Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G019907.195ON1011015207e-70
KAFR0G029907.195ON110761781e-17
KLTH0E04576g7.195ON115781738e-17
CAGL0D05148g7.195ON108811675e-16
Kwal_55.20373singletonOFF115791632e-15
Kwal_YGOB_ADL119W7.195ON115791632e-15
Ecym_43817.195ON120831442e-12
NCAS0E018207.195ON114751432e-12
TDEL0H025207.195ON119811363e-11
TPHA0C045207.195ON135911349e-11
SAKL0F07480g7.195ON113761276e-10
ZYRO0D15818g7.195ON118811261e-09
KNAG0L012307.195ON128691216e-09
TBLA0J015107.195ON107951197e-09
Kpol_1063.107.195ON122811172e-08
KLLA0D16192g7.195ON121711145e-08
Scer_YGOB_ADL119W (ADL119W)7.195ON96711111e-07
ADL119W7.195ON185771114e-07
Skud_6.1257.195ON225561045e-06
Suva_6.1147.195ON26871632.2
KNAG0K004605.76ON70635613.9
CAGL0D00462g4.283ON71230614.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G01990
         (101 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G01990 Chr7 complement(449171..449476) [306 bp, 101 aa] {ON...   204   7e-70
KAFR0G02990 Chr7 (619397..619729) [333 bp, 110 aa] {ON} Anc_7.19...    73   1e-17
KLTH0E04576g Chr5 complement(414398..414745) [348 bp, 115 aa] {O...    71   8e-17
CAGL0D05148g Chr4 complement(492687..493013) [327 bp, 108 aa] {O...    69   5e-16
Kwal_55.20373 s55 complement(377983..378330) [348 bp, 115 aa] {O...    67   2e-15
Kwal_YGOB_ADL119W s55 complement(377983..378330) [348 bp, 115 aa...    67   2e-15
Ecym_4381 Chr4 complement(802807..803169) [363 bp, 120 aa] {ON} ...    60   2e-12
NCAS0E01820 Chr5 complement(355133..355477) [345 bp, 114 aa] {ON...    60   2e-12
TDEL0H02520 Chr8 complement(424797..425156) [360 bp, 119 aa] {ON...    57   3e-11
TPHA0C04520 Chr3 (975080..975487) [408 bp, 135 aa] {ON} Anc_7.19...    56   9e-11
SAKL0F07480g Chr6 (571315..571656) [342 bp, 113 aa] {ON} conserv...    54   6e-10
ZYRO0D15818g Chr4 (1321075..1321431) [357 bp, 118 aa] {ON} conse...    53   1e-09
KNAG0L01230 Chr12 (218769..219155) [387 bp, 128 aa] {ON} Anc_7.1...    51   6e-09
TBLA0J01510 Chr10 complement(344073..344396) [324 bp, 107 aa] {O...    50   7e-09
Kpol_1063.10 s1063 complement(28076..28444) [369 bp, 122 aa] {ON...    50   2e-08
KLLA0D16192g Chr4 (1364216..1364581) [366 bp, 121 aa] {ON} conse...    49   5e-08
Scer_YGOB_ADL119W Chr6 (226260..226550) [291 bp, 96 aa] {ON} ANN...    47   1e-07
ADL119W Chr4 (478065..478622) [558 bp, 185 aa] {ON} NOHBY409; No...    47   4e-07
Skud_6.125 Chr6 (221029..221706) [678 bp, 225 aa] {ON}  (REAL)         45   5e-06
Suva_6.114 Chr6 (192307..193113) [807 bp, 268 aa] {ON}  (REAL)         29   2.2  
KNAG0K00460 Chr11 (77388..79508) [2121 bp, 706 aa] {ON} Anc_5.76...    28   3.9  
CAGL0D00462g Chr4 (55305..57443) [2139 bp, 712 aa] {ON} weakly s...    28   4.0  

>NDAI0G01990 Chr7 complement(449171..449476) [306 bp, 101 aa] {ON}
           Anc_7.195
          Length = 101

 Score =  204 bits (520), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 101/101 (100%), Positives = 101/101 (100%)

Query: 1   MKTIVIPDTRFQQVFQNALERERNKLYPDTTKQNTGTLVTESLVIFKVILRDVILLPFIQ 60
           MKTIVIPDTRFQQVFQNALERERNKLYPDTTKQNTGTLVTESLVIFKVILRDVILLPFIQ
Sbjct: 1   MKTIVIPDTRFQQVFQNALERERNKLYPDTTKQNTGTLVTESLVIFKVILRDVILLPFIQ 60

Query: 61  SVLWTEFLIVCKPRIYRGFKSIANFNIKNITNMLTGRTNNY 101
           SVLWTEFLIVCKPRIYRGFKSIANFNIKNITNMLTGRTNNY
Sbjct: 61  SVLWTEFLIVCKPRIYRGFKSIANFNIKNITNMLTGRTNNY 101

>KAFR0G02990 Chr7 (619397..619729) [333 bp, 110 aa] {ON} Anc_7.195
          Scer_YGOB_ADL119W
          Length = 110

 Score = 73.2 bits (178), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 3/76 (3%)

Query: 4  IVIPDTRFQQVFQNALERERNKLYPDTTKQNTGTLVTESLVIFKVILRDVILLPFIQSVL 63
          + IPDTRF  VF+ A+++E  K   +T   N    + ++L+I KVI RDVIL+PFIQS+L
Sbjct: 12 LAIPDTRFGYVFRKAVQKELRKQVKETDSDNKH--INKNLIICKVIARDVILMPFIQSIL 69

Query: 64 WTEFLIVCKPRIYRGF 79
          WT FLI  KP   RGF
Sbjct: 70 WTGFLISFKP-CLRGF 84

>KLTH0E04576g Chr5 complement(414398..414745) [348 bp, 115 aa]
          {ON} conserved hypothetical protein
          Length = 115

 Score = 71.2 bits (173), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 51/78 (65%), Gaps = 3/78 (3%)

Query: 2  KTIVIPDTRFQQVFQNALERERNKLYPDTTKQNTGTLVTESL---VIFKVILRDVILLPF 58
          + + +PD RF+Q FQ AL RE +K    T++ ++ T    ++   VI KV+LRDV+L+PF
Sbjct: 11 QKVAVPDLRFEQTFQRALRREASKNQKATSQGHSTTDADATISASVICKVVLRDVLLMPF 70

Query: 59 IQSVLWTEFLIVCKPRIY 76
          +Q +LWT  LI  KP ++
Sbjct: 71 LQGILWTSALIALKPWLH 88

>CAGL0D05148g Chr4 complement(492687..493013) [327 bp, 108 aa]
          {ON} some similarities with KLLA0D16192g Kluyveromyces
          lactis and DEHA0C08349g Debaryomyces hansenii
          Length = 108

 Score = 68.9 bits (167), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 52/81 (64%), Gaps = 7/81 (8%)

Query: 4  IVIPDTRFQQVFQNALERE---RNKLYPDTTKQNTGTLVTESLVIFKVILRDVILLPFIQ 60
          I IPDTRF+Q F+ A++RE   +N L   +T          + VI KV++RDV+L+PFIQ
Sbjct: 5  IKIPDTRFEQTFRRAIDREVAKQNALSGKSTDDKKSG--PSAYVICKVVVRDVLLMPFIQ 62

Query: 61 SVLWTEFLIVCKP--RIYRGF 79
          SVLWT FL+  KP  R+  GF
Sbjct: 63 SVLWTGFLLGLKPWLRMVVGF 83

>Kwal_55.20373 s55 complement(377983..378330) [348 bp, 115 aa]
          {OFF} [contig 149] FULL
          Length = 115

 Score = 67.4 bits (163), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 3/79 (3%)

Query: 2  KTIVIPDTRFQQVFQNALERE--RNKLYPDTTKQNTGTLVTESL-VIFKVILRDVILLPF 58
          + + IPD RF+Q F+NAL+RE  +NK Y      +T +    S  +I KV+LRDV+LLPF
Sbjct: 11 QKVSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKVVLRDVLLLPF 70

Query: 59 IQSVLWTEFLIVCKPRIYR 77
          +Q  LWT  LI  +P ++ 
Sbjct: 71 LQGALWTGVLIAMRPWLWH 89

>Kwal_YGOB_ADL119W s55 complement(377983..378330) [348 bp, 115 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 115

 Score = 67.4 bits (163), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 3/79 (3%)

Query: 2  KTIVIPDTRFQQVFQNALERE--RNKLYPDTTKQNTGTLVTESL-VIFKVILRDVILLPF 58
          + + IPD RF+Q F+NAL+RE  +NK Y      +T +    S  +I KV+LRDV+LLPF
Sbjct: 11 QKVSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKVVLRDVLLLPF 70

Query: 59 IQSVLWTEFLIVCKPRIYR 77
          +Q  LWT  LI  +P ++ 
Sbjct: 71 LQGALWTGVLIAMRPWLWH 89

>Ecym_4381 Chr4 complement(802807..803169) [363 bp, 120 aa] {ON}
          similar to Ashbya gossypii ADL119W
          Length = 120

 Score = 60.1 bits (144), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 50/83 (60%), Gaps = 11/83 (13%)

Query: 2  KTIVIPDTRFQQVFQNALERERNKLYPDTTKQNTGT---LVTE--------SLVIFKVIL 50
          K + IPD RF+Q F  AL++E  K +    ++  G+   +V+E        + V+ KVI+
Sbjct: 4  KPLAIPDIRFEQTFMVALKKEALKQHQYKIRKLKGSQDIVVSEDFGEPTITTFVVAKVIV 63

Query: 51 RDVILLPFIQSVLWTEFLIVCKP 73
          RDV+LLP +  +LWT FLI+ KP
Sbjct: 64 RDVVLLPLVHGMLWTGFLIMMKP 86

>NCAS0E01820 Chr5 complement(355133..355477) [345 bp, 114 aa] {ON}
          Anc_7.195
          Length = 114

 Score = 59.7 bits (143), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 49/75 (65%), Gaps = 8/75 (10%)

Query: 6  IPDTRFQQVFQNALERE------RNKL-YPDTTKQNTGTLVTESLVIFKVILRDVILLPF 58
          IPD R +Q F+ A+ +E      +NK  +P +T     T V ++++  KVILRD++++PF
Sbjct: 8  IPDLRVEQTFKRAVAKETKEYIIKNKATFPRSTITEL-TRVEKAVICSKVILRDILVMPF 66

Query: 59 IQSVLWTEFLIVCKP 73
          +QSV WT FLIV KP
Sbjct: 67 LQSVAWTGFLIVLKP 81

>TDEL0H02520 Chr8 complement(424797..425156) [360 bp, 119 aa] {ON}
          Anc_7.195 Scer_YGOB_ADL119W
          Length = 119

 Score = 57.0 bits (136), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 40/81 (49%), Gaps = 13/81 (16%)

Query: 6  IPDTRFQQVFQNALERERNKLYPDTTK-------------QNTGTLVTESLVIFKVILRD 52
          +PDTRF+Q F+ AL RE  K      +             Q         LV+ KV+LRD
Sbjct: 7  VPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVCKVVLRD 66

Query: 53 VILLPFIQSVLWTEFLIVCKP 73
          VI +P +Q +LWT  LI  KP
Sbjct: 67 VIFMPLVQGLLWTGVLIAMKP 87

>TPHA0C04520 Chr3 (975080..975487) [408 bp, 135 aa] {ON} Anc_7.195
           Scer_YGOB_ADL119W
          Length = 135

 Score = 56.2 bits (134), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 45/91 (49%), Gaps = 26/91 (28%)

Query: 2   KTIVIPDTRFQQVFQNALERERNKLYPDTTKQNTGTLVTESL------------------ 43
           +T+ +PD R +Q F NAL++E         KQ    L  E L                  
Sbjct: 21  ETLKVPDVRLEQSFNNALQKE-------AEKQRVAKLKKEGLDDSKILQIQKNEPATVTK 73

Query: 44  -VIFKVILRDVILLPFIQSVLWTEFLIVCKP 73
            +++KVILRD+IL+PFIQ  L+T  L+  KP
Sbjct: 74  YIVWKVILRDMILMPFIQGALFTGLLMAVKP 104

>SAKL0F07480g Chr6 (571315..571656) [342 bp, 113 aa] {ON}
          conserved hypothetical protein
          Length = 113

 Score = 53.5 bits (127), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 52/76 (68%), Gaps = 4/76 (5%)

Query: 1  MKTIVIPDTRFQQVFQNALERERNKLYP---DTTKQNTGTLVTESLVIFKVILRDVILLP 57
          ++TIV+PDTRF+Q F+NAL++E  ++       T  +    VT  +V+ KV++RDV+L+P
Sbjct: 9  IQTIVVPDTRFEQTFKNALKKEAKRMKAARLGITTLDDNAPVT-PMVVAKVVVRDVLLMP 67

Query: 58 FIQSVLWTEFLIVCKP 73
           +Q VLWT FLI  KP
Sbjct: 68 LVQGVLWTSFLIAIKP 83

>ZYRO0D15818g Chr4 (1321075..1321431) [357 bp, 118 aa] {ON}
          conserved hypothetical protein
          Length = 118

 Score = 53.1 bits (126), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 39/81 (48%), Gaps = 13/81 (16%)

Query: 6  IPDTRFQQVFQNALERERNKLYPDTTK-------------QNTGTLVTESLVIFKVILRD 52
          IPDTRF+  F+ AL RE  K      K             Q    +   S V+ KV+ RD
Sbjct: 7  IPDTRFESTFKRALNREAEKQRTLQWKKMGVEDPLVINQLQKNQPVKINSYVVCKVVARD 66

Query: 53 VILLPFIQSVLWTEFLIVCKP 73
          VI +P +Q +LWT  LI  KP
Sbjct: 67 VIFMPLVQGLLWTSLLITMKP 87

>KNAG0L01230 Chr12 (218769..219155) [387 bp, 128 aa] {ON}
          Anc_7.195 Scer_YGOB_ADL119W
          Length = 128

 Score = 51.2 bits (121), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 38/69 (55%), Gaps = 9/69 (13%)

Query: 4  IVIPDTRFQQVFQNALERERNKLYPDTTKQNTGTLVTESLVIFKVILRDVILLPFIQSVL 63
          I IP+ RF  VF NAL+ E         + N     T   ++ KV+ +DV+L+PF+QS L
Sbjct: 34 IKIPEMRFNYVFNNALKAE-------AARHNVAEPTT--WMVCKVVCKDVLLMPFLQSFL 84

Query: 64 WTEFLIVCK 72
          WT  LI  K
Sbjct: 85 WTALLISMK 93

>TBLA0J01510 Chr10 complement(344073..344396) [324 bp, 107 aa] {ON}
           Anc_7.195 Scer_YGOB_ADL119W
          Length = 107

 Score = 50.4 bits (119), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 49/95 (51%), Gaps = 1/95 (1%)

Query: 3   TIVIPDTRFQQVFQNALERERNKLYPDTTKQNTGTLVTESLVIFKVILRDVILLPFIQSV 62
            I IPDTRF+  F+  L++E NK   ++        V + L + KVI RDVI +PF+Q +
Sbjct: 9   VIPIPDTRFESTFRRKLDKELNKNNVNSNSIIKDERVRKLLCLGKVICRDVIFMPFVQGM 68

Query: 63  LWTEFLIVCKPRIYRGFKSIANFNIKNITNMLTGR 97
                 I+ KP + +  ++  N   +N   +  G+
Sbjct: 69  FMCGAFILIKPWLLKLLRNGKNIG-RNFVELFGGQ 102

>Kpol_1063.10 s1063 complement(28076..28444) [369 bp, 122 aa] {ON}
          complement(28076..28444) [369 nt, 123 aa]
          Length = 122

 Score = 49.7 bits (117), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 14/81 (17%)

Query: 6  IPDTRFQQVFQNAL--ERERNKLYP-----------DTTKQNTGTLVTESLVIFKVILRD 52
          +PD RF++ F  A+  E E+ + Y               K+N    VT + +++KVI+RD
Sbjct: 12 VPDVRFEETFNRAINKEAEKQREYSLKKKGLTTDEISKIKENEAPEVT-TYIVWKVIVRD 70

Query: 53 VILLPFIQSVLWTEFLIVCKP 73
          ++++PFIQ ++++  LI+ KP
Sbjct: 71 MLIMPFIQGIMFSGLLIILKP 91

>KLLA0D16192g Chr4 (1364216..1364581) [366 bp, 121 aa] {ON}
          conserved hypothetical protein
          Length = 121

 Score = 48.5 bits (114), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 3/71 (4%)

Query: 6  IPDTRFQQVFQNALERERNKLYPDTTKQNTGTLVTESL---VIFKVILRDVILLPFIQSV 62
          +PD RF+Q F+ +L +E  K    T     G++V   +   ++ KV+ RD+++ PF+Q V
Sbjct: 18 LPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVDPPITPYIVAKVVARDILISPFLQGV 77

Query: 63 LWTEFLIVCKP 73
            + F IV KP
Sbjct: 78 FLSLFYIVAKP 88

>Scer_YGOB_ADL119W Chr6 (226260..226550) [291 bp, 96 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 96

 Score = 47.4 bits (111), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 44/71 (61%), Gaps = 9/71 (12%)

Query: 2  KTIVIPDTRFQQVFQNALERERNKLYPDTTKQNTGTLVTESLVIFKVILRDVILLPFIQS 61
          K + IPD RF++VF+ AL RE   L P +      +L  ++ VI KV++RDV+L+P +QS
Sbjct: 11 KHLNIPDLRFEKVFKKALHRE---LAPSS------SLSRKAGVITKVVVRDVLLMPLLQS 61

Query: 62 VLWTEFLIVCK 72
           + +  L+  K
Sbjct: 62 FVLSLALMGVK 72

>ADL119W Chr4 (478065..478622) [558 bp, 185 aa] {ON} NOHBY409; No
           homolog in Saccharomyces cerevisiae
          Length = 185

 Score = 47.4 bits (111), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 2   KTIVIPDTRFQQVFQNALERERNK-----LYPDTTKQNTGTLVTESLVIFKVILRDVILL 56
           K I IPD RF+Q F+ AL +E  +        +      G     +LV+ KV++RDV+L+
Sbjct: 78  KAITIPDVRFEQTFRAALAKESARQRQLRAQKEGEAAADGEAGISALVVAKVVVRDVLLM 137

Query: 57  PFIQSVLWTEFLIVCKP 73
           P +Q  LWT  LI  KP
Sbjct: 138 PLVQGALWTGLLITMKP 154

>Skud_6.125 Chr6 (221029..221706) [678 bp, 225 aa] {ON}  (REAL)
          Length = 225

 Score = 44.7 bits (104), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 37/56 (66%), Gaps = 9/56 (16%)

Query: 6   IPDTRFQQVFQNALERERNKLYPDTTKQNTGTLVTESLVIFKVILRDVILLPFIQS 61
           IPD RF++VF+ AL RE   L P      + ++ ++  VI KV++RDV+L+P +QS
Sbjct: 144 IPDLRFEKVFKKALHRE---LAP------SSSVPSKWAVITKVVVRDVLLMPLLQS 190

>Suva_6.114 Chr6 (192307..193113) [807 bp, 268 aa] {ON}  (REAL)
          Length = 268

 Score = 28.9 bits (63), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 42/71 (59%), Gaps = 9/71 (12%)

Query: 2   KTIVIPDTRFQQVFQNALERERNKLYPDTTKQNTGTLVTESLVIFKVILRDVILLPFIQS 61
           K + IPD RF +VF+ AL R+   L P  ++        +  V+ KV++RDV+L+P +QS
Sbjct: 183 KQLNIPDLRFGKVFERALYRD---LTPSASRSR------KLAVVAKVVVRDVLLMPLVQS 233

Query: 62  VLWTEFLIVCK 72
           ++ +  LI  K
Sbjct: 234 IVLSVVLIGVK 244

>KNAG0K00460 Chr11 (77388..79508) [2121 bp, 706 aa] {ON} Anc_5.76
           YGR250C
          Length = 706

 Score = 28.1 bits (61), Expect = 3.9,   Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 22/35 (62%)

Query: 4   IVIPDTRFQQVFQNALERERNKLYPDTTKQNTGTL 38
           I + DTR+ Q F NAL  E+N++   ++ QN+  L
Sbjct: 624 IDVNDTRYNQKFLNALVHEQNQVMLMSSLQNSQGL 658

>CAGL0D00462g Chr4 (55305..57443) [2139 bp, 712 aa] {ON} weakly
           similar to uniprot|P34233 Saccharomyces cerevisiae
           YKL185w ASH1 negative regulator of HO transcription
          Length = 712

 Score = 28.1 bits (61), Expect = 4.0,   Method: Composition-based stats.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 5   VIPDTRFQQVFQNALERERNKLYPDTTKQN 34
           ++P  R  Q+  +   +E +KLYPDT K N
Sbjct: 212 ILPSLRHLQLLPDRSLQEHSKLYPDTAKIN 241

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.140    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,238,506
Number of extensions: 360185
Number of successful extensions: 1258
Number of sequences better than 10.0: 25
Number of HSP's gapped: 1239
Number of HSP's successfully gapped: 25
Length of query: 101
Length of database: 53,481,399
Length adjustment: 72
Effective length of query: 29
Effective length of database: 45,225,447
Effective search space: 1311537963
Effective search space used: 1311537963
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)