLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVA 349
                 +EF+TLF+VL FHQMFEGLGLGTRVAE  WP ++RYTPW++G  F +T+PI+ A
Sbjct: 288 SLSVAGKEFDTLFVVLIFHQMFEGLGLGTRVAEVEWPYSKRYTPWILGACFGVTTPISAA 347

Query: 350 IGIGVRHSWIPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKML 409
           IGIGVRHSW+PGSR ALI NG+FDSIS+GILIYTGLVELMAHEFLY+N F+G +  KK+L
Sbjct: 348 IGIGVRHSWVPGSRSALIVNGIFDSISAGILIYTGLVELMAHEFLYANNFEGKNSLKKLL 407

Query: 410 AAYFIMCXXXXXXXXXXKWA 429
            AYF+MC          KWA
Sbjct: 408 LAYFVMCCGCGLMALLGKWA 427

>Kpol_1006.10 s1006 complement(43032..44207) [1176 bp, 391 aa] {ON}
           complement(43032..44207) [1176 nt, 392 aa]
          Length = 391

 Score =  358 bits (919), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 187/423 (44%), Positives = 256/423 (60%), Gaps = 57/423 (13%)

Query: 12  VCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVI 71
           VC  +N+YNG   LRIL+VF+ILISS +G + P++ S      +PSW FF+AKFFGSGVI
Sbjct: 21  VCAANNEYNGDLNLRILSVFMILISSAIGSFAPLILSNTKMFNVPSWFFFIAKFFGSGVI 80

Query: 72  VSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKS---- 127
           ++T+FIHLL PA +AL N+CLG  F +YPW+F I L+SLF+LFFVE++ +++++K+    
Sbjct: 81  IATSFIHLLSPATDALSNDCLGPGFTDYPWSFAIALISLFVLFFVELIVYHYMSKADRLL 140

Query: 128 -FGDEHHDHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQFQKSNCKLAQ 186
              D H+   +++NS H    D SD            +  ++S N      +K N     
Sbjct: 141 QSPDVHYHKHSSMNS-HGCTDDQSD------------LASKKSKN-----IEKVN----- 177

Query: 187 SAQNPXXXXXXXXXXXXXXXXXXXXXALQDRQNISGNNKNNDNMTRFNSIPGKDHFSHDT 246
                                       +D ++ + N+  ++  T FN + GKDHFSH  
Sbjct: 178 ----------------------------EDIESCNINDNQDEINTNFNPMLGKDHFSHKD 209

Query: 247 DHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXXXXXXXXEEFETLFIVLT 306
            HQD+     P+   D E + NQ+ AV   E GI+FH             EF+TLF+VL 
Sbjct: 210 THQDRNPSNPPLNNTD-EGFYNQLVAVLFFESGIVFHSVFIGLSLAVAGSEFKTLFVVLV 268

Query: 307 FHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSWIPGSRKAL 366
           FHQMFE LGLG R+ E  W  ++R+ PWL+ L F++ +PIA+AIGIGVR+SW P S+ AL
Sbjct: 269 FHQMFEALGLGARLVEVEWKKDKRWMPWLLALGFSLCTPIAIAIGIGVRNSWTPESKGAL 328

Query: 367 IANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCXXXXXXXXXX 426
           I NG+FDSIS+GILIYTGLVEL+AHEFL+SNQFK P+GFK+M+ AYF+MC          
Sbjct: 329 ITNGIFDSISAGILIYTGLVELIAHEFLFSNQFKNPNGFKQMMLAYFVMCIGAGLMALLG 388

Query: 427 KWA 429
           KWA
Sbjct: 389 KWA 391

>SAKL0F16346g Chr6 complement(1331198..1332337) [1140 bp, 379 aa]
           {ON} similar to uniprot|Q12436 Saccharomyces cerevisiae
           YLR130C ZRT2 Low-affinity zinc transporter of the plasma
           membrane transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 379

 Score =  323 bits (828), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 176/421 (41%), Positives = 237/421 (56%), Gaps = 73/421 (17%)

Query: 9   DAVVCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGS 68
           D+  C   + YNG+ G+RILAVFI+LISS +G + P+L S+YSFIRLP W FF+AK+FGS
Sbjct: 32  DSSACPGGSGYNGNDGIRILAVFILLISSAIGSFSPLLGSKYSFIRLPDWFFFIAKYFGS 91

Query: 69  GVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKSF 128
           GVI++T FIHLL  ++ +LG ECLG  F  YPWA+ ICL S+F +FFVE++ H    K+ 
Sbjct: 92  GVIIATGFIHLLFHSSHSLGEECLGDGFTSYPWAYLICLASIFTVFFVELLAHRLFIKAS 151

Query: 129 GDEHHDHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQFQKSNCKLAQSA 188
            D   D          + A+S++ S  +Y ++  V++ +      E Q   ++  L    
Sbjct: 152 SDSASDL---------EFAESNNTSEENYPKNSAVMVSKS-----ETQQDDTSSVLDNG- 196

Query: 189 QNPXXXXXXXXXXXXXXXXXXXXXALQDRQNISGNNKNNDNMTRFNSIPGKDHFSHDTDH 248
                                    L+D Q+ S  N  N+              SH T  
Sbjct: 197 -----------------------LPLKDEQSESSENYKNNG-------------SHST-- 218

Query: 249 QDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXXXXXXXXEEFETLFIVLTFH 308
                               Q+ A+F+LEFG++FH            +EF TLFIVL FH
Sbjct: 219 --------------------QLIAIFVLEFGVLFHSVFVGLSLAVAGDEFNTLFIVLIFH 258

Query: 309 QMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSWIPGSRKALIA 368
           QMFEGLGLG R+AETNWP  RR+TPW++ LAF + +PI++AIGIGV+ S+ P S ++LI 
Sbjct: 259 QMFEGLGLGARIAETNWPHKRRFTPWMLALAFAVCTPISIAIGIGVKKSYAPYSSRSLIF 318

Query: 369 NGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCXXXXXXXXXXKW 428
            GVFD+IS+GILIY G+VELMAHEF +   F+GP   K ML A+FIMC          KW
Sbjct: 319 TGVFDAISAGILIYAGIVELMAHEFFHETTFQGPGKLKSMLWAFFIMCLGAGLMSLLGKW 378

Query: 429 A 429
           A
Sbjct: 379 A 379

>NCAS0B03580 Chr2 complement(635005..636048) [1044 bp, 347 aa] {ON}
           Anc_8.325
          Length = 347

 Score =  292 bits (748), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 138/198 (69%), Positives = 157/198 (79%), Gaps = 2/198 (1%)

Query: 234 NSIPGKDHFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXXXXXX 293
           +S PGK HFSH+ DHQD  Q+GTP  ++ KEQY NQ+FAVFILEFGI+FH          
Sbjct: 150 DSRPGKQHFSHEEDHQDAIQIGTPANDKAKEQYTNQVFAVFILEFGILFHSIFIGLSLAV 209

Query: 294 XXEEFETLFIVLTFHQMFEGLGLGTRVAETNWPSN--RRYTPWLMGLAFTITSPIAVAIG 351
             +EF TLFIVL FHQMFEGLGLGTRVAETNWP +  +++TPWLMGLAFT  +P+A+AIG
Sbjct: 210 SGDEFHTLFIVLIFHQMFEGLGLGTRVAETNWPDSGPKKWTPWLMGLAFTFVTPVAIAIG 269

Query: 352 IGVRHSWIPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAA 411
           +GVRHSW+PGSR+ALIANGVFDS+SSGILIYTGLVELMAHEFLYSNQFKGP GFKKML A
Sbjct: 270 LGVRHSWVPGSRRALIANGVFDSLSSGILIYTGLVELMAHEFLYSNQFKGPGGFKKMLYA 329

Query: 412 YFIMCXXXXXXXXXXKWA 429
           YF MC          KWA
Sbjct: 330 YFFMCCGAGIMALLGKWA 347

 Score =  201 bits (510), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 116/151 (76%), Gaps = 1/151 (0%)

Query: 12  VCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVI 71
            C+  NDYNG + +RIL+VF+I+ISSGLGV+FP+L+S+YSFIRLP WCFFLAKFFGSGVI
Sbjct: 4   TCQAQNDYNGETNIRILSVFMIMISSGLGVFFPLLASKYSFIRLPDWCFFLAKFFGSGVI 63

Query: 72  VSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKSFGDE 131
           V+TAF+HLL PA+EAL + CLGGTF +YPWAFGICLMSLF LFF EI +HY+++K+F DE
Sbjct: 64  VATAFVHLLQPASEALSDPCLGGTFADYPWAFGICLMSLFFLFFTEIFSHYYISKAFSDE 123

Query: 132 HHDHGNNINSVHDDDADSSDESITSYTEDHP 162
             D  + I+     D+D     +    +  P
Sbjct: 124 -KDSSDTISKDSSYDSDLEANQVIPVNDSRP 153

>AGL143C Chr7 complement(431959..433083) [1125 bp, 374 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YLR130C
           (ZRT2) and YGL255W (ZRT1)
          Length = 374

 Score =  229 bits (584), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 107/216 (49%), Positives = 144/216 (66%), Gaps = 1/216 (0%)

Query: 215 QDRQNISGNNKNNDNMTRFNSIPGKDHFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVF 274
           +D        K N  ++  NS     HF+HD  HQD  Q  +   + ++EQYLNQ+ ++F
Sbjct: 159 EDESTEDTPPKPNTAVSGANSAVVSQHFAHDECHQDLEQAKSLAADPNREQYLNQLISLF 218

Query: 275 ILEFGIIFHXXXXXXXXXXXXEE-FETLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTP 333
           ILEFG++FH            E+ F TLF+VL FHQMFEG+GLG R+AET W  +R++TP
Sbjct: 219 ILEFGVVFHSVLIGLSLAVTAEDHFTTLFVVLIFHQMFEGMGLGARIAETEWGVHRKWTP 278

Query: 334 WLMGLAFTITSPIAVAIGIGVRHSWIPGSRKALIANGVFDSISSGILIYTGLVELMAHEF 393
           WL+GL + +++PIA+AIG+GVRHS+ P SR +LI NGVFDS+S+GI++YTGL+ELMAHEF
Sbjct: 279 WLLGLGYCLSTPIAIAIGLGVRHSFAPESRPSLIVNGVFDSLSAGIMLYTGLIELMAHEF 338

Query: 394 LYSNQFKGPDGFKKMLAAYFIMCXXXXXXXXXXKWA 429
           L+SN FKG  GF KM+  +  MC          KWA
Sbjct: 339 LFSNSFKGEGGFNKMMQGFVYMCLGAGLMALLGKWA 374

 Score =  160 bits (405), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 79/150 (52%), Positives = 101/150 (67%), Gaps = 10/150 (6%)

Query: 13  CEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVIV 72
           C   N+Y+G  G+RIL+VFIIL++S +G +FP+L SR+S +RLP+W FF AK+FGSGVIV
Sbjct: 28  CPTENEYDGSDGIRILSVFIILLASAIGTFFPMLGSRFSRVRLPTWAFFFAKYFGSGVIV 87

Query: 73  STAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKSFGDEH 132
           +T FIHLL    E+L N CLGG   EYPWAF IC+MSLF LFFVEI +H+FV K+     
Sbjct: 88  ATGFIHLLLHGHESLSNPCLGGVLSEYPWAFAICMMSLFTLFFVEINSHHFVNKA----- 142

Query: 133 HDHGNNINSVHDDDADSSDESITSYTEDHP 162
                 +    D+ +   DES    TED P
Sbjct: 143 -ARSTAVAVAGDEKSIKEDES----TEDTP 167

>Ecym_4202 Chr4 (419650..420777) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii AGL143C
          Length = 375

 Score =  226 bits (577), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 146/227 (64%), Gaps = 11/227 (4%)

Query: 214 LQDRQNISG----------NNKNNDNMTRFNSIPGKDHFSHDTDHQDQTQLGTPIEEEDK 263
           L +  N+SG          ++K  D  T     PG  HFSHD  HQD  Q        +K
Sbjct: 149 LAENGNVSGKSLKDEDSQLDSKAADAPTSVLGPPGNKHFSHDEYHQDIEQANGLATNPNK 208

Query: 264 EQYLNQMFAVFILEFGIIFHXXXX-XXXXXXXXEEFETLFIVLTFHQMFEGLGLGTRVAE 322
           EQY NQ+ ++FILEFG++FH             EEF TLF+VL FHQMFEGLGLGTR+AE
Sbjct: 209 EQYSNQLISLFILEFGVVFHSILIGLALAVSSSEEFVTLFVVLIFHQMFEGLGLGTRIAE 268

Query: 323 TNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSWIPGSRKALIANGVFDSISSGILIY 382
            +W S +  TPWL+   +++ +P+A+A+G+G++HS+ P SR++LI NG+FD+IS+G+LIY
Sbjct: 269 ASWGSGKSLTPWLLAFGYSLATPLAIAVGLGIKHSFAPESRQSLIVNGIFDAISAGVLIY 328

Query: 383 TGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCXXXXXXXXXXKWA 429
           TGL+ELMAHEFL+SN FKG +G+ KM+  + IMC          +WA
Sbjct: 329 TGLIELMAHEFLFSNSFKGENGYTKMMYGFIIMCFGAGSMSLLGRWA 375

 Score =  171 bits (434), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 115/175 (65%), Gaps = 12/175 (6%)

Query: 13  CEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVIV 72
           CE+ N Y+G   LR++A+F+ILI+S +G  FP+LS+ YS IRLPS+CFF AK+FGSGVIV
Sbjct: 32  CEVGNSYDGQDHLRVVAIFVILITSAIGTIFPLLSTNYSRIRLPSYCFFFAKYFGSGVIV 91

Query: 73  STAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKSFGDEH 132
           +T FIHLL PA E L NECLGG F +YPWAF IC+M+LF LFFVEI TH+FV KS  +  
Sbjct: 92  ATGFIHLLQPANENLSNECLGGVFAQYPWAFAICMMALFSLFFVEINTHHFVHKS--NRL 149

Query: 133 HDHGNNINSVHDDDADSSDESITSYTEDHP--VILP----RRSHNDIENQFQKSN 181
            ++GN    V        D  + S   D P  V+ P      SH++     +++N
Sbjct: 150 AENGN----VSGKSLKDEDSQLDSKAADAPTSVLGPPGNKHFSHDEYHQDIEQAN 200

>KLTH0F09064g Chr6 (779431..780516) [1086 bp, 361 aa] {ON} similar
           to uniprot|Q12436 Saccharomyces cerevisiae YLR130C ZRT2
           Low-affinity zinc transporter of the plasma membrane
           transcription is induced under low- zinc conditions by
           the Zap1p transcription factor
          Length = 361

 Score =  224 bits (570), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 135/195 (69%), Gaps = 3/195 (1%)

Query: 235 SIPGKDHFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXXXXXXX 294
           S PG D    D  +Q+  ++ +       E +L+Q+  VFILEFG+IFH           
Sbjct: 170 SKPGSDG---DAVYQEAHRVLSASSSTVTEGFLSQVVTVFILEFGVIFHSVFIGLSLAVS 226

Query: 295 XEEFETLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGV 354
             EF TLFIVL FHQMFEGLGLGTR+AE +WP+N+RYTPW++ L F+I++PIA+AIG+GV
Sbjct: 227 GSEFITLFIVLIFHQMFEGLGLGTRIAEISWPANKRYTPWILALGFSISTPIAIAIGLGV 286

Query: 355 RHSWIPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFI 414
           RHS    SR  LIANG FD+ISSGILIYTGLVELMAHEF++S+QFKGP G KKML A+ +
Sbjct: 287 RHSLSTNSRSGLIANGCFDAISSGILIYTGLVELMAHEFIFSSQFKGPGGLKKMLFAFTM 346

Query: 415 MCXXXXXXXXXXKWA 429
           MC          +WA
Sbjct: 347 MCAGSGLMALLGRWA 361

 Score =  162 bits (410), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 102/143 (71%), Gaps = 4/143 (2%)

Query: 13  CEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVIV 72
           C  SN+++G  GLR+ A+F+I+ SS LG +FPI++S YS + LP WCFF+AKFFGSGVI+
Sbjct: 16  CSTSNEFDGREGLRVGALFVIMASSALGAFFPIMASNYSAVSLPDWCFFVAKFFGSGVII 75

Query: 73  STAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVTHYF---VAKSF- 128
           +T F+HLL PA EAL + CL GTF +YPWAFGICLMSL+ +F VEIVTH+    VA ++ 
Sbjct: 76  ATGFVHLLQPANEALTDPCLTGTFQDYPWAFGICLMSLYAIFLVEIVTHHMLSRVAPAYS 135

Query: 129 GDEHHDHGNNINSVHDDDADSSD 151
             E   H  +  +  DD+   S+
Sbjct: 136 ATEARAHSGSDATCMDDELRLSE 158

>TDEL0D06550 Chr4 (1177932..1179077) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  193 bits (490), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 121/384 (31%), Positives = 190/384 (49%), Gaps = 78/384 (20%)

Query: 17  NDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVIVSTAF 76
           N+YNG  G RI ++F+IL+ S     +P+++ R  ++++  W +  A+ FG GVI++TAF
Sbjct: 41  NEYNGWMGARISSIFVILVLSTCCTLYPVVAKRVKWLKINKWFYSFARNFGIGVIIATAF 100

Query: 77  IHLLDPA-AEALGNECLG--GTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKSFGDEHH 133
           IHLLDPA AE  G  C+G  G +  Y W   I L+++FL F  ++ +  +V K +G    
Sbjct: 101 IHLLDPAYAEIGGLSCVGMTGNWSIYAWCPAIMLLTIFLTFLTDLFSAVYVEKKYG---- 156

Query: 134 DHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQFQKSNCKLAQSAQNPXX 193
                    H  D D  +++I S         P     D E    + +C           
Sbjct: 157 -------KTHQHDFDEIEQTIVS---------PAEPVQDFERSQVEEDCD---------- 190

Query: 194 XXXXXXXXXXXXXXXXXXXALQDRQNISGNNKNNDNMTRFNSIPGKDHFSHDTDHQDQTQ 253
                                 D  + + + K+ D  T             D+D      
Sbjct: 191 ---------------------HDHHSNTKDKKSIDTFT-------------DSD------ 210

Query: 254 LGTPIEEEDKEQYLNQMFAVF-ILEFGIIFHXXXXXXXXXXXXEEFETLFIVLTFHQMFE 312
               ++    +      FA F ILEFG++FH            EEF TL+ VL FHQ FE
Sbjct: 211 ----VDSTTADMSFKSEFAAFLILEFGVLFHSVMIGLNLGSVGEEFSTLYPVLVFHQSFE 266

Query: 313 GLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSWIPGSRKALIANGVF 372
           GLG+G R++  ++P N+R+ P+ + LA+ +T+PI VAIG+GVR ++   S    + +GV 
Sbjct: 267 GLGIGARLSAIDFPQNKRWWPYALCLAYGLTTPICVAIGLGVRTTYNGESYVVNVVSGVL 326

Query: 373 DSISSGILIYTGLVELMAHEFLYS 396
           D+IS+G+LIYTGLVE++A ++L++
Sbjct: 327 DAISAGVLIYTGLVEMLARDYLFN 350

>ZYRO0F02200g Chr6 (178997..180142) [1146 bp, 381 aa] {ON} similar
           to uniprot|P32804 Saccharomyces cerevisiae YGL255W ZRT1
           High-affinity zinc transporter of the plasma membrane
           responsible for the majority of zinc uptake
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 381

 Score =  181 bits (458), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 114/385 (29%), Positives = 194/385 (50%), Gaps = 79/385 (20%)

Query: 17  NDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVIVSTAF 76
           N+YNG+ G RI ++F+IL++S     FP+++ + S++R+  + +  A+ FG+GVI++TAF
Sbjct: 44  NEYNGNLGARISSIFVILVTSSALTLFPLIAKKVSWLRVHKYVYLFARSFGTGVILATAF 103

Query: 77  IHLLDPAAEALGN-ECLG--GTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKSFGDEHH 133
           IHL+DPA + +G   C+   G +  Y W   I L +++           F+   FG  + 
Sbjct: 104 IHLMDPAYQEIGGFSCVAQVGNWSLYSWCPAIMLTTVYFT---------FLVDLFGGVYV 154

Query: 134 DHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQFQKSNCKLAQSAQNPXX 193
           +    I   H +D D + ++         VI P   H+D                     
Sbjct: 155 ERKYGI--AHSEDHDHAMDA---------VIAPH-VHDD--------------------- 181

Query: 194 XXXXXXXXXXXXXXXXXXXALQDRQNISGNNKNNDNMTRFNSIPGKDHFSHDTDHQDQTQ 253
                                    N++    ++ ++++ +S+      S DT       
Sbjct: 182 ---------------------SHLHNMNKETVDDSSLSKKDSVDVSVRSSQDT------- 213

Query: 254 LGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXXXXXXXXEEFETLFIVLTFHQMFEG 313
                  E    + ++  A  +LEFG++FH            +EF TL+ VL FHQ FEG
Sbjct: 214 ------LEKVISFKSEFSAFLVLEFGVLFHSVMIGLNLGTTGDEFSTLYPVLVFHQAFEG 267

Query: 314 LGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSWIPGSRKALIANGVFD 373
           LG+G R++  ++P N+R+ P+++ +A+ +T+PIA+AIG+GVR S+   S    + +GV D
Sbjct: 268 LGIGARLSAIDFPHNKRWWPYVLCMAYGLTTPIAIAIGLGVRKSYQSNSYAVNVVSGVLD 327

Query: 374 SISSGILIYTGLVELMAHEFLYSNQ 398
           +IS+GIL+YTGLVEL+A +FL++ Q
Sbjct: 328 AISAGILLYTGLVELLARDFLFNRQ 352

>ZYRO0D17732g Chr4 complement(1471224..1472423) [1200 bp, 399 aa]
           {ON} similar to uniprot|P32804 Saccharomyces cerevisiae
           YGL255W ZRT1 High-affinity zinc transporter of the
           plasma membrane responsible for the majority of zinc
           uptake transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 399

 Score =  171 bits (433), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 112/385 (29%), Positives = 188/385 (48%), Gaps = 61/385 (15%)

Query: 16  SNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVIVSTA 75
           S + NG +G RI ++F+I I+S     FP+++ +  ++R+  + +  A+ FG+GVIVST+
Sbjct: 41  SPEDNGVTGARISSIFVIFITSTALSLFPVVAQKVPWLRIHRYVYQFARSFGTGVIVSTS 100

Query: 76  FIHLLDPAAEALGN-ECLG--GTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKSFGDEH 132
           +IHL+DPA + +G   C+   G +  Y W   I L ++F  F V++ +  +V + +G  H
Sbjct: 101 YIHLMDPAYQEIGGYSCIAQTGNWSIYSWCPAIMLTTVFATFLVDLFSAVYVERKYGVVH 160

Query: 133 HDHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQFQKSNCKLAQSAQNPX 192
            ++G+ +                               N I +  +KSN     + Q   
Sbjct: 161 EENGDEV------------------------------ANAITHAAKKSNQSPVDNNQ--- 187

Query: 193 XXXXXXXXXXXXXXXXXXXXALQDRQNISGNNKNNDNMTRFNSIPGKDHFSHDTDHQDQT 252
                               +L +  N     +  DN          +  S DT     +
Sbjct: 188 ----------------MELESLPNSGNPYSGVQTMDN--------NDEKISTDTQSYALS 223

Query: 253 QLGTPIEEEDKEQYLNQMFAVF-ILEFGIIFHXXXXXXXXXXXXEEFETLFIVLTFHQMF 311
           +      E+D E+        F +LE G++FH            +EF TL+ VL FHQ F
Sbjct: 224 ESSRSENEQDVERRFRADLGAFMVLEAGLLFHSVMIGLNLGTIGDEFSTLYAVLVFHQSF 283

Query: 312 EGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSWIPGSRKALIANGV 371
           EGLG+G R+    +P ++ + P+ + LA+ +T+PI VAIG+GVR S+   S    + +G+
Sbjct: 284 EGLGIGARLCAITFPRDKWWWPYALCLAYGLTTPICVAIGLGVRKSYSSNSYSVNVVSGI 343

Query: 372 FDSISSGILIYTGLVELMAHEFLYS 396
            DSIS+GIL+YTGLVEL+A +++++
Sbjct: 344 LDSISAGILMYTGLVELLARDYMFN 368

>YGL255W Chr7 (20978..22108) [1131 bp, 376 aa] {ON}
           ZRT1High-affinity zinc transporter of the plasma
           membrane, responsible for the majority of zinc uptake;
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 376

 Score =  140 bits (354), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 111/182 (60%), Gaps = 7/182 (3%)

Query: 218 QNISGNNKNNDNMTRFNSIPGKDHFSHDTDHQDQTQLGTPIEEEDKEQ-YLNQMFAVFIL 276
           +N +  +  NDN        G  + SHDT +  +    +     D  Q +  Q +A  IL
Sbjct: 172 RNTAAVSSENDNEN------GTANGSHDTKNGVEYYEDSDATSMDVVQSFQAQFYAFLIL 225

Query: 277 EFGIIFHXXXXXXXXXXXXEEFETLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLM 336
           EFG+IFH            +EF +L+ VL FHQ FEGLG+G R++   +P ++R+ PW +
Sbjct: 226 EFGVIFHSVMIGLNLGSVGDEFSSLYPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWAL 285

Query: 337 GLAFTITSPIAVAIGIGVRHSWIPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYS 396
            +A+ +T+PI VAIG+GVR  ++ GS  AL+ +GV D+IS+GIL+YTGLVEL+A +F+++
Sbjct: 286 CVAYGLTTPICVAIGLGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFN 345

Query: 397 NQ 398
            Q
Sbjct: 346 PQ 347

 Score =  100 bits (249), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/141 (39%), Positives = 84/141 (59%), Gaps = 4/141 (2%)

Query: 17  NDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVIVSTAF 76
           N+YNG+ G RI +VF+IL  S     FP++S++   +R+P + +  AK+FGSGVIV+TAF
Sbjct: 41  NEYNGNLGARISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF 100

Query: 77  IHLLDPAAEAL-GNECLG--GTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKSFGDEH- 132
           IHL+DPA  A+ G  C+G  G +  Y W   I L SL   F  ++ +  +V + +G  H 
Sbjct: 101 IHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVWVERKYGLSHD 160

Query: 133 HDHGNNINSVHDDDADSSDES 153
           H H    ++V  + A  S E+
Sbjct: 161 HTHDEIKDTVVRNTAAVSSEN 181

>Smik_7.6 Chr7 (15678..16796) [1119 bp, 372 aa] {ON} YGL255W (REAL)
          Length = 372

 Score =  140 bits (353), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 103/157 (65%), Gaps = 1/157 (0%)

Query: 243 SHDTDHQDQTQLGTPIEEEDKEQ-YLNQMFAVFILEFGIIFHXXXXXXXXXXXXEEFETL 301
           SHD+ +  +    + +   D  Q +  Q +A  ILEFG+IFH            EEF TL
Sbjct: 187 SHDSKNGVEYFEESDVSSLDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSTGEEFATL 246

Query: 302 FIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSWIPG 361
           + VL FHQ FEGLG+G R++   +P ++R+ PW + +A+ +T+PI VAIG+GVR  ++ G
Sbjct: 247 YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCIAYGLTTPICVAIGLGVRTRYVSG 306

Query: 362 SRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQ 398
           S  AL+ +GV D+IS+GIL+YTGLVEL+A +F+++ Q
Sbjct: 307 SYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQ 343

 Score =  105 bits (263), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 91/144 (63%), Gaps = 4/144 (2%)

Query: 17  NDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVIVSTAF 76
           N+YNG+ G RI +VF+IL  S     FP++S++   +++P + +  A++FGSGVIV+TAF
Sbjct: 41  NEYNGNLGARISSVFVILFVSTFFTMFPLISTKVKKLKIPLYAYLFARYFGSGVIVATAF 100

Query: 77  IHLLDPAAEAL-GNECLG--GTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKSFGDEH- 132
           IHL+DPA  A+ GN C+G  G +  Y W   I L SL + F  ++ +  +V K +G  H 
Sbjct: 101 IHLMDPAYGAIGGNTCVGQTGNWGIYAWCPAIMLTSLTITFLTDLFSSVWVEKKYGLSHD 160

Query: 133 HDHGNNINSVHDDDADSSDESITS 156
           H H +  ++V +++  SS E+ T+
Sbjct: 161 HTHDDVKDTVVNNEVVSSPENCTA 184

>Suva_7.6 Chr7 (15340..16458) [1119 bp, 372 aa] {ON} YGL255W (REAL)
          Length = 372

 Score =  139 bits (351), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 108/173 (62%), Gaps = 7/173 (4%)

Query: 224 NKNNDNMTRFNSIPGKDHFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFH 283
           N +++N T   S   K+   +  +  D + L T       + + +Q +A  ILEFG+IFH
Sbjct: 176 NTSDENGTANRSYDDKNKVEY-FEESDASTLDT------VQSFQSQFYAFLILEFGVIFH 228

Query: 284 XXXXXXXXXXXXEEFETLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTIT 343
                       EEF TL+ VL FHQ FEGLG+G R++   +P ++R+ PW + +A+ +T
Sbjct: 229 SVMIGLNLGSTGEEFATLYPVLVFHQSFEGLGMGARLSGIEFPKSKRWWPWALCIAYGLT 288

Query: 344 SPIAVAIGIGVRHSWIPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYS 396
           +PI VAIG+G+R  ++ GS  A + +GV D+IS+GILIYTGLVEL+A +FL++
Sbjct: 289 TPICVAIGLGIRTKYVSGSYTASVVSGVLDAISAGILIYTGLVELLARDFLFN 341

 Score =  111 bits (278), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 103/180 (57%), Gaps = 16/180 (8%)

Query: 17  NDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVIVSTAF 76
           N+YNG+ G RI ++F+I + S     FP++S R    ++P + +  AK+FGSGVIV+TAF
Sbjct: 41  NEYNGNLGARISSIFVIFVVSTFFTLFPLISLRVKRFKIPLYAYLFAKYFGSGVIVATAF 100

Query: 77  IHLLDPAAEAL-GNECLG--GTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKSFGDEH- 132
           IHL+DPA  A+ GN C+G  G +  Y W   I L SLF  F  ++ +  +V + +G  H 
Sbjct: 101 IHLVDPAYSAIGGNSCVGQTGDWSLYAWCPAIMLTSLFFTFLTDLFSSVWVERKYGVAHD 160

Query: 133 HDHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIEN--QFQKSNCKLAQSAQN 190
           H H    ++V +D A++SDE+ T+           RS++D      F++S+     + Q+
Sbjct: 161 HTHDTIKDTVVNDAANTSDENGTA----------NRSYDDKNKVEYFEESDASTLDTVQS 210

>Skud_7.12 Chr7 (25081..26199) [1119 bp, 372 aa] {ON} YGL255W (REAL)
          Length = 372

 Score =  137 bits (346), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 114/197 (57%), Gaps = 13/197 (6%)

Query: 227 NDNMTRFNSIPGKDHFSHDTDHQDQTQLGTPIEEEDK------EQYLNQMFAVFILEFGI 280
            D +    ++   +H +    H+ +  +    EE D       + +  Q +A  ILEFG+
Sbjct: 167 KDTVVNDAAVCSTEHGTASGSHESKNGV-EYFEESDASSMDVVQSFQAQFYAFLILEFGV 225

Query: 281 IFHXXXXXXXXXXXXEEFETLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAF 340
           IFH            EEF TL+ VL FHQ FEGLG+G R++   +P ++R+ PW + +A+
Sbjct: 226 IFHSVMIGLNLGSVGEEFSTLYPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAY 285

Query: 341 TITSPIAVAIGIGVRHSWIPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFK 400
            +T+PI VAIG+GVR  +  GS  AL+ +G+ D+IS+GIL+YTGLVEL+A +F+++    
Sbjct: 286 GLTTPICVAIGLGVRTRYNSGSYTALVVSGILDAISAGILLYTGLVELLARDFIFN---- 341

Query: 401 GPDGFKKMLAAYF-IMC 416
            PD  K +    F ++C
Sbjct: 342 -PDRTKNLKELSFNVLC 357

 Score =  102 bits (254), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 17  NDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVIVSTAF 76
           N+YNG+ G RI +VF+IL  S     FP++S +   +R+P + +  AK+FGSGVI++TAF
Sbjct: 41  NEYNGNLGARISSVFVILFVSTFFTMFPLISKKVKKLRIPLYAYLFAKYFGSGVILATAF 100

Query: 77  IHLLDPAAEAL-GNECLG--GTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKSFGDEH- 132
           IHL+DPA  A+ GN C+G  G +  Y W   I L SL   F  ++ +  +V + +G  H 
Sbjct: 101 IHLMDPAYGAIGGNTCVGQTGNWGIYSWCPAIMLTSLTFTFLTDLFSSVWVERKYGVSHD 160

Query: 133 HDHGNNINSVHDDDADSSDESITS 156
           H H    ++V +D A  S E  T+
Sbjct: 161 HTHDEIKDTVVNDAAVCSTEHGTA 184

>KLTH0C00374g Chr3 complement(32017..33147) [1131 bp, 376 aa] {ON}
           similar to uniprot|P32804 Saccharomyces cerevisiae
           YGL255W ZRT1 High-affinity zinc transporter of the
           plasma membrane responsible for the majority of zinc
           uptake transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 376

 Score =  127 bits (318), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 67/188 (35%), Positives = 106/188 (56%), Gaps = 15/188 (7%)

Query: 213 ALQDRQNISGNNKNNDNMTRFNSIPGKDHFSHDTDHQDQTQLGTPIEEEDKEQYLNQMF- 271
           A+  RQ  + NN + ++           +  H  D  D+++    +      + + Q F 
Sbjct: 167 AIVKRQEATNNNVDIES----------HNLGHSADSDDKSKKSYDVVSNASTEIVTQSFE 216

Query: 272 ----AVFILEFGIIFHXXXXXXXXXXXXEEFETLFIVLTFHQMFEGLGLGTRVAETNWPS 327
               A  ILEFG+IFH            +EF TL+ VL FHQ FEGLG+G R++   +P 
Sbjct: 217 SQIGAFLILEFGVIFHSVMIGLNLGTTDDEFSTLYPVLVFHQSFEGLGIGARLSAIEFPK 276

Query: 328 NRRYTPWLMGLAFTITSPIAVAIGIGVRHSWIPGSRKALIANGVFDSISSGILIYTGLVE 387
           N+ + P+ + +A+ +T+PI VAIG+GVR ++   S    + +GV D+IS+GIL+YTGLVE
Sbjct: 277 NKWWWPYALCVAYGLTTPICVAIGLGVRTTYDGNSYTVNVVSGVLDAISAGILMYTGLVE 336

Query: 388 LMAHEFLY 395
           L+A +F++
Sbjct: 337 LLARDFIF 344

 Score = 96.3 bits (238), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 91/150 (60%), Gaps = 6/150 (4%)

Query: 17  NDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVIVSTAF 76
           N Y+G  G RI ++F+IL  S     FP++++R   +++P + +  A++FG+GVIV+TAF
Sbjct: 40  NSYSGSLGARISSIFVILFMSTFFTLFPVIAARSKRLKVPKYVYLFARYFGTGVIVATAF 99

Query: 77  IHLLDPAAEALGNE-CLG--GTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKSFGDEHH 133
           IHLLDPA   +G + C+G  G + +Y +   I L ++F +F V++ +  +V + FG   H
Sbjct: 100 IHLLDPAYGEIGPQSCVGMSGNWSKYSFCPAIILFTVFSIFIVDLASDVYVKRRFGIT-H 158

Query: 134 DHGNNINS--VHDDDADSSDESITSYTEDH 161
            HG+ I +  V   +A +++  I S+   H
Sbjct: 159 GHGDEIENAIVKRQEATNNNVDIESHNLGH 188

>KLTH0A07722g Chr1 (650427..651605) [1179 bp, 392 aa] {ON} similar
           to uniprot|P32804 Saccharomyces cerevisiae YGL255W ZRT1
           High-affinity zinc transporter of the plasma membrane
           responsible for the majority of zinc uptake
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 392

 Score =  126 bits (316), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 76/201 (37%), Positives = 114/201 (56%), Gaps = 16/201 (7%)

Query: 220 ISGNN---KNNDNMTRFNSIPGKDHFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFIL 276
           IS NN   K ND  T    I  KD  S+D      +++         + + +Q+ A  ++
Sbjct: 189 ISDNNPRLKENDAETGSPVISNKDDVSYDVVSGVNSEIAV-------KPFESQIGAFLVM 241

Query: 277 EFGIIFHXXXXXXXXXXXXEEFETLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLM 336
           EFGIIFH            EEF  L+ V+ FHQ FEGLG+G R+    +P  +++ P+ +
Sbjct: 242 EFGIIFHSVMIGLELGTTGEEFSILYPVIVFHQSFEGLGIGARLISIAFPEGKKWWPYAL 301

Query: 337 GLAFTITSPIAVAIGIGVRHSWIPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYS 396
            + +  T+PIA+AIG+GVR S+   S K  I +GV D+I++GILIYTGLVEL+A +F++ 
Sbjct: 302 CILYGATTPIAIAIGLGVRMSYNAHSFKMSIISGVLDAIAAGILIYTGLVELLARDFMFD 361

Query: 397 -NQFKGPDGFKKMLAAYFIMC 416
            N+ K     KK+   + I+C
Sbjct: 362 PNRTK---NLKKL--TFMIIC 377

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 81/133 (60%), Gaps = 4/133 (3%)

Query: 17  NDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVIVSTAF 76
           ++Y G    RI ++F+IL  S      P++ ++   I++P  C+  A++FG+GVI++TAF
Sbjct: 61  SEYQGSLNARISSIFVILFVSTSFTLLPVIFTKVKGIKVPKACYLFARYFGTGVIIATAF 120

Query: 77  IHLLDPAAEALG-NECLG--GTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKSFGDEHH 133
           IHL++ +  ++G N C+G  G + +Y W  GI L ++F++F V++++  ++ + FG    
Sbjct: 121 IHLMEHSYMSIGSNSCVGSSGRWADYSWCSGIVLTTVFVVFLVDLLSEVYIERKFGIS-C 179

Query: 134 DHGNNINSVHDDD 146
            HG+ +     D+
Sbjct: 180 SHGDLVEGAISDN 192

>Kwal_14.824 s14 complement(65415..66539) [1125 bp, 374 aa] {ON}
           YGL255W (ZRT1) - high-affinity zinc transport protein
           [contig 245] FULL
          Length = 374

 Score =  120 bits (302), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 94/162 (58%), Gaps = 3/162 (1%)

Query: 240 DHFSHDTDHQDQTQ---LGTPIEEEDKEQYLNQMFAVFILEFGIIFHXXXXXXXXXXXXE 296
           +H   D+D + +     +     E   E + +Q  A  ILEFG+IFH            +
Sbjct: 184 NHMHADSDDKSKKSYDVISDASSEIATESFESQFAAFLILEFGVIFHSVMIGLNLGTVGD 243

Query: 297 EFETLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRH 356
           EF  L+ VL FHQ FEGLG+G R++   +P  + + P+ + + + + +PI VAIG+GVR 
Sbjct: 244 EFSVLYPVLVFHQSFEGLGIGARLSSIAFPKGKAWWPYALCITYGLATPICVAIGLGVRT 303

Query: 357 SWIPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQ 398
           S+   S    I +GV D+IS+GILIYTGLVEL+A +F++  +
Sbjct: 304 SYNGNSFTVNIVSGVLDAISAGILIYTGLVELLARDFIFDEK 345

 Score =  112 bits (279), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 62/160 (38%), Positives = 95/160 (59%), Gaps = 20/160 (12%)

Query: 17  NDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVIVSTAF 76
           N+YNG  G RI ++F+I   S L   FP++++R   IR+P + +  A++FG+GVIV+TAF
Sbjct: 40  NEYNGSMGARISSIFVIFFVSTLFTLFPVVAARVKSIRIPKYVYLFARYFGTGVIVATAF 99

Query: 77  IHLLDPA-AEALGNECLG--GTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKSFGDEHH 133
           IHLLDPA  E  G+ C+G  G + +Y W   I L+++F++F V++ +  +V + FG   H
Sbjct: 100 IHLLDPAYGEIGGDSCVGKTGHWADYSWCPAIVLLTIFIIFLVDLASDVYVKRRFG-VAH 158

Query: 134 DHGNNI--------NSVHDD--------DADSSDESITSY 157
           +HG+ I           H+D         ADS D+S  SY
Sbjct: 159 NHGDVIEDAVVKRQGDAHEDLESHNNHMHADSDDKSKKSY 198

>Kwal_23.6522 s23 (1624044..1625213) [1170 bp, 389 aa] {ON} YGL255W
           (ZRT1) - high-affinity zinc transport protein [contig
           18] FULL
          Length = 389

 Score =  119 bits (297), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 59/132 (44%), Positives = 86/132 (65%)

Query: 264 EQYLNQMFAVFILEFGIIFHXXXXXXXXXXXXEEFETLFIVLTFHQMFEGLGLGTRVAET 323
           + + +Q+ A F+LEFGIIFH             EF  L+ V+ FHQ FEGLGLG R+   
Sbjct: 226 KSFESQIGAFFVLEFGIIFHSVMIGLELGTTGSEFSVLYPVIVFHQSFEGLGLGARLMSI 285

Query: 324 NWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSWIPGSRKALIANGVFDSISSGILIYT 383
            +P  +++ P+ +   + IT+PIAVAIG+GVR ++   S    I +G+ D+IS+GILIYT
Sbjct: 286 KFPEGKKWWPYALCGLYGITTPIAVAIGLGVRLTYNAHSFTMSIISGILDAISAGILIYT 345

Query: 384 GLVELMAHEFLY 395
           GLVEL+A +F++
Sbjct: 346 GLVELLAKDFIF 357

 Score = 87.0 bits (214), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 86/139 (61%), Gaps = 8/139 (5%)

Query: 17  NDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVIVSTAF 76
           ++Y G    RI ++F++L  S      PI+ ++   +++P +C+  A++FG+GVIVSTAF
Sbjct: 60  SEYQGSLPARISSIFVLLFVSTSFTLLPIVLNKIKGVKVPRYCYLFARYFGTGVIVSTAF 119

Query: 77  IHLLDPAAEALG-NECLG--GTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKSFGDEHH 133
           IHL++ +  ++G N C+G  G + +Y W   I ++++F++F V++++  ++ + +G    
Sbjct: 120 IHLMEHSYMSIGSNSCVGMTGHWADYTWCSCIVMVTVFVIFLVDLLSDVYIERKYGLT-G 178

Query: 134 DHGNN----INSVHDDDAD 148
            HG++    I  VH D+ D
Sbjct: 179 GHGDSIEEAITDVHKDEND 197

>KLLA0B02607g Chr2 complement(228049..230112) [2064 bp, 687 aa] {ON}
           weakly similar to uniprot|P34231 Saccharomyces
           cerevisiae YKL187C and weakly similar to uniprot|Q06689
           Saccharomyces cerevisiae YLR413W
          Length = 687

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 48/99 (48%), Gaps = 9/99 (9%)

Query: 25  LRILAVFIILISSGLGVYFPILSSRYS--FIRLPSWCFFLAKFFGSGVIVSTAFIHLLDP 82
           L I+  F +LI+  L  +F +L+ + +  F R+ + C  LA F   G I+S     ++  
Sbjct: 542 LSIIIAFFLLIAIILS-FFYMLTGKITRWFARVLAMC--LALFSVLGAIISVVVTQIIKE 598

Query: 83  AAEALGNECL---GGTFVEYPW-AFGICLMSLFLLFFVE 117
              A G   +   G  +    W AF +  +++ LLFFV+
Sbjct: 599 GTAADGYNVVHRGGSAYYGMVWTAFALAFITMILLFFVK 637

>NDAI0G03980 Chr7 complement(947806..949518) [1713 bp, 570 aa] {ON}
           Anc_3.50
          Length = 570

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 39/90 (43%), Gaps = 9/90 (10%)

Query: 28  LAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVIVSTAFIHLLDPAAEAL 87
           +A+F+ L+   LG    +  SR   + LP W  ++  FF    I++T         AE +
Sbjct: 118 IAIFLQLLCIKLGTVTGLDLSRACRMHLPKWMNYIIYFFAECAIIATDI-------AEVI 170

Query: 88  GNECLGGTFVEYPWAFGICLM--SLFLLFF 115
           G        ++ P   G+ +    +F++ F
Sbjct: 171 GTAIALNILIKVPLPAGVAITVADVFIIMF 200

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,473,900
Number of extensions: 1821318
Number of successful extensions: 9261
Number of sequences better than 10.0: 56
Number of HSP's gapped: 9489
Number of HSP's successfully gapped: 90
Length of query: 429
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 317
Effective length of database: 40,638,807
Effective search space: 12882501819
Effective search space used: 12882501819
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 67 (30.4 bits)