Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G010903.454ON45645622200.0
NCAS0E008603.454ON44037813530.0
KAFR0I019703.454ON41137311881e-161
ZYRO0C06270g3.454ON43037911851e-160
KNAG0B009503.454ON41836811451e-154
Suva_7.3953.454ON45138411421e-153
YGR110W (CLD1)3.454ON44538511381e-153
Smik_6.2003.454ON44538411311e-152
Skud_7.4153.454ON45238411191e-150
SAKL0B06116g3.454ON43137211161e-149
TDEL0F033903.454ON42437811031e-148
KLTH0E13948g3.454ON43837811021e-147
Ecym_24653.454ON43837511021e-147
Kpol_1035.93.454ON42737510961e-146
ABL019W3.454ON43137510901e-145
TPHA0O013103.454ON43837310681e-142
Kwal_27.123173.454ON43537210371e-137
CAGL0L04686g3.454ON4513989761e-128
KLLA0B12914g3.454ON4263689041e-117
TBLA0F034603.454ON4413928271e-106
KLTH0C01254gna 1ON4344174862e-55
Kwal_14.985na 1ON4354074495e-50
Ecym_5577singletonON4334054215e-46
SAKL0G19074gna 1ON4323993401e-34
NCAS0B051208.284ON3963401971e-15
NDAI0J012108.284ON4163461909e-15
Kwal_56.237028.284ON4163391827e-14
KNAG0G021408.284ON4083391792e-13
CAGL0B01969g8.284ON4233241792e-13
AGR062C8.284ON3843201782e-13
SAKL0H16500g8.284ON4193371748e-13
Suva_10.1838.284ON3943341721e-12
NCAS0B037108.284ON4303231712e-12
Skud_4.3868.284ON4463381703e-12
KNAG0H031208.284ON4343351703e-12
TDEL0F041008.284ON4343331703e-12
KAFR0B053808.284ON4113361693e-12
ZYRO0D06666g8.284ON3803471685e-12
Suva_2.2888.284ON4353351642e-11
YLR099C (ICT1)8.284ON3943341595e-11
NDAI0J01200singletonON4273271605e-11
KLLA0F19624g8.284ON4093361595e-11
Smik_4.3718.284ON4353351597e-11
YDR125C (ECM18)8.284ON4533471598e-11
Smik_12.1588.284ON3943251588e-11
KAFR0B028308.284ON3913421561e-10
Skud_12.1678.284ON3943341561e-10
KLTH0G13178g8.284ON4153481516e-10
Kpol_543.498.284ON4293481482e-09
TPHA0A016908.284ON4053741355e-08
CAGL0M11462g8.284ON3862621355e-08
Ecym_42858.284ON4052551275e-07
TPHA0L016008.524ON3721671105e-05
TBLA0H014008.284ON4211791062e-04
SAKL0H10450g8.524ON3921761053e-04
KNAG0A037708.524ON3561721043e-04
NDAI0C054308.524ON3621401018e-04
KLTH0E12188g8.524ON336128960.003
TDEL0B032508.524ON348130960.003
Kwal_23.6592singletonON164113880.011
Kwal_48.19391singletonON183123880.013
Kwal_43.16490singletonON286123900.014
Kwal_26.9628singletonON254123890.014
Kwal_26.6639singletonON303123880.025
TDEL0G00150singletonON299111880.027
Kwal_27.10170na 2ON29357870.033
NCAS0B022608.524ON363154870.041
ZYRO0F09064g8.524ON349124850.059
CAGL0M05467g8.524ON354141810.20
YNR064Cna 3ON290110800.23
CAGL0J08547g5.693ON379127800.26
Skud_14.400na 3ON29351780.42
Kwal_27.119758.524ON336107760.78
Kwal_26.9638singletonOFF12178711.2
Suva_14.424na 3ON28951731.9
SAKL0E14674g5.693ON377152731.9
Skud_4.1752.390ON620206723.1
SAKL0F07744g7.204ON52664713.7
SAKL0E14564g5.690ON89443714.5
KLLA0A10395gna 2ON29451694.6
Suva_4.1672.390ON620134696.3
YDL080C (THI3)2.390ON609202697.1
Smik_4.1562.390ON621202688.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G01090
         (456 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454    859   0.0  
NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454    525   0.0  
KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON}              462   e-161
ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} simila...   461   e-160
KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.4...   445   e-154
Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W ...   444   e-153
YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}  CLD1Mitoch...   442   e-153
Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W ...   440   e-152
Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W ...   435   e-150
SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {...   434   e-149
TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.4...   429   e-148
KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]...   429   e-147
Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}...   429   e-147
Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON...   426   e-146
ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-synteni...   424   e-145
TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {...   416   e-142
Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]...   404   e-137
CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} simil...   380   e-128
KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} simi...   352   e-117
TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON}              323   e-106
KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {...   191   2e-55
Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON...   177   5e-50
Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar...   166   5e-46
SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON} cons...   135   1e-34
NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {O...    80   1e-15
NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8....    78   9e-15
Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {...    75   7e-14
KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {O...    74   2e-13
CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {...    74   2e-13
AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON} S...    73   2e-13
SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} simi...    72   8e-13
Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {...    71   1e-12
NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284     70   2e-12
Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON...    70   3e-12
KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.2...    70   3e-12
TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {O...    70   3e-12
KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON} Anc_8...    70   3e-12
ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} simila...    69   5e-12
Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON...    68   2e-11
YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON} ...    66   5e-11
NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON}              66   5e-11
KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]...    66   5e-11
Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON...    66   7e-11
YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}  ...    66   8e-11
Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {...    65   8e-11
KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {O...    65   1e-10
Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {...    65   1e-10
KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} simi...    63   6e-10
Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {O...    62   2e-09
TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.2...    57   5e-08
CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa...    57   5e-08
Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar t...    54   5e-07
TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8....    47   5e-05
TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.2...    45   2e-04
SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {...    45   3e-04
KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {O...    45   3e-04
NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON} Anc_8...    44   8e-04
KLTH0E12188g Chr5 (1082142..1083152) [1011 bp, 336 aa] {ON} simi...    42   0.003
TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {O...    42   0.003
Kwal_23.6592 s23 (1658078..1658572) [495 bp, 164 aa] {ON} [conti...    39   0.011
Kwal_48.19391 s48 (3319..3870) [552 bp, 183 aa] {ON} YNR064C - H...    39   0.013
Kwal_43.16490 s43 (51..911) [861 bp, 286 aa] {ON} YNR064C - Hypo...    39   0.014
Kwal_26.9628 s26 (1300688..1301449) [762 bp, 254 aa] {ON} YNR064...    39   0.014
Kwal_26.6639 s26 complement(252..1163) [912 bp, 303 aa] {ON} YNR...    39   0.025
TDEL0G00150 Chr7 complement(22315..23214) [900 bp, 299 aa] {ON}        39   0.027
Kwal_27.10170 s27 complement(227197..228078) [882 bp, 293 aa] {O...    38   0.033
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    38   0.041
ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} simila...    37   0.059
CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa] ...    36   0.20 
YNR064C Chr14 complement(749136..750008) [873 bp, 290 aa] {ON} E...    35   0.23 
CAGL0J08547g Chr10 (846742..847881) [1140 bp, 379 aa] {ON} simil...    35   0.26 
Skud_14.400 Chr14 complement(717609..718490) [882 bp, 293 aa] {O...    35   0.42 
Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR2...    34   0.78 
Kwal_26.9638 s26 (1304546..1304911) [366 bp, 121 aa] {OFF} YNR06...    32   1.2  
Suva_14.424 Chr14 complement(736902..737771) [870 bp, 289 aa] {O...    33   1.9  
SAKL0E14674g Chr5 (1211477..1212610) [1134 bp, 377 aa] {ON} simi...    33   1.9  
Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON...    32   3.1  
SAKL0F07744g Chr6 complement(592416..593996) [1581 bp, 526 aa] {...    32   3.7  
SAKL0E14564g Chr5 complement(1201558..1204242) [2685 bp, 894 aa]...    32   4.5  
KLLA0A10395g Chr1 complement(908097..908981) [885 bp, 294 aa] {O...    31   4.6  
Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON...    31   6.3  
YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}  ...    31   7.1  
Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON...    31   8.0  

>NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454
          Length = 456

 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/456 (92%), Positives = 420/456 (92%)

Query: 1   MWKKVTLSREIIKTSITKLIKRDRKLQTPQTSPQIFQNKEGNESKRXXXXXXXXXXXXXX 60
           MWKKVTLSREIIKTSITKLIKRDRKLQTPQTSPQIFQNKEGNESKR              
Sbjct: 1   MWKKVTLSREIIKTSITKLIKRDRKLQTPQTSPQIFQNKEGNESKRSTTTTTTILSSPAT 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXSLPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFF 120
                                 SLPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFF
Sbjct: 61  TTKINTIAPTPPTAIPLLRIITSLPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFF 120

Query: 121 SNGAKFKTGKILKTQIEDNDDYYINEFCITPDTNININSADVKHLIFIHGYGAGLGFFIK 180
           SNGAKFKTGKILKTQIEDNDDYYINEFCITPDTNININSADVKHLIFIHGYGAGLGFFIK
Sbjct: 121 SNGAKFKTGKILKTQIEDNDDYYINEFCITPDTNININSADVKHLIFIHGYGAGLGFFIK 180

Query: 181 NLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNL 240
           NLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNL
Sbjct: 181 NLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNL 240

Query: 241 LNYPKNNLIVAHSLGAYLMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKL 300
           LNYPKNNLIVAHSLGAYLMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKL
Sbjct: 241 LNYPKNNLIVAHSLGAYLMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKL 300

Query: 301 WDLNFSPFSIVRNSGIYGSKITSAWSYRRFKPLDLDHKQFEALHRYAYSIFNRPGCGEYL 360
           WDLNFSPFSIVRNSGIYGSKITSAWSYRRFKPLDLDHKQFEALHRYAYSIFNRPGCGEYL
Sbjct: 301 WDLNFSPFSIVRNSGIYGSKITSAWSYRRFKPLDLDHKQFEALHRYAYSIFNRPGCGEYL 360

Query: 361 LSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQKG 420
           LSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQKG
Sbjct: 361 LSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQKG 420

Query: 421 KSDVHVIPSAGHHLYLDNYKDFNKLLIKEMEMFGER 456
           KSDVHVIPSAGHHLYLDNYKDFNKLLIKEMEMFGER
Sbjct: 421 KSDVHVIPSAGHHLYLDNYKDFNKLLIKEMEMFGER 456

>NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454
          Length = 440

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/378 (66%), Positives = 300/378 (79%), Gaps = 8/378 (2%)

Query: 83  SLPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFKTGKILKTQIEDNDDY 142
           SLP LFPRS+  S +DY  F  D + LQ++LLKTLPFF  G+  K  K+++T I+D  +Y
Sbjct: 65  SLPSLFPRSLHDSRRDYNTFTTDIDSLQLNLLKTLPFFPMGSSQKVAKLIRTPIDDEGNY 124

Query: 143 YINEFCITPDT-NININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPG 201
            INEFCI P   + + +S D+KHLIFIHGYGAGLGFF+KNLENIPLL+N+WCIHAIDLPG
Sbjct: 125 -INEFCIMPAVKDGDYSSPDLKHLIFIHGYGAGLGFFLKNLENIPLLDNKWCIHAIDLPG 183

Query: 202 YGYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQ 261
           YG+S+R  KFPF YP DSQ KVQ WFHD+I+ W ++RNLL  P+NNL++AHSLGAYLMA 
Sbjct: 184 YGFSSR-FKFPFHYPNDSQTKVQKWFHDRIYRWFRERNLLQNPQNNLVMAHSLGAYLMAH 242

Query: 262 YAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFSPFSIVRNSGIYGSKI 321
           YAF F +HF+K+IMCSPAGV++ ++ K N  PPWWY KLWDLN+SPFS+VRNSGIYGSKI
Sbjct: 243 YAFHFSNHFKKIIMCSPAGVSQFAVGKQNKQPPWWYNKLWDLNYSPFSLVRNSGIYGSKI 302

Query: 322 TSAWSYRRFKPLD---LDHKQFEALHRYAYSIFNRPGCGEYLLSFILSCGGNPRFSLEDT 378
           TS WSYRRFKP     L+  QFEALH+Y Y IFN+ G GEYLLSFILSCGG+PRF+LED 
Sbjct: 303 TSGWSYRRFKPTSFNGLNESQFEALHKYTYGIFNKNGSGEYLLSFILSCGGDPRFALEDN 362

Query: 379 LFQRENLSTELCDWGWIYGDNDWMDINGAKRVSRLINEQ--QKGKSDVHVIPSAGHHLYL 436
           LF+ EN   +LCDW W+YGD DWMDINGA R+SR + ++     KS VHVIPSAGHHLYL
Sbjct: 363 LFKEENPPEDLCDWVWVYGDRDWMDINGAHRISRRLVKKAGDTSKSKVHVIPSAGHHLYL 422

Query: 437 DNYKDFNKLLIKEMEMFG 454
           DNYK FN L+IKEME  G
Sbjct: 423 DNYKAFNNLIIKEMETMG 440

>KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON} 
          Length = 411

 Score =  462 bits (1188), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 221/373 (59%), Positives = 281/373 (75%), Gaps = 14/373 (3%)

Query: 84  LPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFKTGKILKTQIEDNDDYY 143
           LP+LFPRSI +S +DY+++++ PER+Q DLL TLPF+ N +K K  +I+KT + D +  Y
Sbjct: 46  LPRLFPRSIDESFKDYRVYKEGPERMQEDLLSTLPFYPNVSKDKVARIIKTVV-DEEGNY 104

Query: 144 INEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYG 203
           INEFCITP   +N  S  +KHLIFIHGYGAG GFF+KNLE+IPLL+N WCIHAIDLPG+G
Sbjct: 105 INEFCITPKNTVN--SQKLKHLIFIHGYGAGFGFFLKNLESIPLLDNNWCIHAIDLPGFG 162

Query: 204 YSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYA 263
           +S+R K FPFKYP  +  +V  WFH++I  WL++R LL+ PKNN+IVAHSLGAYLMA Y 
Sbjct: 163 FSSR-KNFPFKYPTSNTSEVTAWFHERIRRWLEERTLLDNPKNNVIVAHSLGAYLMALYT 221

Query: 264 FKFPSHFQKLIMCSPAGVTKSSIKKLNNS-----PPWWYEKLWDLNFSPFSIVRNSGIYG 318
             +P+H +KLIMCSPAGV+KS     NNS     PPWWY KLWD+N SPF++VR S   G
Sbjct: 222 QVYPAHLRKLIMCSPAGVSKSQ----NNSKAVLQPPWWYAKLWDMNLSPFTLVRLSKHLG 277

Query: 319 SKITSAWSYRRFKPLDLDHKQFEALHRYAYSIFNRPGCGEYLLSFILSCGGNPRFSLEDT 378
           SK+TS WSYRRFK ++ +  QFE LHRY+Y+IFN+PG GEYLL FIL CGGNPR SLEDT
Sbjct: 278 SKLTSGWSYRRFKLIE-NRMQFEMLHRYSYAIFNQPGSGEYLLGFILECGGNPRCSLEDT 336

Query: 379 LFQRENLSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQKGKSDVHVIPSAGHHLYLDN 438
           LF      +   +W WIYG+NDWMDI G +RV  L+ E+    S  +++P+AGHHLYLDN
Sbjct: 337 LFSNNFNVSSKVEWAWIYGENDWMDIEGGRRVHNLLLEKFNRDSKFYMVPNAGHHLYLDN 396

Query: 439 YKDFNKLLIKEME 451
            + FN ++++ ME
Sbjct: 397 IRYFNNIIVQHME 409

>ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
           Hypothetical ORF
          Length = 430

 Score =  461 bits (1185), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 224/379 (59%), Positives = 278/379 (73%), Gaps = 14/379 (3%)

Query: 84  LPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFKTGKILKTQIEDNDDYY 143
           LPKLFPRS+  S +DYK F     +LQ +LL+TLPF+   A+ K  +++KT ++D  +Y 
Sbjct: 53  LPKLFPRSVDASTRDYKDFCYHTGQLQEELLRTLPFYPYCAESKKAEVVKTTVDDQGNY- 111

Query: 144 INEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYG 203
           INEFCITP    ++ S  +KHLI IHGYGAGLGFF+KNLE IPLL+N W IHAIDLPGYG
Sbjct: 112 INEFCITP-VKPSVPSHKMKHLICIHGYGAGLGFFLKNLEGIPLLDNSWVIHAIDLPGYG 170

Query: 204 YSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYA 263
           +S+R  KFPFKYP+DS  +V +WFHD+IH W +KR LL   +NNL++AHSLGAYLMA Y 
Sbjct: 171 FSSR-PKFPFKYPKDSLSQVHSWFHDRIHTWFKKRGLLVNSQNNLVMAHSLGAYLMALYT 229

Query: 264 FKFPSHFQKLIMCSPAGVTKSSIKK--LNNSPPWWYEKLWDLNFSPFSIVRNSGIYGSKI 321
            K+ +HF+KL+MCSPAGV KS+  K   N +PPWWY KLWDLN SPF +VRN+   GS +
Sbjct: 230 TKYTTHFKKLVMCSPAGVCKSTTAKNIGNTTPPWWYTKLWDLNISPFCLVRNAAALGSMV 289

Query: 322 TSAWSYRRFKPL-------DLDHKQFEALHRYAYSIFNRPGCGEYLLSFILSCGGNPRFS 374
           TS WSYRRF  L       +LD  QFEALHRYAY+IFNR G GEYLLSF LSCGG+PR  
Sbjct: 290 TSGWSYRRFNKLLQSNSNTNLDRLQFEALHRYAYAIFNRRGSGEYLLSFALSCGGDPRLP 349

Query: 375 LEDTLF--QRENLSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQKGKSDVHVIPSAGH 432
           LEDT+F  +   +    C+W WIYG+ DWMD+NG +RVSR I  Q   KS VHV P++GH
Sbjct: 350 LEDTIFKDKTSGIFRSNCEWIWIYGERDWMDVNGGERVSRFIENQGGRKSQVHVAPNSGH 409

Query: 433 HLYLDNYKDFNKLLIKEME 451
           HLY DN+K FN  ++K+M+
Sbjct: 410 HLYFDNHKFFNSFIVKQMK 428

>KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.454
           YGR110W
          Length = 418

 Score =  445 bits (1145), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 219/368 (59%), Positives = 267/368 (72%), Gaps = 8/368 (2%)

Query: 84  LPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFKTGKILKTQIEDNDDYY 143
           LP LFPR + QS++DYK+F  + +++Q DLL TLPFF      K  +I++T+I D DD +
Sbjct: 55  LPYLFPRGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKDGKRAEIVRTKI-DEDDNF 113

Query: 144 INEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYG 203
           INEF I P  N+    + +KHLIFIHGYGAGLGFF+KN ENI L +N WCIHAIDLPG+G
Sbjct: 114 INEFFIQP-ANVT-EPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFG 171

Query: 204 YSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYA 263
           +S+R K FPFKYP D   KVQ WFH+++ IW +KR+LL  P NN++VAHSLGAYLMA Y 
Sbjct: 172 FSSRTK-FPFKYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYK 230

Query: 264 FKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFSPFSIVRNSGIYGSKITS 323
              P HF+KLIMCSPAG+  S++ K    PPWWY  LWD+N SPFS+VRNSG  GSK+TS
Sbjct: 231 RNNPLHFKKLIMCSPAGMCNSTVVK--KQPPWWYAALWDMNLSPFSLVRNSGWLGSKLTS 288

Query: 324 AWSYRRFKPLDLDHKQFEALHRYAYSIFNRPGCGEYLLSFILSCGGNPRFSLEDTLFQR- 382
            WSYRRF+ L     QFE LH Y+Y+IFNRPGCGEYLL+F L CGG+PR SLE TLF   
Sbjct: 289 GWSYRRFRSLH-SKIQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFNDV 347

Query: 383 ENLSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQKGKSDVHVIPSAGHHLYLDNYKDF 442
            N      +W W+YGD DWMD+ G +R+S+ INE   GKS V VIP+AGHHLY DN   F
Sbjct: 348 VNKWDSDSEWVWLYGDRDWMDVKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCF 407

Query: 443 NKLLIKEM 450
           N +L KEM
Sbjct: 408 NAILEKEM 415

>Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W
           (REAL)
          Length = 451

 Score =  444 bits (1142), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 222/384 (57%), Positives = 282/384 (73%), Gaps = 20/384 (5%)

Query: 84  LPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFKTGKILKTQIEDNDDYY 143
           +P LFPR ++ S++D++ F K+ +  Q +LL TLPF+ N +  K  K++KT I D+D  Y
Sbjct: 70  VPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATLPFYPNPSTTKKSKLIKT-IVDDDGNY 128

Query: 144 INEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYG 203
           INEFCI P    ++  AD+KHL+FIHGYGAGLGFFIKN E+IPLLNN WC+HAIDLPGYG
Sbjct: 129 INEFCIYPQVP-SVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYG 187

Query: 204 YSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYA 263
           +S+R  KFPFKYPRD    VQ+WFH++IH W +KRNLLN P+ N+++AHSLG+YLMA Y 
Sbjct: 188 FSSR-PKFPFKYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMALYL 246

Query: 264 FKF---PSHFQKLIMCSPAGVTKSSIKKLNNS------PPWWYEKLWDLNFSPFSIVRNS 314
            K+   PS F+KLI+CSPAGV+       N+       PPWWY KLWD N SPF++VRNS
Sbjct: 247 QKYEGSPS-FKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFTLVRNS 305

Query: 315 GIYGSKITSAWSYRRFKPL---DLDH-KQFEALHRYAYSIFNRPGCGEYLLSFILSCGGN 370
             +GSKITS WSYRRFK +   D D  K+FEALHRYAYSIFN+ G GEYLLSF L CGG 
Sbjct: 306 RQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKRGSGEYLLSFALKCGGE 365

Query: 371 PRFSLEDTLFQREN---LSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQKGKSDVHVI 427
           PR  LE+ LF  +N   L     +W W+YGD+DWMD+NG  RVS+L+N++ K KS V  +
Sbjct: 366 PRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGGLRVSKLLNDKLKQKSSVITV 425

Query: 428 PSAGHHLYLDNYKDFNKLLIKEME 451
           P+AGHHLYLDN+K FN +++ EM+
Sbjct: 426 PNAGHHLYLDNHKFFNTIIMNEMQ 449

>YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}
           CLD1Mitochondrial cardiolipin-specific phospholipase;
           functions upstream of Taz1p to generate
           monolyso-cardiolipin; transcription increases upon
           genotoxic stress; involved in restricting Ty1
           transposition; has homology to mammalian CGI-58
          Length = 445

 Score =  442 bits (1138), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 220/385 (57%), Positives = 282/385 (73%), Gaps = 22/385 (5%)

Query: 84  LPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFKTGKILKTQIEDNDDYY 143
           +P LFPR ++ S++D++ F K+ +  Q +LLKTLPF+   ++ KT ++++T ++D  +Y 
Sbjct: 64  VPSLFPRPLEDSVKDFRDFIKNEDAFQTELLKTLPFYPTPSESKTARLIRTVVDDEGNY- 122

Query: 144 INEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYG 203
           INEFCI P    ++  AD+KHL+FIHGYGAGLGFFIKN E+IPLL+N WCIHAIDLPGYG
Sbjct: 123 INEFCIRP-RKTSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLDNEWCIHAIDLPGYG 181

Query: 204 YSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYA 263
           +S+R  KFPF+YPRD+   VQ+WFH++IH W  KRNLLN P+ N+++AHSLG+YLMA Y 
Sbjct: 182 FSSR-PKFPFEYPRDNIHSVQDWFHERIHTWFSKRNLLNRPEKNIVMAHSLGSYLMALYL 240

Query: 264 FKF---PSHFQKLIMCSPAGV-------TKSSIKKLNNSPPWWYEKLWDLNFSPFSIVRN 313
            K+   PS F+KLI+CSPAGV       T S ++K    PPWWY KLWD N SPF++VRN
Sbjct: 241 QKYKESPS-FKKLILCSPAGVSYRDFNNTASEVEKW-KPPPWWYVKLWDRNISPFTLVRN 298

Query: 314 SGIYGSKITSAWSYRRFKPL----DLDHKQFEALHRYAYSIFNRPGCGEYLLSFILSCGG 369
               GSKITS WSYRRFK +        K+FEALHRYAY+IFN+ G GEYLLSF L CGG
Sbjct: 299 FRQLGSKITSGWSYRRFKHILNGDPEQSKRFEALHRYAYAIFNKRGSGEYLLSFALKCGG 358

Query: 370 NPRFSLEDTLF---QRENLSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQKGKSDVHV 426
            PR SLE  LF   + + L    CDW W+YGD+DWMD+NG  RVSR + E+ K KS+V +
Sbjct: 359 EPRLSLEQQLFDGKKSDILKNSNCDWLWLYGDDDWMDVNGGLRVSRFLKEKLKQKSNVII 418

Query: 427 IPSAGHHLYLDNYKDFNKLLIKEME 451
           +P +GHHLYLDNYK FN +L KEM+
Sbjct: 419 VPHSGHHLYLDNYKFFNNILTKEMQ 443

>Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W
           (REAL)
          Length = 445

 Score =  440 bits (1131), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 223/384 (58%), Positives = 281/384 (73%), Gaps = 22/384 (5%)

Query: 84  LPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFKTGKILKTQIEDNDDYY 143
           +P LFPR +  S++D++ F K  +  Q +LLKTLPF+ N +K K  ++++T ++D D  Y
Sbjct: 64  VPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSKLKKSRVIRTVVDD-DGNY 122

Query: 144 INEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYG 203
           INEFCI P  N ++   ++KHLIFIHGYGAGLGFFIKN E+IPLLNN WC+HAIDLPGYG
Sbjct: 123 INEFCIRP-INPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYG 181

Query: 204 YSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYA 263
           +S+R  KFPF+YPRD+   VQ+WFH ++H W  KRNLLN P  N+++AHSLG+YLMA Y 
Sbjct: 182 FSSR-PKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYV 240

Query: 264 FKF---PSHFQKLIMCSPAGV-------TKSSIKKLNNSPPWWYEKLWDLNFSPFSIVRN 313
            K+   PS F+KLI+CSPAGV       T S  +K    PPWWY KLWD N SPF++VRN
Sbjct: 241 QKYKERPS-FKKLILCSPAGVSHRDSNNTTSEAEKW-KPPPWWYVKLWDRNISPFTLVRN 298

Query: 314 SGIYGSKITSAWSYRRFKP-LDLDHKQ---FEALHRYAYSIFNRPGCGEYLLSFILSCGG 369
           S  +GSKITS WSYRRFK  L+ D KQ   FEALHRYAYSIFN+ G GEYLLSF L CGG
Sbjct: 299 SRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNKRGSGEYLLSFALKCGG 358

Query: 370 NPRFSLEDTLFQRENLS---TELCDWGWIYGDNDWMDINGAKRVSRLINEQQKGKSDVHV 426
            PR  LE+ LF   NL+   +   +W W+YGD+DWMD+NG  RVS+ +NE+ + KS+V +
Sbjct: 359 EPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNEKLRQKSNVII 418

Query: 427 IPSAGHHLYLDNYKDFNKLLIKEM 450
           +P AGHHLYLDN K FN +L+KEM
Sbjct: 419 VPHAGHHLYLDNSKFFNDILVKEM 442

>Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W
           (REAL)
          Length = 452

 Score =  435 bits (1119), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 214/384 (55%), Positives = 279/384 (72%), Gaps = 20/384 (5%)

Query: 84  LPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFKTGKILKTQIEDNDDYY 143
           +P LFPR ++ S++D++ F K+ +  Q +LL+TLPF+ N +K+K  K++KT ++D D  Y
Sbjct: 70  VPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSKYKKSKLIKTVVDD-DGNY 128

Query: 144 INEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYG 203
           INEFCI P    ++   ++KHL+FIHGYGAGLGFFIKNLE+IPLL+N WCIHAIDLPGYG
Sbjct: 129 INEFCIYPQKP-SVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYG 187

Query: 204 YSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYA 263
           +S+R  KFPF+YP+D+   VQ+WFH++IH W  KRNLL+ P  N++VAHSLG+YLMA Y 
Sbjct: 188 FSSR-PKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYL 246

Query: 264 FKF---PSHFQKLIMCSPAGVTKSSIKKLN------NSPPWWYEKLWDLNFSPFSIVRNS 314
            K+   PS F+KL++CSPAGV+                PPWWY KLWD N SPF++VRN+
Sbjct: 247 QKYKESPS-FKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPFTLVRNA 305

Query: 315 GIYGSKITSAWSYRRFKPL----DLDHKQFEALHRYAYSIFNRPGCGEYLLSFILSCGGN 370
              GSKITS WSYRRFK +        ++FEALHRYAYSIFN+ G GEYLLSF L CGG 
Sbjct: 306 RQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGSGEYLLSFALRCGGE 365

Query: 371 PRFSLEDTLFQREN---LSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQKGKSDVHVI 427
           PR  LE+ LF  EN   L     +W W+YG++DWMD++G  RVS+ +NE+   KS+V ++
Sbjct: 366 PRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLGQKSNVFIV 425

Query: 428 PSAGHHLYLDNYKDFNKLLIKEME 451
           P AGHHLYLDNY  FNK+L+KEM+
Sbjct: 426 PHAGHHLYLDNYTFFNKILVKEMQ 449

>SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {ON}
           similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 431

 Score =  434 bits (1116), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 215/372 (57%), Positives = 268/372 (72%), Gaps = 11/372 (2%)

Query: 84  LPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFKTGKILKTQIEDNDDYY 143
           LP LFP S + SI+DY +FQ++ E  Q  LL TLPF+ + A  ++ +ILKT ++D  +Y 
Sbjct: 63  LPNLFPLSFEASIRDYSMFQENAESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGNY- 121

Query: 144 INEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYG 203
           INEF I P    +  S+ +KHLIF+HGYGAGLGFF+KN ENIPLLNN WCIHAIDLPGYG
Sbjct: 122 INEFTIKPMNPSS--SSSMKHLIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYG 179

Query: 204 YSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYA 263
           +S+R  KFPF YP  + + V++WFH +I  WL KR LL  PKNNL+VAHSLGAY+ A YA
Sbjct: 180 FSSR-PKFPFNYPEHNPIMVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYA 238

Query: 264 FKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFSPFSIVRNSGIYGSKITS 323
            KFP+HF KLIMCSPAG+  S   KL  +PP W+ KLWD N SPFS+VRNS   GSK+TS
Sbjct: 239 NKFPNHFSKLIMCSPAGICPSP--KLGQAPPQWFVKLWDRNISPFSLVRNSFHLGSKLTS 296

Query: 324 AWSYRRFKPL----DLDHKQFEALHRYAYSIFNRPGCGEYLLSFILSCGGNPRFSLEDTL 379
            W+YRRF+         ++Q +A+H+Y Y+IFN+PG GEYLLSF L CGG+PR  LE  L
Sbjct: 297 GWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRL 356

Query: 380 FQRENLSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQKGKSDVHVIPSAGHHLYLDNY 439
           F   +     CDW W+YGD DWMD+ G +R S  + ++   KSDV V+PSAGHHLYLDNY
Sbjct: 357 FDNTSSFKANCDWLWLYGDEDWMDLRGGQRASEFL-KKIGMKSDVKVVPSAGHHLYLDNY 415

Query: 440 KDFNKLLIKEME 451
           K FN ++IKEME
Sbjct: 416 KHFNNVVIKEME 427

>TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.454
           YGR110W
          Length = 424

 Score =  429 bits (1103), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 209/378 (55%), Positives = 271/378 (71%), Gaps = 14/378 (3%)

Query: 84  LPKLFPRSIKQSIQDYK-IFQKDPERLQIDLLKTLPFFSNGAKFKTGKILKTQIEDNDDY 142
           LP LFPRS   S++DY+ + +   E+ Q DLL TLPF+  G   +  ++++T+++D  +Y
Sbjct: 49  LPSLFPRSFGDSVRDYRDLCRHTDEKFQRDLLATLPFYGEGDLHRRSEVIRTKVDDEGNY 108

Query: 143 YINEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGY 202
            INEF I P  N ++    +KHL+FIHGYGAGLGFF+KN ENIPLLNN WCIHAIDLPGY
Sbjct: 109 -INEFYIMP-KNASVPRDRLKHLVFIHGYGAGLGFFLKNFENIPLLNNEWCIHAIDLPGY 166

Query: 203 GYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQY 262
           G+S+R K FPF+YP+D+   V  WFH +++ W  +RNLL  P+NN+++AHSLGAYLMA Y
Sbjct: 167 GFSSRCK-FPFQYPKDTVTDVHEWFHKRLNRWFAERNLLRNPENNIVMAHSLGAYLMALY 225

Query: 263 AFKFPSHFQKLIMCSPAGVTKSSIKKL--NNSPPWWYEKLWDLNFSPFSIVRNSGIYGSK 320
           A K  SHF+KL+MCSPAG+ +S+  K   N  PPWWY KLWD N SPFS+VR S   GSK
Sbjct: 226 ASKNSSHFKKLVMCSPAGICESTTTKAIGNRKPPWWYSKLWDRNISPFSLVRVSSRLGSK 285

Query: 321 ITSAWSYRRFKPL-----DLDHKQFEALHRYAYSIFNRPGCGEYLLSFILSCGGNPRFSL 375
           +TS WSY+RF  L         +QFEALH+Y YSIFN+PGCGEYLLSF L CGG+PR  L
Sbjct: 286 LTSGWSYKRFGKLLRSKSRKSEQQFEALHKYCYSIFNKPGCGEYLLSFALRCGGDPRIPL 345

Query: 376 EDTLFQREN--LSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQKGKSDVHVIPSAGHH 433
           ED LF+  +  +     +W W+YG+ DWMD NG KRVS  + +  + KS+V ++P+AGHH
Sbjct: 346 EDMLFKTNDSGIMNGNLEWLWLYGERDWMDFNGGKRVSEHLKKSGQ-KSEVCIVPNAGHH 404

Query: 434 LYLDNYKDFNKLLIKEME 451
           LY DNY  FN L+I+EM+
Sbjct: 405 LYFDNYDYFNSLIIREMK 422

>KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]
           {ON} similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 438

 Score =  429 bits (1102), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 202/378 (53%), Positives = 270/378 (71%), Gaps = 9/378 (2%)

Query: 83  SLPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFKTGKILKTQIEDNDDY 142
           +LP+LFPRS+K+S++DY  F+KD   LQ  LL TLPFF      K  ++++T +++  +Y
Sbjct: 65  NLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDKVAEVVQTPVDEQANY 124

Query: 143 YINEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGY 202
            INEFC+ P   +   S  ++HLI +HGYGAGLGFF+KNLE + L++NRW IHAIDLPGY
Sbjct: 125 -INEFCVRPA--MPHPSGTLRHLIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGY 181

Query: 203 GYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQY 262
           G+S+R  KFP+KY  D   +V++WFH +   WL+KR LL +P+ N++VAHS+GAYL A Y
Sbjct: 182 GFSSR-PKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALY 240

Query: 263 AFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFSPFSIVRNSGIYGSKIT 322
           A K+P+HF+KL+MCSPAG+  +   K    PPWW+ KLWD N SPFS+VRNS + GSK+T
Sbjct: 241 ANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWFAKLWDRNISPFSLVRNSRLLGSKLT 300

Query: 323 SAWSYRRFKPLDLD----HKQFEALHRYAYSIFNRPGCGEYLLSFILSCGGNPRFSLEDT 378
           S WSYRRF  L  +     +QFEA+H+YAY+IFN PG GEYLLSF L CGG+PR +LE  
Sbjct: 301 SGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDPRDALERR 360

Query: 379 LFQ-RENLSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQKGKSDVHVIPSAGHHLYLD 437
           LF  + N     C+W W+YGD DWMD+ G +RVS  +N     KS V V+  +GHHLY D
Sbjct: 361 LFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKKSKVEVVHDSGHHLYFD 420

Query: 438 NYKDFNKLLIKEMEMFGE 455
           NY+ FN++L KEM+M+ +
Sbjct: 421 NYEQFNRILEKEMKMWDQ 438

>Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}
           similar to Ashbya gossypii ABL019W
          Length = 438

 Score =  429 bits (1102), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 209/375 (55%), Positives = 265/375 (70%), Gaps = 11/375 (2%)

Query: 83  SLPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFKTGKILKTQIEDNDDY 142
           ++P LFP  +K+S +DYKIF  D ++ Q  LL TLPFF + A  K G+I++T + D +  
Sbjct: 57  NIPSLFPMPLKESWKDYKIFHDDVDKFQTGLLSTLPFFPSAADGKIGEIIRTPV-DEEGN 115

Query: 143 YINEFCITPDTN-ININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPG 201
           YINEFCI P++  +N   + + HLIF+HGYGAGLGFF+KN ENI LLNN W IHAID PG
Sbjct: 116 YINEFCIRPNSPPVNPKDSKMHHLIFVHGYGAGLGFFLKNFENIKLLNNSWTIHAIDFPG 175

Query: 202 YGYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQ 261
           YG+S+R  KFPF   +++  +V+NWFHD+  IWLQKR LL   + NL++AHSLGAYL+A 
Sbjct: 176 YGFSSR-PKFPFSINKNTASEVENWFHDRFEIWLQKRGLLEDQERNLVLAHSLGAYLIAL 234

Query: 262 YAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFSPFSIVRNSGIYGSKI 321
           YA   P H +KLIMCSPAG+  S+  K+   PPWW+ KLWD N SPFS+VRNSGI+GSK+
Sbjct: 235 YAQSRPKHLKKLIMCSPAGICPSN--KVIKQPPWWFVKLWDRNLSPFSLVRNSGIFGSKL 292

Query: 322 TSAWSYRRFKPL----DLDHKQFEALHRYAYSIFNRPGCGEYLLSFILSCGGNPRFSLED 377
           TS WS+RRFK       +   QF+ALHRYAY+IFN+PG GEYLLSF+L CGG+PR  L  
Sbjct: 293 TSGWSFRRFKQFLNEGTMGESQFQALHRYAYAIFNKPGSGEYLLSFVLKCGGDPRSPLLS 352

Query: 378 TLFQRENLST--ELCDWGWIYGDNDWMDINGAKRVSRLINEQQKGKSDVHVIPSAGHHLY 435
            LF  +   +    CDW W+YGD DWMD  G ++ S  I      +S+VHVIP +GHHLY
Sbjct: 353 RLFNSQAADSFKAQCDWLWMYGDQDWMDCKGGEQASDFIVRHIGKESNVHVIPQSGHHLY 412

Query: 436 LDNYKDFNKLLIKEM 450
           LDNY  FN+LL  EM
Sbjct: 413 LDNYSVFNELLQAEM 427

>Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON}
           complement(19721..21004) [1284 nt, 428 aa]
          Length = 427

 Score =  426 bits (1096), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 206/375 (54%), Positives = 266/375 (70%), Gaps = 10/375 (2%)

Query: 84  LPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFKTGKILKTQIEDNDDYY 143
           LP LFPR++K+S+ DY  F KD ++ Q +LL TLP++      K  +++ T+++D  +Y 
Sbjct: 54  LPNLFPRTLKESLNDYHDFHKDIDKFQTELLSTLPYYPMANDGKKAELITTKVDDEGNY- 112

Query: 144 INEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYG 203
           INEFCI+P      +  D+KHLIFIHGYGAGLGFF+KN E++PLL+N+WCIHAIDLPGYG
Sbjct: 113 INEFCISP-IGAEADQRDLKHLIFIHGYGAGLGFFLKNFEHLPLLDNKWCIHAIDLPGYG 171

Query: 204 YSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYA 263
           YS R + FPFKYP      VQ+WFH +I  W + R+LL  P+NN+I+AHSLGAYLMA Y 
Sbjct: 172 YSKRCE-FPFKYPEHDISDVQDWFHKRIRTWFKARSLLTTPENNMIMAHSLGAYLMALYI 230

Query: 264 FKFPSHFQKLIMCSPAGVTKSSIKKL--NNSPPWWYEKLWDLNFSPFSIVRNSGIYGSKI 321
            KFP+ F+K++MCSPAG+ +SS  +   N   PWW+ KLWD N SPF++VRN+   GSK+
Sbjct: 231 DKFPNDFKKIVMCSPAGICQSSTSEEIGNIKTPWWFNKLWDQNVSPFTLVRNTYYLGSKL 290

Query: 322 TSAWSYRRFKPLDLDHK--QFEALHRYAYSIFNRPGCGEYLLSFILSCGGNPRFSLEDTL 379
           TS WSYRRFK L       QFE LHRYAYSIFN+ G GEY+L F L CGG+PR  LED L
Sbjct: 291 TSGWSYRRFKQLKQSGHLMQFEKLHRYAYSIFNQKGSGEYILGFALKCGGDPRIPLEDNL 350

Query: 380 FQR---ENLSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQKGKSDVHVIPSAGHHLYL 436
           F+    E +    C+W W+YG+ DWMDI G KRV+  +  +   KS   V+P +GHHLY 
Sbjct: 351 FKSPKTEGIPKSDCEWLWVYGEKDWMDIGGGKRVTDELVTRFGKKSSTTVVPDSGHHLYF 410

Query: 437 DNYKDFNKLLIKEME 451
           DNYK FN+LL+KEM+
Sbjct: 411 DNYKFFNELLVKEMK 425

>ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR110W
          Length = 431

 Score =  424 bits (1090), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 202/375 (53%), Positives = 266/375 (70%), Gaps = 10/375 (2%)

Query: 83  SLPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFKTGKILKTQIEDNDDY 142
           +LP LFP    QS +DYK F+ D E  Q+ LL TLPFF    + K GKI++T ++D  +Y
Sbjct: 56  NLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFFERAREGKIGKIIRTPVDDEGNY 115

Query: 143 YINEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGY 202
            INEFCI P +    + A   HLIFIHGYGAGLGFFIKN E++PLL+++W IHAIDLPGY
Sbjct: 116 -INEFCIRPASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGY 174

Query: 203 GYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQY 262
           GYSTR  +FPF     S  +V+ WFH+++  WL KR LL  P  N+++AHS+GAYL A Y
Sbjct: 175 GYSTRC-QFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHY 233

Query: 263 AFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFSPFSIVRNSGIYGSKIT 322
           A    +HF+KLIMCSPAG++ S  K +   PPWW+ KLWD N SPFS+VRNSG  GSK+T
Sbjct: 234 AQSRQNHFKKLIMCSPAGISPS--KSMKKQPPWWFIKLWDRNVSPFSLVRNSGPLGSKLT 291

Query: 323 SAWSYRRFKPL----DLDHKQFEALHRYAYSIFNRPGCGEYLLSFILSCGGNPRFSLEDT 378
           S WS+RRF+ L    ++  +QFEALH+Y+Y+IFN PG GEYLLSF+L CGG+PR  L  +
Sbjct: 292 SGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGS 351

Query: 379 LF--QRENLSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQKGKSDVHVIPSAGHHLYL 436
           +F  ++E+     C+W W+YGD+ WMD  G +R S  I ++  GKS V ++P++GHHLY 
Sbjct: 352 MFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITDRIGGKSRVEIVPNSGHHLYF 411

Query: 437 DNYKDFNKLLIKEME 451
           DNY  FNK+L++EM+
Sbjct: 412 DNYSYFNKILLREMQ 426

>TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {ON}
           
          Length = 438

 Score =  416 bits (1068), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 204/373 (54%), Positives = 267/373 (71%), Gaps = 10/373 (2%)

Query: 84  LPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFKTGKILKTQIEDNDDYY 143
            P+LFPRS  +S QDYK F  D E  Q+ LL+TLP+F + +     KI  T I D++   
Sbjct: 68  FPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNT-IVDDEGSS 126

Query: 144 INEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYG 203
           INEF + P +NI++ S  +KHLIF+HGYGAGLGFF+KNLENI LLN+ WC+HAIDLPGYG
Sbjct: 127 INEFVVYP-SNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAIDLPGYG 185

Query: 204 YSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYA 263
           +STR  KFPF+  +    +V  WFH +I  W+ +RNLL + +NN ++AHSLGAYLMA Y 
Sbjct: 186 FSTR-AKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLMALYV 244

Query: 264 FKFPSHFQKLIMCSPAGVTKS-SIKKLNNSPPWWYEKLWDLNFSPFSIVRNSGIYGSKIT 322
            K P+  QK++MCSPAG+  S ++KK   +P WW+EKLW+ N SPF++VR+S   GSK+T
Sbjct: 245 DKHPNDLQKILMCSPAGIGDSMNLKK--KTPAWWFEKLWERNISPFTLVRSSSYIGSKLT 302

Query: 323 SAWSYRRFKPL--DLDHKQFEALHRYAYSIFNRPGCGEYLLSFILSCGGNPRFSLEDTLF 380
           S W+YRRF  L    + KQFEALH+Y YSIFN+ G GEYLL+F L CGG PR+ LE TLF
Sbjct: 303 SGWTYRRFSSLLSQNNLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYPLEKTLF 362

Query: 381 QREN--LSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQKGKSDVHVIPSAGHHLYLDN 438
              +  +S    +W W YGDNDWMD NG  RVS ++ +Q K +S+V+++P AGHHLY DN
Sbjct: 363 MNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVPRAGHHLYFDN 422

Query: 439 YKDFNKLLIKEME 451
           ++ FN L++KEME
Sbjct: 423 HQFFNDLILKEME 435

>Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]
           {ON} YGR110W - Hypothetical ORF [contig 20] FULL
          Length = 435

 Score =  404 bits (1037), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 196/372 (52%), Positives = 256/372 (68%), Gaps = 9/372 (2%)

Query: 84  LPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFKTGKILKTQIEDNDDYY 143
           LP LFPRS++QS +D+K F+ +   LQ +LL TLPFF  G   +T +I++T + D    Y
Sbjct: 66  LPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRRTAEIIRTTV-DAQGNY 124

Query: 144 INEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYG 203
           INEF I P T ++  S  +KHLI +HGYGAGLGFF+K  EN+ L+N  W IHAIDLPGYG
Sbjct: 125 INEFNIRP-TAVD-TSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYG 182

Query: 204 YSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYA 263
           +S+R   FPFK    +  +V+ WFH + H W+++R LL  P+NN++VAHS+GAYL A YA
Sbjct: 183 FSSR-PPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALYA 241

Query: 264 FKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFSPFSIVRNSGIYGSKITS 323
            K P HF+KL+MCSPAGV  S+ +     PPWW+ KLWD N SPFS+VRN+ + GSK+TS
Sbjct: 242 NKHPGHFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLWDKNISPFSLVRNANVLGSKLTS 301

Query: 324 AWSYRRFKPL----DLDHKQFEALHRYAYSIFNRPGCGEYLLSFILSCGGNPRFSLEDTL 379
            WSYRR   L     L+ +Q EALHRYAY+IFNR G GEYLLSF L CGG PR  LE  L
Sbjct: 302 GWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLERRL 361

Query: 380 FQRENLSTEL-CDWGWIYGDNDWMDINGAKRVSRLINEQQKGKSDVHVIPSAGHHLYLDN 438
           F       +  C+W W+YGD DW+D  G +RVS+ +  +   +S V ++ ++GHHLYLDN
Sbjct: 362 FHNRGQQFKANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHESCVKIVKNSGHHLYLDN 421

Query: 439 YKDFNKLLIKEM 450
           ++ FNK+L  EM
Sbjct: 422 HRMFNKILEDEM 433

>CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110w
          Length = 451

 Score =  380 bits (976), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 192/398 (48%), Positives = 259/398 (65%), Gaps = 36/398 (9%)

Query: 84  LPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFKTGKILKTQIEDNDDYY 143
           LP+LFPRS+ +S +DY  F  + + +Q++LL+TLPFF      K   + KT+I D+D  Y
Sbjct: 57  LPRLFPRSLAESKRDYATFHSNVDLMQLELLRTLPFFERTGYNKRAYLRKTEI-DSDGNY 115

Query: 144 INEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYG 203
           INE  I P  N++ N    K LIF+HGYGAGLGF++KN E++PLL++ W IHAIDLPGYG
Sbjct: 116 INELVIEP-ANVDPNKKR-KRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYG 173

Query: 204 YSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYA 263
           +S+R   FPF++PRD    V +WF  ++    +KR       +N+++AHS+GAYLMA Y 
Sbjct: 174 FSSR-MDFPFQFPRDDTSVVCDWFISRLRTLFEKRGFDK--SDNIVMAHSMGAYLMAFYL 230

Query: 264 FKFPSHFQKLIMCSPAGVTKSSIKKLNN-----------------SPPWWYEKLWDLNFS 306
            K+P   +K++MCSPAG+++S     NN                   PWWY KLWD N S
Sbjct: 231 NKYPDSVKKMVMCSPAGISRSQYSINNNITEDISSGKEEIKLKIKKVPWWYTKLWDRNIS 290

Query: 307 PFSIVRNSGIYGSKITSAWSYRRFKPLDLD----HKQFEALHRYAYSIFNRPGCGEYLLS 362
           PF +VR +GI GSKITS W+YRRFKP+ L+    ++QFE LHRY+++IFN  G GEYLLS
Sbjct: 291 PFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSFAIFNMKGSGEYLLS 350

Query: 363 FILSCGGNPRFSLEDTLFQRE---------NLSTELCDWGWIYGDNDWMDINGAKRVSRL 413
           F+L CGG+PR  LE++LF  +          +    C+W W+YG NDWMDI+GA+RV++ 
Sbjct: 351 FVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDWMDIHGAERVTKD 410

Query: 414 INEQQKGKSDVHVIPSAGHHLYLDNYKDFNKLLIKEME 451
                + KS V  IP +GHHLY DNY  FN LLI EM+
Sbjct: 411 FLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMK 448

>KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
          Length = 426

 Score =  352 bits (904), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 179/368 (48%), Positives = 247/368 (67%), Gaps = 13/368 (3%)

Query: 83  SLPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFKTGKILKTQIEDNDDY 142
           +L KLFP S  +S++DYK +  + E+ Q DLL  LP++   +   + KI+KT I D    
Sbjct: 71  NLHKLFPLSFAESLKDYKQYNINKEQFQEDLLSVLPYYPEPSARFSSKIIKTPI-DAAGN 129

Query: 143 YINEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGY 202
           YINEF ITP      +   +KH+I +HGYGAGLGF++KN     LL+    +HAIDLPGY
Sbjct: 130 YINEFQITP-IRPESDGKPLKHIILVHGYGAGLGFYLKNFN--ALLSENVVVHAIDLPGY 186

Query: 203 GYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQY 262
           G+S+R   FPF YP+DS L V+++FHD +H W  K+ L++  +NN ++AHS+GAY+ + Y
Sbjct: 187 GFSSR-PMFPFHYPKDSYLAVEDYFHDALHKWFDKKGLISCWENNYVIAHSMGAYIFSLY 245

Query: 263 AFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFSPFSIVRNSGIYGSKIT 322
           A K+  HF+KL MCSP G++++   K    PPWW+ KLWD N SPFS+VRN+G  GSK+ 
Sbjct: 246 ANKY-KHFKKLFMCSPGGISRN---KDMPPPPWWFLKLWDQNISPFSLVRNAGHVGSKLV 301

Query: 323 SAWSYRRFKPLDLDHKQFEALHRYAYSIFNRPGCGEYLLSFILSCGGNPRFSLEDTLFQR 382
           S W+ RRF    L H  F+ LH Y Y IFN+PG GEY+LSF+L CGG PR  LE  LF  
Sbjct: 302 SGWTARRF---GLHHPNFDKLHHYTYGIFNQPGSGEYMLSFMLGCGGWPRVPLETRLFTE 358

Query: 383 ENLSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQKGKSDVHVIPSAGHHLYLDNYKDF 442
           EN ++   DW W+YGD+DWMDINGA+R++  + ++    + + ++P+AGHHLY DN   F
Sbjct: 359 ENFNSSHLDWVWLYGDSDWMDINGARRINDFLRKKCI-NTKLEIVPNAGHHLYWDNDSFF 417

Query: 443 NKLLIKEM 450
           N +L KE+
Sbjct: 418 NNVLRKEL 425

>TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score =  323 bits (827), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 179/392 (45%), Positives = 245/392 (62%), Gaps = 31/392 (7%)

Query: 83  SLPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFF-----------SNGAKFKTGKI 131
           +LP+LFPRS+  SI+DY  F+ +PE  Q  LL  L F+           S     + G+I
Sbjct: 59  NLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYNNNSNDTSGNDDPRQGQI 118

Query: 132 LKTQIEDNDDYYINEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNR 191
           +KT + +N+  YINEF I P+T+   +   +KHLI IHGYGAGLGF+I  L+++ + N  
Sbjct: 119 IKTYVNENE--YINEFQILPNTSTPYDR--LKHLILIHGYGAGLGFYINTLQHLSMDN-- 172

Query: 192 WCIHAIDLPGYGYSTRNKKFPFKY--PRD-SQLKVQNWFHDKIHIWLQKRNLLNYPKNNL 248
           WCIHA+DLPGYG+S+R  KFP+    PR  S+  V +WF  ++  W  K+ LL +P+NNL
Sbjct: 173 WCIHAVDLPGYGFSSR-LKFPYGTINPRIYSKKDVLDWFQKRLKTWFHKKGLLAHPENNL 231

Query: 249 IVAHSLGAYLMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFSPF 308
           + AHS+GAY+M  Y    PS F+K+IMCSPAG   +S    N   P WY  LWD N+SPF
Sbjct: 232 VTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFYPASNPLTN--IPLWYTYLWDRNYSPF 289

Query: 309 SIVRNSGIYGSKITSAWSYRRF--KPLDLDHKQFEALHRYAYSIFNRPGCGEYLLSFILS 366
           S+VR SG  GSK+TS WSY RF      + ++   ALH YAYSIFN PG GEY LS IL 
Sbjct: 290 SLVRISGPLGSKLTSGWSYSRFFHSNQTISNELSLALHTYAYSIFNLPGSGEYSLSHILK 349

Query: 367 CGGNPRFSLEDTLFQRENLSTEL-----CDWGWIYGDNDWMDINGAKRVSRLINEQQKGK 421
            GG+PR  L++  F  ++ +         ++ W+YG +DW++  G  ++S+ +N   K K
Sbjct: 350 AGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFKISQFLNSLNK-K 408

Query: 422 SDVHVIPSAGHHLYLDNYKDFNKLLIKEMEMF 453
           S+V + P++GHHLY DNY  FN  L KEM +F
Sbjct: 409 SNVFIAPNSGHHLYFDNYMWFNSYLAKEMTLF 440

>KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {ON}
           conserved hypothetical protein
          Length = 434

 Score =  191 bits (486), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 135/417 (32%), Positives = 199/417 (47%), Gaps = 87/417 (20%)

Query: 103 QKDPERLQIDLLKTLPFFSNGAKFKTGKILKTQIEDNDDYYINEFCITPDTNININSAD- 161
           + D +  +  LL TL FF  G   +  ++L   I   +  +I+EF I    NI   S D 
Sbjct: 36  RADAKENEKKLLSTLEFFPGGDSIRNCELLDVDI--GNKQHIHEFSIQ---NIESCSRDY 90

Query: 162 VKHLIFIHGYGAGLGFFIKN---LENIPLLNNRWCIHAIDLPGYGYSTRNKKFPF----- 213
            K L+ +HGYGA LG F++N   L  IP +N    +HA+D+ G G S+R  +FP      
Sbjct: 91  CKDLVMVHGYGAALGLFVRNFDGLSRIPGIN----LHALDMLGCGLSSR-PRFPGTGLIS 145

Query: 214 ------KYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYAFKFP 267
                 +  ++   + +N+F D +  W Q+R L  +    ++V HSLG YL   YA KFP
Sbjct: 146 SVIKRGRVTKEEVYEAENFFIDSLEKWRQQRKLDKF----VLVGHSLGGYLSCCYALKFP 201

Query: 268 SHFQKLIMCSPAGVTKSSI---------------------KKLNNSP------------- 293
              +KL++ SP GV KS                       K++ NS              
Sbjct: 202 ERVEKLVLVSPVGVEKSVFDLTKEHTPSHNNASELGPDLSKEVTNSSGRPTTDDPVKTSS 261

Query: 294 -----------------PWWYEKLWDLNFSPFSIVRNSGIYGSKITSAWSYRRFKPLDLD 336
                            PW +  +W  N SPF ++R++G  G  ++S WS+RRF   + +
Sbjct: 262 SFHVPDEAGNVERVPNMPWIFSSMWTYNISPFGLLRSAGPAGPLLSSRWSFRRFSFAE-N 320

Query: 337 HKQFEALHRYAYSIFNRPGCGEYLLSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIY 396
            +Q    H Y YSIF+  G GEY L+ IL+ G   R  L   +   ENL    CD  W+Y
Sbjct: 321 TEQLLTFHEYCYSIFSGSGSGEYALTRILAPGVLARVPLLSRV--PENLK---CDSFWMY 375

Query: 397 GDNDWMDINGAKRVSRLINEQQKG-KSDVHVIPSAGHHLYLDNYKDFNKLLIKEMEM 452
           G +DWM       + R IN+ +   K+D  V+  AGHHLYLDN ++FN+ L K +++
Sbjct: 376 GSHDWMSKEAGSVIVRQINKTKGSVKADYSVVSDAGHHLYLDNPEEFNQKLAKFLKV 432

>Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 244] FULL
          Length = 435

 Score =  177 bits (449), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 129/407 (31%), Positives = 187/407 (45%), Gaps = 87/407 (21%)

Query: 113 LLKTLPFFSNGAKFKTGKILKTQIEDNDDYYINEFCITPDTNININSAD-VKHLIFIHGY 171
           LL TL FF  G   +  KIL   I   D   I+E  I    N+  +S      L+ +HGY
Sbjct: 47  LLSTLEFFPQGDSTRKCKILDVDI--GDKQTIHELEIE---NLKTSSRSYANDLVLVHGY 101

Query: 172 GAGLGFFIKN---LENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFK-----------YPR 217
           GA LG F++N   L ++P +     +HAID+ G G S+R  KFP               +
Sbjct: 102 GAALGLFVRNFDGLSSVPGIK----LHAIDMLGCGLSSR-PKFPGTGLISSLIKRGNVTK 156

Query: 218 DSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYAFKFPSHFQKLIMCS 277
           +   + +++F D +  W +KR +  +    ++V HSLG YL + YA K+P   +KL++ S
Sbjct: 157 EEVYEAEDFFVDSMEKWRKKRQVEKF----VLVGHSLGGYLSSCYALKYPERVEKLVLVS 212

Query: 278 PAGVTKS---------------------SIKKLNNSP----------------------- 293
           P GV KS                       K++ N+P                       
Sbjct: 213 PVGVEKSIFDLTHEHTESHKGAAELGPDVAKEITNNPDKPTTDNPVKNSSSFHVPDEHGM 272

Query: 294 -------PWWYEKLWDLNFSPFSIVRNSGIYGSKITSAWSYRRFKPLDLDHKQFEALHRY 346
                     +  +W  N SPF I+R  G  G  I+S WS+RRF   D D KQ    H Y
Sbjct: 273 VERVPNMSRIFSYMWTYNISPFGILRTLGPVGPLISSNWSFRRFSFTD-DPKQLLTFHEY 331

Query: 347 AYSIFNRPGCGEYLLSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDWMDING 406
            Y +F+  G GEY L+ IL+ G   R  L   +    NL    CD  W+YG  DWM    
Sbjct: 332 CYGVFSGAGSGEYALTRILAPGVLARLPLLSRM--PGNLK---CDSFWMYGSQDWMSKEA 386

Query: 407 AKRVSRLINEQQK-GKSDVHVIPSAGHHLYLDNYKDFNKLLIKEMEM 452
              + + +NE    GK+D  ++  AGHHLYLDN ++FN+ L+K +++
Sbjct: 387 GSVMVKKLNESPGLGKADFSIVSDAGHHLYLDNPEEFNRKLLKFLKL 433

>Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar to
           Saccharomyces cerevisiae YGR110W
          Length = 433

 Score =  166 bits (421), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 122/405 (30%), Positives = 186/405 (45%), Gaps = 90/405 (22%)

Query: 112 DLLKTLPFFSNGAKFKTGKILKTQIEDNDDYYINEFCITPDTNININSADVKHLIFIHGY 171
           ++L+ L F+ +G   +T ++L   I   D  Y++EFCI  +  + +     K ++ +HGY
Sbjct: 43  NVLRMLSFYPDGDSERTCEVLHVDIGGGD--YMHEFCI--ENKLPMTRDTCKDIVLVHGY 98

Query: 172 GAGLGFFIKN---LENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFK-----------YPR 217
           G  LG FI+N   L  IP +     +HAID+ GYG S+R  +FP               +
Sbjct: 99  GTALGVFIRNFDELSQIPGVR----LHAIDMLGYGLSSR-PRFPRSGFWDYYVKGKVVTK 153

Query: 218 DSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYAFKFPSHFQKLIMCS 277
           +   +   +F D +  W +KRN+ ++    ++V HSLG YL + YA + P    KL++ S
Sbjct: 154 EQVEEALAFFVDSLEAWREKRNVDSF----VLVGHSLGGYLSSFYALRHPERIDKLVLVS 209

Query: 278 PAGVTKSSIKKL------------------------------------NNSP-------- 293
           P GV ++SI  L                                    +NSP        
Sbjct: 210 PVGV-ETSIYDLTAEHTPEHQHAGQLGPEVASEFKEDATEHTTDLSIDSNSPQSSSLHIP 268

Query: 294 ------------PWWYEKLWDLNFSPFSIVRNSGIYGSKITSAWSYRRFKPLDLDHKQFE 341
                       PW  + LW+ N SPFS++R  G  G KI + WS+RRF     D  +  
Sbjct: 269 NEKGFVEHVPNIPWLVKMLWNTNVSPFSLLRLLGPLGPKICANWSFRRFGACK-DTNELM 327

Query: 342 ALHRYAYSIFNRPGCGEYLLSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDW 401
             H+YAY+ F   G GEY +  IL+ G   R  L   L          CD  W+YG NDW
Sbjct: 328 NFHQYAYNNFKAKGSGEYAMMKILAPGALARVPLLSQL-----PGALKCDSLWMYGSNDW 382

Query: 402 MDINGAKRVSRLINEQQKGKSDVHVIPSAGHHLYLDNYKDFNKLL 446
           M       +   + E+   +++  ++ +AGHHLYLDN ++FN+ L
Sbjct: 383 MSKEAGCIIVEELQEKSDYRAEYKIVNNAGHHLYLDNPEEFNREL 427

>SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON}
           conserved hypothetical protein
          Length = 432

 Score =  135 bits (340), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 116/399 (29%), Positives = 173/399 (43%), Gaps = 83/399 (20%)

Query: 112 DLLKTLPFFSNGAKFKTGKILKTQIEDNDDYYINEFCITPDTNININSAD---VKHLIFI 168
           ++L  L F+  G + +  + +   I   +   I+EFCI      N   +D    + ++ +
Sbjct: 47  NILSMLDFYPEGDESRRCETMDVDIGTGNS--IHEFCIE-----NTKESDRDYCRDMVLV 99

Query: 169 HGYGAGLGFFIKN---LENIPLLNNRWCIHAIDLPGYGYSTRNKKFP-----------FK 214
           HGYGA LG FI+N   L  IP +     +HAID+ GYG S+R  KFP            +
Sbjct: 100 HGYGAALGLFIRNFDGLSQIPGIR----LHAIDMLGYGLSSR-PKFPDTGFLTSFWKKRE 154

Query: 215 YPRDSQLKVQNWFHDKIHIWLQKRNL-------------------LNYPK--NNLIVAHS 253
             ++  L  +++F D I  W  KR+L                   L YP+    LI+   
Sbjct: 155 VTKEDVLLAEDFFIDSIETWRHKRHLDKFVLVGHSLGGYLSCRYALKYPERVEKLILVSP 214

Query: 254 LGA-----------YLMAQYAFKFPSHFQKLIMCSPAGVT-------KSSIKKLNNSP-- 293
           +G                ++A +      + +   P   T        SS    N S   
Sbjct: 215 VGVETSIFDLTKEHTATHEHAAELGPDIAQELKVVPENSTTDKPVQPSSSFHVPNESGHV 274

Query: 294 ------PWWYEKLWDLNFSPFSIVRNSGIYGSKITSAWSYRRFKPLDLDHKQFEALHRYA 347
                 P     +W+ N SPF I+R+ G +G  + S WS+RRF     D +Q    H YA
Sbjct: 275 ERIPNLPKIVRIIWENNISPFGILRSLGPWGPLLCSRWSFRRFSHCG-DKEQVMKFHDYA 333

Query: 348 YSIFNRPGCGEYLLSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDWMDINGA 407
           Y+ FN  G GEY L+ IL+ G   R  L       +NL    C+  W+YG +DWM     
Sbjct: 334 YNTFNARGSGEYALTRILAPGVLARIPLLSC--APKNLK---CESLWMYGSHDWMSKEAG 388

Query: 408 KRVSRLINEQQKGKSDVHVIPSAGHHLYLDNYKDFNKLL 446
             + + +N +    +D  V+  AGHHLYLDN  +FN+ L
Sbjct: 389 SVIVKELN-KAGNTADYSVVSDAGHHLYLDNPHEFNQKL 426

>NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {ON} 
          Length = 396

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 93/340 (27%), Positives = 143/340 (42%), Gaps = 73/340 (21%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYST------------------- 206
           + IHGY A    + + L    L  N   ++ IDLP    S+                   
Sbjct: 70  VLIHGYAASSMAYYRTLAT--LSKNVKDVYVIDLPANSLSSVPPHSDISHLKINKIKVVQ 127

Query: 207 -----RNKKFPFKYP--------RDSQL--KVQNWFHDKIHIWLQKRNLLNYPKNNLIVA 251
                 N+K+ FK          R+ Q+  K++N++ D I  W  +R      K NL V 
Sbjct: 128 VSKDKENEKYVFKVAPPHAYDAQREKQVIDKLENYYLDVIEKW--RRANYGLDKFNL-VG 184

Query: 252 HSLGAYLMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFSPFSIV 311
           HS G YL  +YA K+P    KL + SP GV  S+I+ +NN      E + DL  +P S++
Sbjct: 185 HSFGGYLSFKYAIKYPEVVDKLCLVSPLGVA-SNIRSVNNVFDTKKEYVMDLQ-NPGSML 242

Query: 312 RNS-------------------GIYGSKITSAWSYRRF-KPLDLDHKQFEALHRYAYSIF 351
            N                    G  GSK+T  +    + K   +D+K +     Y Y   
Sbjct: 243 YNRQRMIPNFLFNNQLNVLKWMGPVGSKLTRKYINSAYVKVPTMDYKDY----LYEYFQM 298

Query: 352 NRPGCGEYLLSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDWMDINGAKRVS 411
             P     + + + S     R  + D + + ++       +  +YGDNDWMD      + 
Sbjct: 299 GVPQVNVDIFTKLFSRNLMARDPIMDNMNRLKS-----TRFMMMYGDNDWMDKFSGYTLV 353

Query: 412 RLINEQQKG---KSDVHVIPSAGHHLYLDNYKDFNKLLIK 448
           + IN+ +     K+    IP AGH+L+LDN +DF+  LIK
Sbjct: 354 QNINKIKNNFDRKATYVEIPDAGHNLFLDNPEDFSNNLIK 393

>NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8.284
          Length = 416

 Score = 77.8 bits (190), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 88/346 (25%), Positives = 153/346 (44%), Gaps = 75/346 (21%)

Query: 154 NININSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYST------- 206
           N N ++  +  L+ +HGY A    F +     PL NN   ++AIDLP  G S        
Sbjct: 87  NNNTSTVTIPTLL-LHGYAASSMSFYRTFA--PLSNNFKNLYAIDLPANGLSVAIPLKIT 143

Query: 207 ------------RNKKFPFKYPRDSQLK------VQNWFHDKIHIWLQKRNLLNYPKNNL 248
                        N KF   YP   + +       +N++ D +  W    N+  +     
Sbjct: 144 KQRKRLYEVKYKENNKFSISYPVPIEEQKPLIEQYENYYLDAMRSWQVANNIEKFN---- 199

Query: 249 IVAHSLGAYLMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNF--- 305
           +V HS G Y   +YA +FP    KL + SP G+ +S+I  ++N   +   K++++N    
Sbjct: 200 LVGHSFGGYFSFKYALRFPDSINKLCLVSPLGM-ESNIFSIHNK--FEENKIYNVNLTDP 256

Query: 306 -SPF----------------SIVRNSGIYGSKITSAW---SYRRFKPLDLDHKQFEALHR 345
            SPF                 ++R  G +G+++   +   +Y+R   ++     FE  + 
Sbjct: 257 TSPFYGKKFQIPNYLFENQLDVIRKLGPFGARLCWNYILSAYKRVPSMEYKEYLFELFYG 316

Query: 346 YAYSIFNR---PGCGEYLLSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDWM 402
                 NR   P   E L + +L+     R  + D++ Q      +L +   +YG++DWM
Sbjct: 317 ------NRQVSPILCE-LFTNLLTRNLLARDPILDSIDQ-----LQLSNVLVMYGEHDWM 364

Query: 403 D-INGAKRVSRLINEQQKGKSDVHV-IPSAGHHLYLDNYKDFNKLL 446
           +   G   VSRL N ++   +  ++ +P+AGH+L+LDN + F+  L
Sbjct: 365 NRYAGYCMVSRLNNIRRTPNTAQYLQVPAAGHNLFLDNPEYFSSAL 410

>Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 174] FULL
          Length = 416

 Score = 74.7 bits (182), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 91/339 (26%), Positives = 143/339 (42%), Gaps = 74/339 (21%)

Query: 166 IFIHGYGAG-LGFFIKNLENIPLLNNRWC-IHAIDLPGYGYS------------------ 205
           + +HGY A  +GF      N P L+     ++AIDLP  G S                  
Sbjct: 100 LLVHGYAASSMGFH----RNFPGLSQSIKDLYAIDLPASGLSPALPLEMRCTQPLDLKIN 155

Query: 206 ----TRNKKFPFKYPRDSQL--KVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLM 259
               T +  +   Y     L    ++++ D I  W     L   P N  IVAHS G YL 
Sbjct: 156 MSKDTFSLPYTINYLHHKSLIQNYEDYYLDAIEQWRHDNKL--GPIN--IVAHSFGGYLS 211

Query: 260 AQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNF-SPFS--------- 309
            +YA KFP   +KL + SP GV + +I  +NN   W     ++L+F +P S         
Sbjct: 212 FKYAVKFPHAVEKLCLVSPLGVER-NIFSVNNQ--WRSNTSYNLDFENPASKFYIKKGPA 268

Query: 310 -----------IVRNSGIYGSKITSAW---SYRRFKPLDLDHKQFEALHRYAYSIFNRPG 355
                      ++RN G  G+K++  +   +Y R   LD     FE L  Y  +  N+  
Sbjct: 269 IPRLVFEQQTQLLRNLGPLGAKLSWNYINAAYSRVPSLDYKKYVFELL--YGKNGLNQTS 326

Query: 356 CGEYLLSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDWMDINGAKRVSRLIN 415
              ++  F      N R    D L        +      IYGD+DWM+         ++N
Sbjct: 327 KDLFIGLF------NNRVLARDPLLDSIQFFGKSAKLMCIYGDHDWMNRRAGM---EMVN 377

Query: 416 E--QQKGKSDVHVIPSAGHHLYLDNYKDFNKLLIKEMEM 452
           E  Q   ++  + + S+GH+L+LDN ++FN  L++ +++
Sbjct: 378 EANQLGIEAKYNEVSSSGHNLFLDNPEEFNDKLVRFLKL 416

>KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {ON} 
          Length = 408

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 83/339 (24%), Positives = 137/339 (40%), Gaps = 76/339 (22%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPR-------- 217
           + IHGY A    F  N+  +    +  C+  +DLP  G S   ++ P   P+        
Sbjct: 84  VLIHGYAASSMAFHLNVAGLSNAFSDLCV--VDLPANGLS---REPPMLGPKVKGQPVHW 138

Query: 218 --------------------------DSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVA 251
                                     D     +++F D+I  W     L +   N  +V 
Sbjct: 139 KELDKKTGSLTVVCEPPSKMSSSGVLDDPGVYEDYFVDRIEKW----RLAHGFDNINVVG 194

Query: 252 HSLGAYLMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLN------- 304
           HS G Y+  +YA K+  H  KL++ SP GV + +I  ++N   W   K +DL        
Sbjct: 195 HSFGGYMSFKYAIKYSKHVDKLVLLSPLGVER-NIDSVSNK--WDVGKTYDLTDIDATSP 251

Query: 305 --FSPFS-----------IVRNSGIYGSKITSAWSYRRFKPLDLDHKQFEA-LHRYAYSI 350
             + PF+           ++R  G  G+ +       R+   ++    + A LH   Y  
Sbjct: 252 LYYRPFTVPGYLFNNQLNVLRKMGPLGNHMAKRAIASRYS--NVPGTAYHAYLHHVFYGA 309

Query: 351 FNRPGCGEYLLSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDWMDINGAKRV 410
              P       + + +     R  L D + QR  ++  +     +YGD+DWM+      +
Sbjct: 310 HTFPSANITAFTHLFTRQLLARDPLLDNI-QRLKVNKLMM----VYGDHDWMNKEAGYGM 364

Query: 411 SRLINEQQ--KGKSDVHVIPSAGHHLYLDNYKDFNKLLI 447
            + IN+++    K+    +PSAGH+L+LDN   FNKLLI
Sbjct: 365 VQEINKERYVPAKAVYAELPSAGHNLFLDNPSGFNKLLI 403

>CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {ON}
           similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125c ECM18 or uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 423

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 90/324 (27%), Positives = 139/324 (42%), Gaps = 67/324 (20%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWC-IHAIDLPGYGYS-------TRNKKFPFK--- 214
           + IHGY A    F ++   IP LN     ++ IDLPG G S         +K  P K   
Sbjct: 110 VLIHGYAATSTAFFRS---IPYLNRDIKDLYTIDLPGNGLSFTPSLDLEVSKPLPLKIEN 166

Query: 215 ----------YPRDSQ------LKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYL 258
                     Y  DS        K+ +++ D+I  W     L    K N +VAHS G YL
Sbjct: 167 IDDGNEFQLPYVIDSAHHRYVLQKLLDYYVDRIEQWRLDNKL---GKIN-VVAHSYGGYL 222

Query: 259 MAQYAFKFPSHFQKLIMCSPAGVTKS--SI-----------KKLNNSPPWWYEKLWDLNF 305
              YA K+P++   L + SP GV ++  SI           ++ N+    +Y++ + LN 
Sbjct: 223 SFNYALKYPANINTLGLISPLGVERNIYSINNEFHSRTIYKREWNDCNSMFYDRKFKLND 282

Query: 306 SPFSI----VRNSGIYGSKITSAW---SYRRFKPLDLDHKQFEALHRYAYSIFNRPGCGE 358
             F      +R  G  G+K+   +   +Y R   +D     FE      Y     P    
Sbjct: 283 YLFQKQLKPLRWLGPIGAKLCWNYIRSAYARVPSIDYKDYTFETF----YGRGGLPEQTS 338

Query: 359 YLLSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQ 418
            + + +L+     R  L D + Q      ++     +YG  DWM+ NG K ++++ N   
Sbjct: 339 QIFTSLLTSSLLARDPLLDHVSQ-----LQVPKLIMMYGQYDWMNKNGGKLMTQIFN--- 390

Query: 419 KGKSDVHVIPSAGHHLYLDNYKDF 442
            G++    IP+AGH+L+LDN  DF
Sbjct: 391 -GETKYIDIPNAGHNLFLDNPSDF 413

>AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR099C
           (ICT1) and YDR125C (ECM18)
          Length = 384

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 73/320 (22%), Positives = 133/320 (41%), Gaps = 64/320 (20%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQL---- 221
           + +HGY +    F +NL  +     +  ++A+DLPG G S      P      ++     
Sbjct: 86  VLLHGYASSAVSFHRNLAALGAQVEQ--LYALDLPGNGMSQELPLGPAAARALARRCGAR 143

Query: 222 ----KVQNWFHDKIHIWLQKRNL--LNYPKNNLIVAHSLGAYLMAQYAFKFPSHFQKLIM 275
                + +++ D +  W     L  LN         HS G YL  +YA + P+  Q+L +
Sbjct: 144 ADIRALADYYLDALERWRAANGLETLN------AAGHSFGGYLAFKYALRHPARVQRLCL 197

Query: 276 CSPAGVTKSSI-----------------------KKLNNSPPWWYEKLWDLNFSPFSIVR 312
            SP GV   +                         +    PP  +E+          ++R
Sbjct: 198 VSPLGVEAQTAGRRMPGRATRRRTRPPTPASPHYTRAAALPPLLFEQ-------QLRVLR 250

Query: 313 NSGIYGSKITSAWSYRRFKPLDLDHKQFEALHRYAYSIFNRPGCGEY---LLSFILSCGG 369
             G  G+ +   W Y       +  ++F   HRY +++ +R         L + + +   
Sbjct: 251 WLGPLGAHLL--WQYVNASFSRVPGREF---HRYTFALLHRLALRPLPRKLFTGLFTNAL 305

Query: 370 NPRFSLEDTLFQRENLSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQKGKSD--VHVI 427
             R  L D+L + +  + +L     +YGD+DWMD    + +   +N   +G+ D  + ++
Sbjct: 306 LARDPLLDSLAELKVPNVQL-----LYGDHDWMDARAGRALVAELNAL-RGRPDASLAIV 359

Query: 428 PSAGHHLYLDNYKDFNKLLI 447
           P+AGH+L+LDN +DF+  L+
Sbjct: 360 PAAGHNLFLDNPEDFHSWLL 379

>SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 419

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 90/337 (26%), Positives = 142/337 (42%), Gaps = 61/337 (18%)

Query: 159 SADVKH-LIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYST----------- 206
           SA +K   + +HGY A    F +N     L +    ++AIDLP  G S            
Sbjct: 92  SASIKTPTLLLHGYAAASMGFHRNFAG--LSSRIQNLYAIDLPANGLSPGSSQPLVVSCG 149

Query: 207 ---------RNKKFPFKYP------RDSQLKVQNWFHDKIHIWL--QKRNLLNYPKNNLI 249
                     N +F   Y       +    ++++++ + I  W    K N +N      I
Sbjct: 150 EPLPMKAEFSNDRFKIPYTLEYLHQKSFIQQLEDYYLNSIEQWRIDNKLNKIN------I 203

Query: 250 VAHSLGAYLMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNF---- 305
           VAHS G YL  +YA K+P   ++L + SP GV ++ I  +NN   W     +DLN+    
Sbjct: 204 VAHSFGGYLSTKYAIKYPHAVERLCLVSPLGVERN-IHSVNNH--WCSNTWYDLNYEDPG 260

Query: 306 SPFSIVRNSGIYGSKITSAWSYRRFKPLDLDHKQFEALHRYAYSIFNRPGCGEYLLSFIL 365
           S + + R  GI  +   S     R     L  K        AYS        EY+     
Sbjct: 261 SKYYMRRMRGIPSTVFQSQVKLLRLLG-PLGAKLCWNYINAAYSRVKNEKYKEYVFELFY 319

Query: 366 SCGGNPRFSLE--DTLFQRENLSTE-LCD---------WGWIYGDNDWMDINGAKRVSRL 413
              G  + +++    LF R+ L+ + L D             YG++DWM+      +++ 
Sbjct: 320 GKEGVTQTAMDIFTNLFTRQLLAKDPLMDSLQHLHVGRLMLAYGEHDWMNKYAGVLMTKE 379

Query: 414 INEQQKGKSDVH---VIPSAGHHLYLDNYKDFNKLLI 447
            N   +GKSD     VI S+GH+++LDN  +FN+ +I
Sbjct: 380 FN-HLRGKSDAATYTVISSSGHNMFLDNPDEFNEKVI 415

>Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 83/334 (24%), Positives = 136/334 (40%), Gaps = 70/334 (20%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYST----------RNKKFPFKY 215
           + IHGY A    F +  +N  L +N   ++AIDLP  G S           + K   FK+
Sbjct: 74  VLIHGYAASSMAFYRTFKN--LSDNIKDLYAIDLPANGASEAPALQVEGVKKIKSLRFKH 131

Query: 216 PRDSQL------------------KVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAY 257
             D  +                  + +++F D+I  W +  NL    +   +V HS G Y
Sbjct: 132 VEDDMVTPVLDKRPPAEEIKSHLEQYESYFVDRIEQWRKDNNL----RKINVVGHSFGGY 187

Query: 258 LMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFS----------- 306
           +  +YA K+P+   KL + SP GV ++SI  +N+   W     + + F+           
Sbjct: 188 ISFKYALKYPNSIDKLCLISPLGV-ENSIHAINHK--WEANTTYPVTFTDPSSRYYTRKL 244

Query: 307 ---------PFSIVRNSGIYGSKITSAW-SYRRFKPLDLDHKQFEALHRYAYSIFNRPGC 356
                      ++++  G  GSK+ S++ S    K  D  +K +  LH +     N+   
Sbjct: 245 NVPQFIFENQLNVLKWMGPIGSKLCSSYISTAYVKVPDQLYKDY-LLHSFVGK--NQSVQ 301

Query: 357 GEYLLSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDWMDINGAKRVSRLINE 416
            + +  F      N      D +     L        ++YG++DWMD    K    L  E
Sbjct: 302 PQTIKVFTQLFERN--LIARDPIINNVGLLNPATHVMFMYGEHDWMD----KYAGYLTTE 355

Query: 417 ---QQKGKSDVHVIPSAGHHLYLDNYKDFNKLLI 447
              + K K+    +P AGH+L+LDN   F   L+
Sbjct: 356 SMLKNKAKASYMEVPDAGHNLFLDNPNHFTSSLV 389

>NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284
          Length = 430

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 88/323 (27%), Positives = 130/323 (40%), Gaps = 68/323 (21%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYS-------------------T 206
           + +HGY A    F +    +PL  +   ++A DLPG G S                    
Sbjct: 112 LLLHGYAASSLCFFRTF--VPLSRSIKNLYATDLPGNGLSKNKSFFSVMYGNEYMKVKYE 169

Query: 207 RNKKFPFKY------PRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMA 260
            N KF  KY        +S    ++++ D I  W    NL   PK NL V HS G YL  
Sbjct: 170 ENNKFSIKYLNSLKDQTNSIKHSEDYYIDAIREWQLSNNL---PKINL-VGHSFGGYLSF 225

Query: 261 QYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFS-------------- 306
           +YA ++P +  KL + SP GV +S++  +NNS    Y  L+D+++S              
Sbjct: 226 KYALRYPDNVNKLCLVSPLGV-ESNLYSVNNSLKENY--LYDVDYSDPKSSYYSRNFAIP 282

Query: 307 ------PFSIVRNSGIYGSKITSAW---SYRRFKPLDLDHKQFEALHRYAYSIFNRPGCG 357
                  F I+R  G  G+++   +   SY+R   +      F  L   A  +       
Sbjct: 283 KSLFEGQFGILRWMGPIGARVCWNYILSSYKRVPSMKYKEYLFHLLFGNAKKLVTSAKTF 342

Query: 358 EYLLSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDWMD-INGAKRVSRLIN- 415
             L +  L        S+E    Q E L         +YG +DWM+   G   +++L N 
Sbjct: 343 TNLFTRNLLAKDPIMDSIEK--LQCEKLMV-------MYGQHDWMNKYAGYCLIAKLNNY 393

Query: 416 EQQKGKSDVHVIPSAGHHLYLDN 438
              K       IP AGH+L LDN
Sbjct: 394 RSTKDAGYFTEIPEAGHNLILDN 416

>Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON}
           YDR125C (REAL)
          Length = 446

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 90/338 (26%), Positives = 140/338 (41%), Gaps = 80/338 (23%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYST------------------- 206
           + IHGY A    + +N     L  +   +++IDLP  G S+                   
Sbjct: 123 LLIHGYAASSMSYFRNYPG--LSKHIRDLYSIDLPASGLSSIPSLEINATTPLPLDIKFI 180

Query: 207 -RNK-KFPFKYPRDSQLKV----QNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMA 260
            +NK K P+    +    V    ++++ D+I  W     L    K N IV HS GAYL  
Sbjct: 181 GKNKFKIPYTINANHHKFVIQMFEDFYLDRIEQWRIDNKL---GKMN-IVGHSFGAYLSF 236

Query: 261 QYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNF---SPFSIVRNSGIY 317
           +YA K+P+  +KL + SP GV + +I  +NN            NF   SP++I      +
Sbjct: 237 KYAVKYPNSVEKLCLVSPLGVER-NIWSVNN------------NFRSNSPYTID-----F 278

Query: 318 GSKITSAWSYRRFKPLDLDHKQFEALHRY--------------AYSIFNRPGCGEYLLSF 363
            +  +  +S R   P  L  +QF+ L                 AYS        EY+   
Sbjct: 279 ENPSSKFYSKRNIIPRYLFQQQFQILRMMGPLGAKLCWNYILAAYSRVPSLAYKEYIFEL 338

Query: 364 ILSCGGNPRFSLE--DTLFQRENLSTE-LCD---------WGWIYGDNDWMDINGAKRVS 411
               GG P  + E  + LF R  L+ + L D            +YG  DWM+ N    + 
Sbjct: 339 FYGKGGIPAVTTEIFEGLFSRSILARDPLMDSLNSLNVRKLLVVYGQYDWMNKNAGMLMV 398

Query: 412 RLINE--QQKGKSDVHVIPSAGHHLYLDNYKDFNKLLI 447
           + +N       K+    IP +GH+L+LDN + FN+ ++
Sbjct: 399 KELNNLGDHFEKATYTEIPFSGHNLFLDNPESFNQSIV 436

>KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.284
           YDR125C
          Length = 434

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 84/335 (25%), Positives = 146/335 (43%), Gaps = 68/335 (20%)

Query: 165 LIFIHGYGAGLGFFIKNLENIPLLNNRWC--IHAIDLPGYGYSTR-------NKKFPFKY 215
           ++ IHGY +    + +N   +    +  C  ++AIDLP  G S         + K   KY
Sbjct: 111 VLLIHGYASSSMSYFRNFRGL----SSQCKDVYAIDLPANGLSREISLSEDADLKDLVKY 166

Query: 216 PRD-------SQLKVQNWFHDKIHIWLQKRNLLNYPKNNL-------------IVAHSLG 255
                      Q+KV   +++K+    Q R L +Y  + +             +V HS G
Sbjct: 167 SLQVKGLDSPGQVKVTKPYNNKL-CATQLRILEDYYVDEIERWRVENQIDQLHLVGHSFG 225

Query: 256 AYLMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNN---------------SPPWWYEKL 300
            Y+  +YA K+P +  KL + SP GV + ++  +NN               S P +  KL
Sbjct: 226 GYISYKYALKYPQNVMKLALISPLGVER-NLYSVNNHLPQDSIVQGTFEDPSSPSYLRKL 284

Query: 301 WDLNF---SPFSIVRNSGIYGSKITSAWSYRRFKPLDLDHKQFEALHRYAYSIFNRPG-- 355
               +   +   I+R  G  G+++   W+Y       +  ++F+    Y + +F   G  
Sbjct: 285 EVPRYIFENQLKILRWGGPMGARL--CWNYITSAYAKVPSREFK---EYLFELFYGDGGI 339

Query: 356 CGEYLLSFILSCGGN--PRFSLEDTLFQRENLSTELCDWGWIYGDNDWMDINGAKRVSRL 413
               L +FIL    N   R  + D++ +      ++ D  + YG  DWM+ N   R + L
Sbjct: 340 TKTALTTFILLFTRNLLARDPIMDSIAE-----LKVKDVMFQYGQYDWMNKNAGARAAEL 394

Query: 414 INEQQKGKSDVHV-IPSAGHHLYLDNYKDFNKLLI 447
           + +Q    S +++ IP +GH+L+LD+ + FN  LI
Sbjct: 395 LRKQPYNNSALYLEIPESGHNLFLDSPQSFNFSLI 429

>TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {ON}
           Anc_8.284 YDR125C
          Length = 434

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 88/333 (26%), Positives = 135/333 (40%), Gaps = 69/333 (20%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKY----PRDSQL 221
           + IHGY A    + +N     L      ++AIDLP  G S      PFK     PR  ++
Sbjct: 116 LLIHGYAASSMAYYRNFTG--LSQTVTDLYAIDLPANGLSAEQ---PFKLNGDKPRSLKV 170

Query: 222 K------------------------VQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAY 257
           K                         ++++ DKI  W   R +    K NL V HS G Y
Sbjct: 171 KYLDNDKFSVQHVIDESGTKQMIQQCESYYLDKIEEW---RKVNKLEKINL-VGHSFGGY 226

Query: 258 LMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDL-----NF------- 305
           L  +YA K+P+  +KL + SP GV ++SI  +NN      +   DL     NF       
Sbjct: 227 LSFKYALKYPNSIEKLCLVSPLGV-ETSIYSVNNKLEKNTKYALDLEDPTSNFYTRRREI 285

Query: 306 ------SPFSIVRNSGIYGSKITSAW---SYRRFKPLDLDHKQFEALHRYAYSIFNRPGC 356
                 +   I+R  G  G+K+   +   +Y R   ++     FE L    Y        
Sbjct: 286 PKFIFKNQSEILRWMGPLGAKMCWNYILSAYSRIPEMEYKSYIFELL----YGKGGIAPT 341

Query: 357 GEYLLSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDWMD-INGAKRVSRLIN 415
              + + + +     +  + D+L Q +     L     +YGD+DWM+   G K V RL  
Sbjct: 342 ARQIFTNLFTRNLLAKDPIMDSLGQLQAKKVLL-----VYGDHDWMNKYAGYKLVERLNT 396

Query: 416 EQQKGKSDVHVIPSAGHHLYLDNYKDFNKLLIK 448
            +    +    +P +GH+L+LDN   FN  L +
Sbjct: 397 IRNNTSAQYIEVPESGHNLFLDNPTFFNASLTE 429

>KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON}
           Anc_8.284 YDR125C
          Length = 411

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 83/336 (24%), Positives = 135/336 (40%), Gaps = 80/336 (23%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYS-TRNKKFPFKYPRDS----- 219
           + +HG+ +    F +N   +    +   ++AIDLP  G S + + KF    P+++     
Sbjct: 91  LLLHGFASSSMSFFRNFTGLS--QDIMDLYAIDLPANGLSRSLSTKFYRVSPKETRKFDM 148

Query: 220 ------QL--------------KVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLM 259
                 QL              K ++++ D I  W +   L    K N IVAHS G YL 
Sbjct: 149 LDDIHFQLLSHGNYHAEKELIQKCEDYYIDTIERWRRSNEL---HKIN-IVAHSFGGYLS 204

Query: 260 AQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNS-------------------------PP 294
            +YA K+P    KL + SP GV +++I  +NN+                         P 
Sbjct: 205 FKYALKYPESINKLCLVSPLGV-EANIYSINNNFNVGETYTVNRLDPSSCCYINENEIPK 263

Query: 295 WWYEKLWDLNFSPFSIVRNSGIYGSKITSAW---SYRRFKPLDLDHKQFEALHRYAYSIF 351
           + ++ L       F I+R SG  G+K+   +   SY R   LD     FE L       +
Sbjct: 264 YVFDNL-------FKILRLSGPIGAKLCWNYVLSSYSRISSLDFKRYVFELL-------Y 309

Query: 352 NRPGCGEYLLSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDWMDINGAKRV- 410
            + G     ++           + +  +    +LS        +YG+ DWM  N  K + 
Sbjct: 310 GKGGMTATAINLFTQLFTTRLLARDPLMDSAHSLSCN--GILLLYGEYDWMAKNAGKSLL 367

Query: 411 --SRLINEQQKGKSDVHVIPSAGHHLYLDNYKDFNK 444
              +  N+    K+    +P +GH+L+LDN   FNK
Sbjct: 368 TNCKADNKGSASKTKYLEVPKSGHNLFLDNPAFFNK 403

>ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 380

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 82/347 (23%), Positives = 144/347 (41%), Gaps = 75/347 (21%)

Query: 156 NINSADVKH-LIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTR------- 207
           N N+++V    + IHGY A    + +  +   L +    ++ IDLP  G S         
Sbjct: 51  NSNASEVTTPTLLIHGYAASSMAYYRTFQG--LTDKISDLYTIDLPSNGLSKELPLILDG 108

Query: 208 -------------NKKFPF------KYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNL 248
                          KF        ++ R    + ++++ D I +W +   +  +     
Sbjct: 109 QTPPPLKVEIHKDGSKFKIIERVDAEHCRSVVKQYEDYYLDSIELWRKHNGIGRFN---- 164

Query: 249 IVAHSLGAYLMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFSPF 308
           +V HS G Y+  +YA K+P   ++L + SP GV +S+I  +NN   W  + ++++     
Sbjct: 165 LVGHSFGGYIAFKYAVKYPKAVEQLGLISPLGV-ESNIYSVNND--WKLDTVYEME---- 217

Query: 309 SIVRNSGIYGSKITSAWSYRRFKPLDLDHKQFEALH-----------RYAYSIFNRPGCG 357
           S    S +YG      W      P  L  +Q E L             Y  + +N+    
Sbjct: 218 STDPASRMYGKN----WEI----PKVLFERQTELLRWMGPIGAKLCWNYITAAYNKLPTM 269

Query: 358 E---YLLSFILSCGGNPRFS-------LEDTLFQRENLSTELCDWG-----WIYGDNDWM 402
           E   Y+   +   GG P+ +          +L  R+ +   +   G      +YGD+DWM
Sbjct: 270 EYKDYVFELLYGNGGIPKTARKVFGGLFTRSLLARDPIMDSMDKLGARKVLLLYGDSDWM 329

Query: 403 DINGAKRVSRLINEQQ-KGKSDVHVIPSAGHHLYLDNYKDFNKLLIK 448
           +     R+  L+N+++ KG +    +P A H+L+LDN   FN  LI+
Sbjct: 330 NNYAGYRMVELLNQKRGKGYATYDEVPDARHNLFLDNPDSFNDKLIQ 376

>Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 79/335 (23%), Positives = 133/335 (39%), Gaps = 74/335 (22%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYST-----RNKKFPF----KYP 216
           + IHGY A    + +N     L  +   +++IDLP  G S+      N   P     K+ 
Sbjct: 112 LLIHGYAASSMSYFRNYSG--LSKHFQNLYSIDLPASGLSSIPPLEVNTTTPLPLDIKFI 169

Query: 217 RDSQLKV----------------QNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMA 260
             ++ K+                ++++ D+I  W     L    K N IV HS G YL  
Sbjct: 170 GKNKFKIPYTINASHHKFVIQMFEDFYIDRIEQWRIDNKL---DKMN-IVGHSFGGYLSF 225

Query: 261 QYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFSPFSIVRNSGIYGSK 320
           +YA K+P+  +KL + SP GV ++               +W +N +  S    +  +   
Sbjct: 226 KYAVKYPNSVEKLCLVSPLGVERN---------------IWSVNNNLSSNTLYTTDFKDP 270

Query: 321 ITSAWSYRRFKPLDLDHKQFEALH--------------RYAYSIFNRPGCGEYLLSFILS 366
            +  +S     P  L  +QF+ L                 AYS        EY+      
Sbjct: 271 SSKFYSKGHLIPKYLFEEQFKLLRLMGPLGAKVCWNYIMAAYSRVTSLAFKEYIFELFYG 330

Query: 367 CGGNPRFSLE--DTLFQRENLSTE----------LCDWGWIYGDNDWMDINGAKRVSRLI 414
            GG P  + +    LF R  L+ +          +     +YG  DWM+ N    +   +
Sbjct: 331 KGGIPEVTTDIFKGLFSRSILARDPILDSLNYLNVKKLLVVYGQYDWMNKNAGMLLVENV 390

Query: 415 NEQQKG--KSDVHVIPSAGHHLYLDNYKDFNKLLI 447
           N+   G  ++    +PS+GH+L+LDN + FN+ ++
Sbjct: 391 NKLGNGLERASYLEVPSSGHNLFLDNPESFNQSIV 425

>YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON}
           ICT1Lysophosphatidic acid acyltransferase, responsible
           for enhanced phospholipid synthesis during organic
           solvent stress; null displays increased sensitivity to
           Calcofluor white; highly expressed during organic
           solvent stress
          Length = 394

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 85/334 (25%), Positives = 132/334 (39%), Gaps = 70/334 (20%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYST----------RNKKFPFKY 215
           + IHGY A    F +  EN  L +N   ++AIDLP  G S           + K   FK+
Sbjct: 74  VLIHGYAASSMAFYRTFEN--LSDNIKDLYAIDLPANGASEAPALQVNKTKKIKSLRFKH 131

Query: 216 PRDSQL------------------KVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAY 257
             D  +                  + +++F D+I  W +   L    +   +V HS G Y
Sbjct: 132 IEDDVVIPVIEKRPPAEDIKSHLEQYESYFVDRIEQWRKDNKL----RKINVVGHSFGGY 187

Query: 258 LMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFS----------- 306
           +  +YA K+P   +KL + SP GV ++SI  + +   W     + L F+           
Sbjct: 188 ISFKYALKYPDSIEKLCLISPLGV-ENSIHAITHK--WEPNTTYPLTFTDPSSRYYTRKL 244

Query: 307 --PFSIVRNS-------GIYGSKITSAW-SYRRFKPLDLDHKQFEALHRYAYSIFNRPGC 356
             P  I  N        G  GSK+ S + S    K  D  +K +  LH +     N+   
Sbjct: 245 NVPRFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQIYKDY-LLHSFVGK--NQTVQ 301

Query: 357 GEYLLSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDWMDINGAKRVSRLINE 416
            + +  F      N      D +              ++YG++DWMD    K    L  E
Sbjct: 302 PQTIKVFTHLFERN--LIARDPIINNVRFLNPATPVMFMYGEHDWMD----KYAGYLTTE 355

Query: 417 ---QQKGKSDVHVIPSAGHHLYLDNYKDFNKLLI 447
              + K K+    +P AGH+L+LDN + F   L+
Sbjct: 356 SMLKNKAKASYVEVPDAGHNLFLDNPQHFASSLV 389

>NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON} 
          Length = 427

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 78/327 (23%), Positives = 129/327 (39%), Gaps = 74/327 (22%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTR------------------ 207
           + +HGY      F +     PL      ++AID P  G S                    
Sbjct: 107 LLLHGYATSSIAFFRTFG--PLSKQIRDLYAIDFPANGLSKAPPLNVNHLKKHTPYKVKF 164

Query: 208 ---NKKFPFKYPRDSQLK------VQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYL 258
              N KF   +  D QL+       +N++ D +  W     L N  +   +V HS G Y 
Sbjct: 165 KDDNTKFQISHTVDVQLQKETIEHYENYYLDAVRKW----QLTNKIEKFNLVGHSFGGYF 220

Query: 259 MAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFS------------ 306
             +YA ++P    KL + SP GV + +I  +NN+  +  +K+++L               
Sbjct: 221 AYKYALRYPDSVDKLCLVSPLGVER-NIYSVNNN--FEDKKVYNLELEDPTSKYYGRTFQ 277

Query: 307 --------PFSIVRNSGIYGSKITSAW---SYRRFKPLDLDHKQFEALH--RYAYSIFNR 353
                    F I+R  G  G + T  +   SYRR   ++     FE L+  R    I   
Sbjct: 278 IPKCLFEGQFDILRKFGPLGPRFTWNYINSSYRRVPSMEFKEYIFELLYGNRKTSPILTE 337

Query: 354 PGCGEYLLSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDWMDINGAKRVSRL 413
                 + S I+S     R  + D++ + +  +  L     +YG  DWM+      + + 
Sbjct: 338 ------VFSNIVSRNLLARDPILDSIDELKASNVML-----MYGQEDWMNSQAGYLMVKE 386

Query: 414 INE--QQKGKSDVHVIPSAGHHLYLDN 438
           +NE  +    +    +P+AGH+L+LDN
Sbjct: 387 LNEIRENPNAASYVEVPNAGHNLFLDN 413

>KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]
           {ON} similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125C ECM18 Protein of unknown function, similar to
           Rlp24p
          Length = 409

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 79/336 (23%), Positives = 135/336 (40%), Gaps = 75/336 (22%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYS-------------------- 205
           + IHGY A    F +N E + L  +   ++A+DLPG G S                    
Sbjct: 90  LMIHGYAASSMTFFRNFEQLSL--SLKDVYAVDLPGNGLSKELPLSVDSMQKPDRVEFNE 147

Query: 206 -TRNKKFPFKYPRDSQ------LKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYL 258
             + + F  + P D +         ++++ D +  W ++  L    K NL V HS G YL
Sbjct: 148 TVKGQYFRLQNPVDEEKYKKHLAHYEDYYVDALEKWRKENKL---SKINL-VGHSYGGYL 203

Query: 259 MAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFSPFSIVRNSGIYG 318
             +Y+ K+P +  KL + SP GV +S     N+  P   E+ +++     S         
Sbjct: 204 TFKYSLKYPDNVHKLCLVSPLGVERSIFSIHNHLEP---ERDYEIQSEDPS--------- 251

Query: 319 SKITSAWSYRRFKPLDLDHKQFEALH-----------RYAYSIFNR-PGC--GEYLLSFI 364
               S +S +R  P  +   Q +AL             Y  S + R P     EY+   +
Sbjct: 252 ---KSNYSNKRNIPKLILQYQNKALRWMGPLGAKACWGYVNSSYGRVPSVPYREYVFQLV 308

Query: 365 LSCG--GNPRFSLEDTLFQRENLS----------TELCDWGWIYGDNDWMD-INGAKRVS 411
              G   +    + + LF R  L+           ++     +YG++DWM+ + G   + 
Sbjct: 309 FGKGIMTDTSIRIFNQLFSRSLLAYDPIMDSLDKVKVSKLMLVYGEHDWMNKVAGRLAIE 368

Query: 412 RLINEQQKGKSDVHVIPSAGHHLYLDNYKDFNKLLI 447
              + ++       ++  AGH+L LDN  +FN  L+
Sbjct: 369 EFNSIRKSYDGTFDIVSRAGHNLVLDNPSEFNSKLV 404

>Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 90/335 (26%), Positives = 132/335 (39%), Gaps = 74/335 (22%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTR-----NKKFP-------- 212
           + IHGY A    F +N     L  +   +++IDLP  G S+      N   P        
Sbjct: 112 LLIHGYAASSMSFFRNYPG--LSKHIQNLYSIDLPASGLSSIPPLEINATTPLPLDIEFT 169

Query: 213 ----FKYPRDSQLK--------VQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMA 260
               FK P    L          ++++ DKI  W     L    K N IV HS G YL  
Sbjct: 170 GKNKFKIPYTINLNHHKFVIQMYEDFYLDKIEQWRIDNKL---GKVN-IVGHSFGGYLSF 225

Query: 261 QYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFSPFSIVRNSGIYGSK 320
           +YA K+P+  +KL + SP GV + +I  +NN+  +    L+ + F   S           
Sbjct: 226 KYAAKYPNSVEKLCLVSPLGVER-NIWSINNN--FRSNTLYTIGFEDPS----------- 271

Query: 321 ITSAWSYRRFKPLDLDHKQFEALHRY--------------AYSIFNRPGCGEYLLSFILS 366
            +  +S R   P  L  +QF+ L                 AYS        EY+      
Sbjct: 272 -SKFYSKRNMIPKYLFERQFQLLRMMGPVGAKLCWNYIMAAYSRVPSLAYKEYIFELFYG 330

Query: 367 CGGNPRFSLE--DTLFQRENLSTE-LCD---------WGWIYGDNDWMDINGAKRVSRLI 414
            GG P  + E    LF R  L+ + L D            +YG  DWM+      +   +
Sbjct: 331 KGGIPEVTTEIFKGLFSRCILAKDPLMDSLHYLNVRKLMVVYGQYDWMNKKAGMLMVENL 390

Query: 415 NEQQKG--KSDVHVIPSAGHHLYLDNYKDFNKLLI 447
           N       K+    IPS+GH+L+LDN   FN+ ++
Sbjct: 391 NSLGNCLEKASYLEIPSSGHNLFLDNPLSFNQSIV 425

>YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}
           ECM18Protein of unknown function, similar to Rlp24p
          Length = 453

 Score = 65.9 bits (159), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 86/347 (24%), Positives = 142/347 (40%), Gaps = 77/347 (22%)

Query: 156 NINSADVKH-LIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTR-----NK 209
           N N++ V+   + IHGY A    F +N     L  +   +++ID+P  G S+      N 
Sbjct: 119 NENTSTVRTPTLLIHGYAASSMSFFRNYPG--LSKHIRNLYSIDMPASGLSSVPSLEINT 176

Query: 210 KFPF----KYPRDSQLKV----------------QNWFHDKIHIWLQKRNLLNYPKNNLI 249
             P     K+  +++ KV                ++++ D+I  W     L    K N +
Sbjct: 177 TTPLPLDIKFIGENKFKVPYTINANHNKFVIQMYEDFYLDRIEQWRIDNKL---GKMN-V 232

Query: 250 VAHSLGAYLMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFSPFS 309
           V HS G YL  +YA K+P+   KL + SP GV ++               +W +N +  S
Sbjct: 233 VGHSFGGYLSFKYAVKYPNSVNKLCLVSPLGVERN---------------IWSVNNNFHS 277

Query: 310 IVRNSGIYGSKITSAWSYRRFKPLDLDHKQFEALHRY--------------AYSIFNRPG 355
               +  + +  +  +S R   P  L  +QF  L                 AYS      
Sbjct: 278 NTLYTIDFKNPNSKFYSKRNMIPKYLFEQQFHILRMMGPLGAKLCWNYIMAAYSRVPSLA 337

Query: 356 CGEYLLSFILSCGGNPRFSLE--DTLFQRENLSTE-LCD---------WGWIYGDNDWMD 403
             EY+       GG P  + +    LF R  L+ + L D            +YG  DWM+
Sbjct: 338 YKEYIFELFYGKGGIPEVTTDIFKALFSRCILAKDPLMDSLQYLNVKKLLIVYGQYDWMN 397

Query: 404 INGAKRVSRLINEQQ---KGKSDVHVIPSAGHHLYLDNYKDFNKLLI 447
                 + + +N  +   +G S +  IPS+GH+L+LDN + FN+ ++
Sbjct: 398 KKAGMFMVKELNNLKNCLEGASYLE-IPSSGHNLFLDNPESFNQSIV 443

>Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 85/325 (26%), Positives = 129/325 (39%), Gaps = 70/325 (21%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYST----------RNKKFPFKY 215
           + IHGY A    F +  E+  L NN   ++AIDLP  G S           + K   FK+
Sbjct: 74  VLIHGYAASSMAFYRTFES--LSNNIKDLYAIDLPANGASEAPVLQVDKTKKVKSLRFKH 131

Query: 216 PRDSQL------------------KVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAY 257
             D  +                  + +N+F D+I  W +   L    +   +V HS G Y
Sbjct: 132 IEDDVVIPVLDRRPPAEDIKSHLEQYENYFVDRIEQWRKDNKL----RKINVVGHSFGGY 187

Query: 258 LMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFS----------- 306
           +  +YA K+P+   KL + SP GV ++SI  + +   W     + L F+           
Sbjct: 188 ISFKYALKYPNSIDKLCLISPLGV-ENSIHAITHK--WEPNTTYPLTFTDPSSRYYTRKL 244

Query: 307 --PFSIVRNS-------GIYGSKITSAW-SYRRFKPLDLDHKQFEALHRYAYSIFNRPGC 356
             P  I  N        G  GSK+ S + S    K  D  +K +  LH +     N+   
Sbjct: 245 NVPRFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQIYKDY-LLHSFVGK--NQTVQ 301

Query: 357 GEYLLSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDWMDINGAKRVSRLINE 416
            + +  F      N      D +     L        ++YG++DWMD    K    L  E
Sbjct: 302 PQTIKVFTHLFERN--LIARDPIINNVGLLNPTMHVMFMYGEHDWMD----KYAGYLTTE 355

Query: 417 ---QQKGKSDVHVIPSAGHHLYLDN 438
              + K K+    +P AGH+L+LDN
Sbjct: 356 SMLKNKAKASYIEVPDAGHNLFLDN 380

>KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {ON}
           Anc_8.284 YDR125C
          Length = 391

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 89/342 (26%), Positives = 142/342 (41%), Gaps = 66/342 (19%)

Query: 156 NINSADVKH-LIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYS--------- 205
           N N++ +K   + IHGY A    F +      L  +   ++AIDLPG G S         
Sbjct: 61  NPNASKIKTPTLLIHGYAASSMAFHRTFNR--LSTDIKDLYAIDLPGNGLSSAPELSDVI 118

Query: 206 -------TRNKK---FPFKYPRDSQL------KVQNWFHDKIHIWLQKRNLLNYPKNNLI 249
                  T NK    F  K   D ++      K +N++  +I  W   R      K N +
Sbjct: 119 KMKDLKITLNKSKDGFTLKKAIDLEIEKANLAKYENYYLSRIDEW---RKFHGIEKLN-V 174

Query: 250 VAHSLGAYLMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNF---- 305
           + HS G ++  +YA   P+    LI+ SP G+ K +I  LNN+  +  E  + L+F    
Sbjct: 175 IGHSFGGFISFKYAITHPNQVNDLILVSPLGMEK-NIHSLNNN--FELETKYTLDFENPA 231

Query: 306 ----------------SPFSIVRNSGIYGSKITSAWSYRRFKPL-DLDHKQFEALHRYAY 348
                           +  +I+R  G  G ++   +    +K + D+ +K +  L+   Y
Sbjct: 232 SLYYARSFNVPSILFNNQLNILRWMGPLGGRMARQYIDMAYKKVPDVAYKNY--LYYVFY 289

Query: 349 SIFNRPGCGEYLLSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDWMD-INGA 407
              + P       + + S     R  + D L +       L     +YG++DWMD   G 
Sbjct: 290 DGKSFPKVTINNFTNMFSKNLLARDPIMDNLLKLRAKKVML-----VYGEHDWMDKYAGY 344

Query: 408 KRVSRLINEQQKGKSDVHV--IPSAGHHLYLDNYKDFNKLLI 447
             V  L     K K  VH   IP AGH+L+LDN  DF++ ++
Sbjct: 345 NMVELLSKSNYKLKDTVHYVEIPDAGHNLFLDNPTDFSENVV 386

>Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 83/334 (24%), Positives = 133/334 (39%), Gaps = 70/334 (20%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYST----------RNKKFPFKY 215
           + IHGY A    F +  E+  L +N   ++AIDLP  G S           + K   FK+
Sbjct: 74  VLIHGYAASSMAFYRTFES--LSDNIKDLYAIDLPANGASQAPALQVDKTKKIKPLRFKH 131

Query: 216 PRDSQL------------------KVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAY 257
             D  +                  + +N+F D+I  W +   L    +   +V HS G Y
Sbjct: 132 IEDDVVVPVLDKHPPAEDIKSHLEQYENYFVDRIEQWRKDNKL----RRINVVGHSFGGY 187

Query: 258 LMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFS----------- 306
           +  +YA K+P+   KL + SP GV ++SI  + +   W     + L F+           
Sbjct: 188 ISFKYALKYPNSIDKLCLISPLGV-ENSIHAIAHK--WEPNTTYPLTFTDPSSRYYTRKL 244

Query: 307 ---------PFSIVRNSGIYGSKITSAW-SYRRFKPLDLDHKQFEALHRYAYSIFNRPGC 356
                      ++++  G  GSK+ S + S    K  D  +K +  LH +     N+   
Sbjct: 245 NVPQFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQLYKDY-LLHSFVGK--NQTVQ 301

Query: 357 GEYLLSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDWMDINGAKRVSRLINE 416
            + +  F      N      D +     L        ++YG++DWMD    K    L  E
Sbjct: 302 PQTIKVFTHLFERN--LIARDPIINNVGLLNPATHVMFMYGEHDWMD----KYAGYLTTE 355

Query: 417 ---QQKGKSDVHVIPSAGHHLYLDNYKDFNKLLI 447
              + K K+    +P AGH+L+LDN   F   L+
Sbjct: 356 SMLKNKAKASYVEVPDAGHNLFLDNPHHFTSSLV 389

>KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 415

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 90/348 (25%), Positives = 137/348 (39%), Gaps = 103/348 (29%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWCI---HAIDLPGYGYS----------------- 205
           + +HGY A    F +N E +       CI   +AIDLP  G S                 
Sbjct: 100 LLLHGYAASSMAFHRNFEGL-----SKCIRDLYAIDLPANGLSPPQPLEIRCTEPQPLKI 154

Query: 206 -TRNKKFPFKYPRDS---QLKVQN---WFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYL 258
              N  F   Y  +S   +  +QN   ++ D +  W     L   P N  IVAHS G Y+
Sbjct: 155 EISNDTFKLPYTINSLHHKSAIQNFEDYYLDALEQWRLDNKL--GPIN--IVAHSFGGYI 210

Query: 259 MAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDLNF-SPFS-------- 309
             +YA K+P   ++L + SP GV ++     NN   W     + L+F +P S        
Sbjct: 211 SFRYAVKYPHAVKRLCLLSPLGVERNIFSVNNN---WRSNTQYKLDFENPASKFYIRKGP 267

Query: 310 ------------IVRNSGIYGSK-----ITSAWSYRRFKPLDLDHKQFE------ALHRY 346
                       ++R  G  G++     IT+A  Y R   L      FE      AL + 
Sbjct: 268 AIPPAIFELQTKVLRGLGPLGARLCWNYITAA--YARVPSLKYKQYIFEMFYGKNALTQT 325

Query: 347 AYSIFNRPGCGEYLLSFILSCGGNPRFSLEDTLFQRENLSTELC-----DWGWIYGDNDW 401
           +  IF     G +                 + L  R+ L   LC         +YGD+DW
Sbjct: 326 SKDIF----TGLF----------------TNRLLARDPLLDSLCHVRSKKLLLMYGDHDW 365

Query: 402 MDINGAKRVSRLINEQQKGKSDVHV--IPSAGHHLYLDNYKDFNKLLI 447
           M+    K    ++ E +K   D     + S+GH+L+LDN ++ N+L++
Sbjct: 366 MN---RKAGLEMVTEAKKLGIDAQYGEVSSSGHNLFLDNPEESNELIV 410

>Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {ON}
           complement(108945..110234) [1290 nt, 430 aa]
          Length = 429

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 86/348 (24%), Positives = 140/348 (40%), Gaps = 93/348 (26%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYST-----------------RN 208
           + IHGY A    + +      L +    ++AIDLP +G S                   +
Sbjct: 103 LLIHGYAASSLAYFRTFSG--LSDKIKNLYAIDLPSFGLSNAPPLDFKEKVSDIKIKLSD 160

Query: 209 KKFPFKYPRDSQL----------KVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYL 258
               FK    +++          K ++++ +KI  W +   L    K NL V HS G Y+
Sbjct: 161 DNTKFKISDSNRVDSLDLKKLIGKYEDYYVEKIEDWRKANKL---EKINL-VGHSFGGYI 216

Query: 259 MAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDL--------------- 303
             +YA K+P    +L + SP G+ +S+I  +NN+     E   DL               
Sbjct: 217 SFKYAIKYPDAINRLCLVSPLGM-ESNIHSVNNNFETKKEYPLDLEDPSSRFYAKERRIP 275

Query: 304 NF---SPFSIVRNSGIYGSKITSAWSYRRFKPLDLDHKQFEALHRYAYSIFNRPGCGEYL 360
           NF   +  +++R  G  GSK+   W+Y                   +Y     P   EYL
Sbjct: 276 NFLFKNQLNVLRWMGPIGSKL--CWNYI----------------NASYRRVPNPLFKEYL 317

Query: 361 LSFILSCGGNPRFSLE--DTLFQRENLSTE-LCD---------WGWIYGDNDWM-DINGA 407
              +   GG P  +++    LF R  L+ + + D            +YG++DWM ++ G 
Sbjct: 318 FELLYGKGGMPSVTIDIFTNLFTRSLLARDPIMDSISKLKAEKVLLLYGEHDWMNNLAGY 377

Query: 408 KRVSRLINEQQKGKSDVHVI--------PSAGHHLYLDNYKDFNKLLI 447
             V  L   Q K  +++  I        P AGH+L+LDN + FN  ++
Sbjct: 378 NMVESL--NQLKPNNNISTIDYANYVEVPDAGHNLFLDNPQFFNSAVL 423

>TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.284
           YDR125C
          Length = 405

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 90/374 (24%), Positives = 152/374 (40%), Gaps = 130/374 (34%)

Query: 166 IFIHGYG----------AGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYS---------- 205
           + +HGY           AGL  +IK+L            ++IDLP +G S          
Sbjct: 65  LLVHGYATSSLAYYRNFAGLSSYIKDL------------YSIDLPTFGLSKTPELPTRKV 112

Query: 206 TRNKKFP----------------FKYPRDS-------------QLKV-QNWFHDKIHIWL 235
           T+N K                  F+  +D              +L++ +N++ D+I  W 
Sbjct: 113 TKNLKVTLSNSNDKSDDPKKITSFQLSKDDIKHNEKYYNETKKELEINENYYIDRIEKWR 172

Query: 236 QKRNLLNYPKNNLIVAHSLGAYLMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPW 295
            +  L    K NL V HS G YL  +YA K+P   +KL + SP G+ +S+I  +NN   +
Sbjct: 173 IENKL---DKINL-VGHSFGGYLSYKYATKYPDSIEKLCLVSPLGM-ESNIYSINNK--F 225

Query: 296 WYEKLWDLNF--------------------SPFSIVRNSGIYGSKITSAWSYRRFKPLDL 335
             +K++++                      +  +++R  G  GS +T  W Y +     +
Sbjct: 226 ENDKIYEIEEEDPSSIFFTNTRTIPKFLFNNQLNVLRWLGPVGSTLT--WKYIKASYRRV 283

Query: 336 DHKQFEALHRYAYSIFNRPGCGEYLLSFILSCGGNPRFSLE--DTLFQRENLS----TEL 389
           D    +AL++            +Y+   I   GG    +++    LF  + L+    T+ 
Sbjct: 284 D----DALYK------------DYIHELIYGKGGMEETTIKTFTNLFTTKLLAKDPITDT 327

Query: 390 CD------WGWIYGDNDWMDINGAKRVSRLINEQQKGKSDVHV----------IPSAGHH 433
            D         +YG  DWM+     ++++ +NE  KG +   V          +P AGH+
Sbjct: 328 VDKLKAKNVLLLYGQEDWMNNYAGYQMTKKLNE-LKGYNTSKVGELNYATYMEVPEAGHN 386

Query: 434 LYLDNYKDFNKLLI 447
           L+LDN   FNK L+
Sbjct: 387 LFLDNPSFFNKALL 400

>CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa]
           {ON} similar to uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 386

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 108/262 (41%), Gaps = 62/262 (23%)

Query: 224 QNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYAFKFPSHFQKLIMCSPAGVTK 283
           ++++ + I  W ++ NL    K NL V HS G YL  +YA K+P    KL + SP G+ +
Sbjct: 146 EDYYVESIEQWRKENNL---DKFNL-VGHSFGGYLSYKYALKYPESVNKLCLLSPLGMER 201

Query: 284 -----------SSIKKLNNSPPWWY-----EKLWDLNF-SPFSIVRNSGIYGSKITSAWS 326
                      + + +L  S P  Y      K     F + FS++R  G  G K+     
Sbjct: 202 NIHSINNTFEENVVYELQESDPSSYLYTRKRKAPKFLFENQFSVLRWMGPIGDKLC---- 257

Query: 327 YRRFKPLDLDHKQFEALHRYAYSIFNRPGCGEYLLSFILSCGGNPRFSLEDT-----LFQ 381
                 L   +  +  +   AY         +YL    L   G   F+ ++      LF 
Sbjct: 258 ------LSFINSSYAKVPSQAYK--------DYLFESFL---GKKHFAKQNVHALKHLFT 300

Query: 382 RENLSTE----------LCDWGWIYGDNDWMD-INGAKRVSRL----INEQQKGKSDVHV 426
           R  L+ +          + D    YGD+DWM+   G   V RL    +     G +    
Sbjct: 301 RSLLARDPIMDTIDKLKVPDVSVFYGDHDWMNSYAGYLMVERLKKFRVASTSGGSASYLE 360

Query: 427 IPSAGHHLYLDNYKDFNKLLIK 448
           +P AGH+L+LDN   F+K L++
Sbjct: 361 VPDAGHNLFLDNPDYFSKKLVQ 382

>Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar to
           Ashbya gossypii AGR062C
          Length = 405

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 112/255 (43%), Gaps = 50/255 (19%)

Query: 222 KVQNWFHDKIHIWLQKRNL--LNYPKNNLIVAHSLGAYLMAQYAFKFPSHFQKLIMCSPA 279
           K+++++ D I +W +K +L  +N      +V HS G Y+  +Y+ K+P + +KL + SP 
Sbjct: 167 KLEDYYIDSIELWRRKNSLGAIN------LVGHSFGGYISFKYSIKYPQNVKKLCLISPI 220

Query: 280 GVTKSSIKKLNNSPPWWYEKLWDLNFSPFSIVRNSGIYGSKITSAWSYRRFKPLDLDHKQ 339
           GV ++     NN         W  N  P+SI      Y    +  ++ +   P  + ++Q
Sbjct: 221 GVERNIYSVHNN---------WRSN-CPYSID-----YEDPSSKHFANKTMIPEFVFNEQ 265

Query: 340 FEALH-----------RYAYSIFNRPGCGEYL-LSFILSCGGNP---------RFSLEDT 378
            + L            +Y  +++++     YL   F L  G N           +   ++
Sbjct: 266 TKLLRLMGPLGAKLGWKYINAVYSKVPNFLYLEFIFTLIYGKNVMTDTSRNIFTYLFTNS 325

Query: 379 LFQRENLSTELCDWG-----WIYGDNDWMDINGAKRVSRLINEQQKGKS-DVHVIPSAGH 432
           L  R+ +   L          +YG++DW+     K +    N+Q+   S  + V+P A H
Sbjct: 326 LLARDPMLDSLEHLHVDKLLMLYGEHDWVRSQPGKMMVEEFNKQRSHPSGTLTVVPDASH 385

Query: 433 HLYLDNYKDFNKLLI 447
           +L+LDN   FN  L+
Sbjct: 386 NLFLDNPVFFNVALL 400

>TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8.524
           YBR204C
          Length = 372

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 72/167 (43%), Gaps = 21/167 (12%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQN 225
           IFIHG G  L  F+  L+   L N  +   A+DLPG+G S  N ++           + N
Sbjct: 93  IFIHGLGGSLEQFLPLLKLTDLSNKSFI--AVDLPGFGQSEFNDEY----------NIAN 140

Query: 226 WFHDKIHIWLQKRNLLNYPKNN---LIVAHSLGAYLMAQY--AFKFPSHFQKLIMCSPAG 280
           +    I  +L+ +    Y   N   ++  HS+G YL   +   +K     QK+++ +P  
Sbjct: 141 YSMSSIIGFLKSQVFSRYLTTNTKIILTGHSMGCYLALHFYQQYKTEYQIQKIVLLAPPN 200

Query: 281 VTKSSIKKLNNSPPWWYEKL----WDLNFSPFSIVRNSGIYGSKITS 323
             ++ + K N S  +    +    W  +F      ++ G+  S I S
Sbjct: 201 PHETRLDKSNYSTRFIIRTMFSWSWIFDFYRKRFDQSKGLQSSGIKS 247

>TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.284
           YDR125C
          Length = 421

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 71/179 (39%), Gaps = 46/179 (25%)

Query: 156 NINSADVKH-LIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYS--------- 205
           N N++ +K   + IHGY A    + K      L  +   ++ IDLPG+G S         
Sbjct: 43  NANASTIKTPTVLIHGYAASSMAYYKTFR--YLTGSIKDLYTIDLPGFGLSASPKIIIND 100

Query: 206 -----------------TRNKKFPFKYPRDSQLKVQN------------WFHDKIHIWLQ 236
                            + N KF         L+  N            ++ D+I  W  
Sbjct: 101 HNRKKSQFDIKLIDSKDSNNNKFSISKKNLKLLENGNIEDKAFISAFDDYYIDRIEKW-- 158

Query: 237 KRNLLNYPKNNLIVAHSLGAYLMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPW 295
            R   N  K N ++ HS G Y+  +YA K+P   + L + SP G+ +S++  +NN   W
Sbjct: 159 -RKFNNLGKIN-VIGHSFGGYISFKYAIKYPDSIENLCLVSPFGM-ESNVYSINNYDDW 214

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 69/144 (47%), Gaps = 15/144 (10%)

Query: 308 FSIVRNSGIYGSKITSAWSYRRFKPLDLDHKQFEALHRYAYSIF-NRPGCGEYLLSFILS 366
           F++++  G  GSK+T ++  RR+     +H   EA   + + +F   P       S + +
Sbjct: 284 FNVLKCMGPLGSKLTWSFISRRY-----EHIASEAYQNFLFKLFATVPNVTINNFSNMFT 338

Query: 367 CGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDWMDINGAKRVSRLINEQQKGKSDVH- 425
                +  + D++ + ++    L      YG+NDWM+      ++  +N   KG S    
Sbjct: 339 RNLLAKDPIMDSINKLQSKKLLL-----FYGENDWMNKEAGFLMAEKLN-ILKGDSKYAN 392

Query: 426 --VIPSAGHHLYLDNYKDFNKLLI 447
              +P++GH+L LD+ K F+K LI
Sbjct: 393 WIEVPNSGHNLILDDPKFFSKNLI 416

>SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {ON}
           similar to uniprot|P38139 Saccharomyces cerevisiae
           YBR204C Hypothetical ORF
          Length = 392

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 82/176 (46%), Gaps = 31/176 (17%)

Query: 154 NININSA--DVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTRNKKF 211
           N+N+ +A  D    +FIHG G  L  F   L+ + LLN  +   ++DLPG+G S      
Sbjct: 119 NLNLRNAKSDSVVYVFIHGLGGTLAQFEPLLKLLSLLNKGF--FSMDLPGFGSSD----- 171

Query: 212 PFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLI-VAHSLGAYLMAQY--AFKFPS 268
                     +V+++   +I   +QK      P  NL+ + HS+G YL   +  AF+   
Sbjct: 172 ----------EVESYGMLEIVAIVQKTFAKLTPSRNLVLIGHSMGCYLAIHFCSAFQEQY 221

Query: 269 HFQKLIMCSPAGVTKSSIKKLNNSP--------PWWYEKLWDLNFSPFSIVRNSGI 316
            FQ+L++ +P  +    +++ +           PW ++ ++   F     +R+SGI
Sbjct: 222 SFQELVLLAPPSLDLPQVERTSTRVLMSLLFRWPWMFD-IYRTQFDQSRGLRSSGI 276

>KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {ON}
           Anc_8.524 YBR204C
          Length = 356

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 76/172 (44%), Gaps = 29/172 (16%)

Query: 124 AKFKTGKILKTQIED---NDDYYIN------EFCITPDTNI----NINSADVKHL-IFIH 169
           + ++ G  L +QI D     D+ +N      ++C      +    N+++A+ K L IFIH
Sbjct: 30  SSYEDGPTLSSQITDPANAGDFRLNFISTHEQYCTVNGIKVRVCHNLSTANGKTLSIFIH 89

Query: 170 GYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQNWFH- 228
           G G  L  F   L+ + L    +   AIDLPG+G S  +  +P          +Q   H 
Sbjct: 90  GLGGSLDQFFPLLKLLDLSEKYFV--AIDLPGFGKSDEHTDYPM---------IQVVKHI 138

Query: 229 DKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYAFKFPSHFQ--KLIMCSP 278
           D +   L     L +    LI  HS+G YL   +   F   ++  K+++ +P
Sbjct: 139 DAVISELLNEARLAFDTVRLI-GHSMGCYLTLHFMTLFSKKYRIGKVVLLAP 189

>NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON}
           Anc_8.524 YBR204C
          Length = 362

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 60/140 (42%), Gaps = 15/140 (10%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQN 225
           +FIHG G  L  F   L  + L  N++   A+DLPG+G S        +Y   +   V +
Sbjct: 93  LFIHGLGGVLEQFEPLLRLLDLNENKFL--ALDLPGFGKSD-------EYEDYNMFDVIS 143

Query: 226 WFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYAFKFPSH--FQKLIMCSPAGVTK 283
             H  +   + +R       N ++V HS+G Y+     +K  +   F+KL+  SP     
Sbjct: 144 IIHTIVDRLIPERT----TSNIVLVGHSMGCYISLHLFYKSYTRFSFKKLVFLSPPKPQL 199

Query: 284 SSIKKLNNSPPWWYEKLWDL 303
             ++K N    W    +  L
Sbjct: 200 DQLEKTNRKMQWLLRGILSL 219

>KLTH0E12188g Chr5 (1082142..1083152) [1011 bp, 336 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 336

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 56/128 (43%), Gaps = 18/128 (14%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQN 225
           +F HG G  L  F   L  +  LN  +   A+DLPG+G S     +         L+V  
Sbjct: 82  LFFHGLGGNLTQFEPLLRLLGELNEGFV--AMDLPGFGLSEEQDGY-------QMLQVTQ 132

Query: 226 WFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYAFKFPSHF--QKLIMCSPAGVTK 283
             HD    +LQ    +   K  ++V HS+G +L+  +A  F   F  +  +  SP   T 
Sbjct: 133 VIHDA---FLQ----ITDHKKIILVGHSMGCHLVLHFAILFGLEFDIKDSVFLSPPAPTL 185

Query: 284 SSIKKLNN 291
             ++K++ 
Sbjct: 186 PQLQKVST 193

>TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {ON}
           Anc_8.524 YBR204C
          Length = 348

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 58/130 (44%), Gaps = 18/130 (13%)

Query: 165 LIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQ 224
            +FIHG G  L  F   L  +   N  +   A DLPG+G S        +YP    +K  
Sbjct: 81  FLFIHGLGGTLEQFEPVLRELDQRNKSFL--AFDLPGFGKSDEWD----QYPMLDVVKSI 134

Query: 225 NWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYAFKFPSH--FQKLIMCSPAGVT 282
           +W    IH   Q  N L + K NLI  HS+G YL   +   F       +L++ +P    
Sbjct: 135 DWL---IH---QLTNNLKFEKLNLI-GHSMGCYLAVHFYLLFHESWCISRLVLLAPP--- 184

Query: 283 KSSIKKLNNS 292
           K ++ +L+ S
Sbjct: 185 KPNVDQLSKS 194

>Kwal_23.6592 s23 (1658078..1658572) [495 bp, 164 aa] {ON} [contig
           358] FULL
          Length = 164

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 49/113 (43%), Gaps = 16/113 (14%)

Query: 185 IPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYP 244
           IPLL   + + A+DLPG G S +          D+Q        +K+HI +Q   L  Y 
Sbjct: 34  IPLLAESYWVIAVDLPGQGDSDKPGD-----GYDTQT-----LANKLHILIQSLGLSRY- 82

Query: 245 KNNLIVAHSLGAYLMAQYAFKFPSHFQKLIMCSPA--GVTKSSIKKLNNSPPW 295
               + AH +GA++   Y+  F    +++ +      GVT   +  +N    W
Sbjct: 83  ---FLAAHDVGAWVAFPYSLLFGEEIERMALLDAGIPGVTLPEMLPINPDYAW 132

>Kwal_48.19391 s48 (3319..3870) [552 bp, 183 aa] {ON} YNR064C -
           Hypothetical ORF [contig 322] FULL
          Length = 183

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 52/123 (42%), Gaps = 19/123 (15%)

Query: 185 IPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYP 244
           IPLL   + + A+DLPG G S +          D+Q        +K+HI +Q   L  Y 
Sbjct: 53  IPLLAESYWVIAVDLPGQGDSDKPGDG-----YDTQT-----LANKLHILIQSLGLSRY- 101

Query: 245 KNNLIVAHSLGAYLMAQYAFKFPSHFQKLIMCSPA--GVTKSSIKKLNNSPPWWYEKLWD 302
               + AH +GA++   Y+  F    +++ +      GVT   +  +N    W   + W 
Sbjct: 102 ---FLAAHDVGAWVAFPYSLLFGEEIERMALLDAGIPGVTLPEMLPINPDYAW---RTWH 155

Query: 303 LNF 305
             F
Sbjct: 156 FPF 158

>Kwal_43.16490 s43 (51..911) [861 bp, 286 aa] {ON} YNR064C -
           Hypothetical ORF [contig 357] PARTIAL
          Length = 286

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 52/123 (42%), Gaps = 19/123 (15%)

Query: 185 IPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYP 244
           IPLL   + + A+DLPG G S +          D+Q        +K+HI +Q   L  Y 
Sbjct: 36  IPLLAESYWVIAVDLPGQGDSDKPGDG-----YDTQT-----LANKLHILIQSLGLSRY- 84

Query: 245 KNNLIVAHSLGAYLMAQYAFKFPSHFQKLIMCSPA--GVTKSSIKKLNNSPPWWYEKLWD 302
               + AH +GA++   Y+  F    +++ +      GVT   +  +N    W   + W 
Sbjct: 85  ---FLAAHDVGAWVAFPYSLLFGEEIERMALLDAGIPGVTLPEMLPINPDYAW---RTWH 138

Query: 303 LNF 305
             F
Sbjct: 139 FPF 141

>Kwal_26.9628 s26 (1300688..1301449) [762 bp, 254 aa] {ON} YNR064C -
           Hypothetical ORF [contig 363] PARTIAL
          Length = 254

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 52/123 (42%), Gaps = 19/123 (15%)

Query: 185 IPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYP 244
           IPLL   + + A+DLPG G S +          D+Q        +K+HI +Q   L  Y 
Sbjct: 53  IPLLAESYWVIAVDLPGQGDSDKPGDG-----YDTQT-----LANKLHILIQSLGLSRY- 101

Query: 245 KNNLIVAHSLGAYLMAQYAFKFPSHFQKLIMCSPA--GVTKSSIKKLNNSPPWWYEKLWD 302
               + AH +GA++   Y+  F    +++ +      GVT   +  +N    W   + W 
Sbjct: 102 ---FLAAHDVGAWVAFPYSLLFGEEIERMALLDAGIPGVTLPEMLPINPDYAW---RTWH 155

Query: 303 LNF 305
             F
Sbjct: 156 FPF 158

>Kwal_26.6639 s26 complement(252..1163) [912 bp, 303 aa] {ON}
           YNR064C - Hypothetical ORF [contig 294] FULL
          Length = 303

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 52/123 (42%), Gaps = 19/123 (15%)

Query: 185 IPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYP 244
           IPLL   + + A+DLPG G S +          D+Q        +K+HI +Q   L  Y 
Sbjct: 53  IPLLAESYWVIAVDLPGQGDSDKPGD-----GYDTQT-----LANKLHILIQSLGLSRY- 101

Query: 245 KNNLIVAHSLGAYLMAQYAFKFPSHFQKLIMCSPA--GVTKSSIKKLNNSPPWWYEKLWD 302
               + AH +GA++   Y+  F    +++ +      GVT   +  +N    W   + W 
Sbjct: 102 ---FLAAHDVGAWVAFPYSLLFGEEIERMALLDAGIPGVTLPEMLLINPDYAW---RTWH 155

Query: 303 LNF 305
             F
Sbjct: 156 FPF 158

>TDEL0G00150 Chr7 complement(22315..23214) [900 bp, 299 aa] {ON} 
          Length = 299

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 53/111 (47%), Gaps = 16/111 (14%)

Query: 165 LIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQ 224
           ++ +HG+ +    F +NL  IPLL  R+ + A D+PG+G++        +YP D +    
Sbjct: 38  ILLLHGFPSSSNMF-RNL--IPLLAARFYVVAPDIPGFGFT--------EYPEDYEFNFA 86

Query: 225 NWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYAFKFPSHFQKLIM 275
           N   + I  +L+  N+  Y     +     GA +  + A K PS    +++
Sbjct: 87  N-LTNSIEQFLKALNIKKYS----VYVFDYGAPIGFRLALKSPSAITGIVV 132

>Kwal_27.10170 s27 complement(227197..228078) [882 bp, 293 aa] {ON}
           YNR064C - Hypothetical ORF [contig 41] FULL
          Length = 293

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 159 SADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKY 215
           S D   ++ +HGY      F +NL  IPL+   + + A DLPG+G++T ++ F F +
Sbjct: 27  SRDKPTILLLHGYPTSSNMF-RNL--IPLIAASFHVVAPDLPGFGFTTMDEPFSFSF 80

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 64/154 (41%), Gaps = 13/154 (8%)

Query: 157 INSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYP 216
           +N     HL FIHG G  LG F   L    L   ++    +DLPG+G S   + +  K  
Sbjct: 77  VNDGHPLHL-FIHGLGGSLGQFEPLLRLTHLKGKKFL--TLDLPGFGQSDELESYSMKSV 133

Query: 217 RDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYAFKFPSHF--QKLI 274
            ++   V +     +    QK    N     ++  HS+G YL   +   +  ++  +K+ 
Sbjct: 134 IETIRSVVD-----LATGNQKSLGENTQLKLILTGHSMGCYLCLHFFETYSKNYDIRKIA 188

Query: 275 MCSPAGVTKSSIKKLNNSPPWWYEKLWDLNFSPF 308
           + SP     +S+ K N    W    LW +   PF
Sbjct: 189 LLSPPKPIMTSLSKRNYWTQW---ALWGVFKLPF 219

>ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 349

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 56/124 (45%), Gaps = 20/124 (16%)

Query: 158 NSADVKHL-IFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYP 216
           +S+ V  L +FIHG G  L  F   L  +  ++ R+   A+DLPG+G S    ++P    
Sbjct: 78  DSSQVHELFLFIHGLGGELEQFEPLLRLVDAMDQRFL--ALDLPGFGKSDEWDEYPMLKV 135

Query: 217 RDSQLKVQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQY--AFKFPSHFQKLI 274
            ++  ++   F+                   ++V HS+G YL + +  A+       +++
Sbjct: 136 VETIEEIAAKFN---------------AAKIVLVGHSMGCYLTSHFYEAYHKVHSINRIV 180

Query: 275 MCSP 278
           + SP
Sbjct: 181 LLSP 184

>CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa]
           {ON} weakly similar to uniprot|P38139 Saccharomyces
           cerevisiae YBR204c peroxisomal serine-active lipase
          Length = 354

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 62/141 (43%), Gaps = 20/141 (14%)

Query: 156 NINSADVKHLIF--IHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYS-TRNKKFP 212
           NI   + +  +F  IHG G  +  F   ++ + LL  R  + A+DLPG+G S +    + 
Sbjct: 67  NIRDGERRDSVFLLIHGLGGSMDQFQPLMKLLTLLKYR--VIALDLPGFGQSGSSTNGYD 124

Query: 213 FKYPRDSQLK-VQNWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYAFKFPSHF- 270
             Y      K V N   +K  I  +            +V HS+G Y+ + +   +   + 
Sbjct: 125 MLYVTSVVKKVVDNNIENKTDIDFK------------VVGHSMGCYIASHFVQMYHEEYN 172

Query: 271 -QKLIMCSPAGVTKSSIKKLN 290
             KL++  P   + S++++ N
Sbjct: 173 IDKLVLTCPPPPSISTLRQDN 193

>YNR064C Chr14 complement(749136..750008) [873 bp, 290 aa] {ON}
           Epoxide hydrolase, member of the alpha/beta hydrolase
           fold family; may have a role in detoxification of
           epoxides
          Length = 290

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 51/110 (46%), Gaps = 16/110 (14%)

Query: 165 LIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQ 224
           ++ +HG+      F +NL  IPLL  ++ I A DLPG+G++   + + F +  DS  +  
Sbjct: 32  ILLLHGFPTSSNMF-RNL--IPLLAGQFHIIAPDLPGFGFTETPENYKFSF--DSLCESI 86

Query: 225 NWFHDKIHIWLQKRNLLNYPKNNLIVAHSLGAYLMAQYAFKFPSHFQKLI 274
            +  D + I      + +Y           G+ +  + A KFPS    ++
Sbjct: 87  GYLLDTLSIEKFAMYIFDY-----------GSPVGFRLALKFPSRITGIV 125

>CAGL0J08547g Chr10 (846742..847881) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12405 Saccharomyces cerevisiae YOR084w
          Length = 379

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 51/127 (40%), Gaps = 13/127 (10%)

Query: 164 HLIFIHGYGAGLGFFIKNLENIPLLNNRWCIH---AIDLPGYGYSTRNKKFPFKYPRDSQ 220
           +L+F HG G     +  + + I  LN+ W +     ID   +G S    K         +
Sbjct: 57  NLVFCHGSGMNRAIWEYHADRIADLNSNWVVDKIVVIDQVNHGDSALLNK--------GR 108

Query: 221 LKVQ-NWFHDKIHIWLQKRNLLNYPKN-NLIVAHSLGAYLMAQYAFKFPSHFQKLIMCSP 278
           L ++ +WF     I        N+  N N+IV HS+G +         P+ FQ  I+  P
Sbjct: 109 LGLEFDWFDGARDICKVAEEEFNFMNNYNVIVGHSMGGFQTLAAVAHNPNLFQLAIVIEP 168

Query: 279 AGVTKSS 285
             +   S
Sbjct: 169 VIIKDPS 175

>Skud_14.400 Chr14 complement(717609..718490) [882 bp, 293 aa] {ON}
           YNR064C (REAL)
          Length = 293

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 165 LIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKY 215
           ++ +HG+ +    F +NL  IPLL +++ + A DLPG+G+S     + F +
Sbjct: 32  IVLLHGFPSSSNMF-RNL--IPLLASQFHVIAPDLPGFGFSETPDDYTFSF 79

>Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR204C
           - Hypothetical ORF [contig 26] FULL
          Length = 336

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 46/107 (42%), Gaps = 20/107 (18%)

Query: 166 IFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQN 225
           +FIHG G  L  F   L  + +LN  +    IDLPG+G+S     +       S L +  
Sbjct: 82  VFIHGLGGTLTQFEPLLRVLDVLNEGFL--TIDLPGFGHSDELDSY-------SMLDIAK 132

Query: 226 WFHDKIHIWLQKRNLLNYPKNN--LIVAHSLGAYLMAQYAFKFPSHF 270
                    + +  L+   KN   ++V HS+G ++   +   + + F
Sbjct: 133 ---------IIREVLVETTKNKKVIVVGHSMGCHIALHFGQLYNAEF 170

>Kwal_26.9638 s26 (1304546..1304911) [366 bp, 121 aa] {OFF} YNR064C
           - Hypothetical ORF [contig 323] FULL
          Length = 121

 Score = 32.0 bits (71), Expect = 1.2,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 36/78 (46%), Gaps = 14/78 (17%)

Query: 185 IPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYP 244
           IPLL   + + A+DLPG G S +        P D     Q    +K+HI +Q   L  Y 
Sbjct: 53  IPLLAESYWVIAVDLPGQGDSDK--------PGDG-YDTQT-LANKLHILIQSLGLSRY- 101

Query: 245 KNNLIVAHSLGAYLMAQY 262
               + AH +GA++   Y
Sbjct: 102 ---FLAAHDVGAWVAFPY 116

>Suva_14.424 Chr14 complement(736902..737771) [870 bp, 289 aa] {ON}
           YNR064C (REAL)
          Length = 289

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 165 LIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKY 215
           ++ +HG+      F +NL  IPLL   + + A DLPG+G+S     + F +
Sbjct: 32  IVLLHGFPTSSNMF-RNL--IPLLAGHFHVIAPDLPGFGFSETPDDYKFTF 79

>SAKL0E14674g Chr5 (1211477..1212610) [1134 bp, 377 aa] {ON} similar
           to uniprot|Q12405 Saccharomyces cerevisiae YOR084W
           Putative lipase of the peroxisomal matrix
           transcriptionally activated by Yrm1p along with genes
           involved in multidrug resistance
          Length = 377

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 61/152 (40%), Gaps = 17/152 (11%)

Query: 158 NSADVKHLIFIHGYGAGLGFFIKNLENIPLLNNRWC---IHAIDLPGYGYSTRNKKFPFK 214
           NS  V + +F+HG G     +   L +I   ++ W    I  ID   +G S         
Sbjct: 56  NSKTVVNFVFLHGSGMNRSVWEYYLADIIDNDSGWSCGKILLIDQVNHGDSAV------- 108

Query: 215 YPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKN----NLIVAHSLGAYLMAQYAFKFPSHF 270
             RD    + +W      +     + L YPK     N++V HS+G +        +P  F
Sbjct: 109 LNRDKLGTIFDWSDGARDVCKIAMDEL-YPKPANTINVVVGHSMGGFQALCCGVLYPGLF 167

Query: 271 QKLIMCSPAGVTK--SSIKKLNNSPPWWYEKL 300
           Q +I   P  + K  S+ K +   P  +Y+ L
Sbjct: 168 QLIITIEPVVLMKNISNPKNITKVPGNFYDAL 199

>Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 40/206 (19%), Positives = 75/206 (36%), Gaps = 50/206 (24%)

Query: 208 NKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLL--------------NYPKNNL----- 248
           N   P  YP  + L  Q W  ++I  W Q  +++               +P N L     
Sbjct: 362 NMMVPRPYPAGNVLLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQA 421

Query: 249 ---IVAHSLGAYLMAQYAFK------FPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEK 299
               V +++GA L A++A +      FP    ++I+    G  + ++++L+    W    
Sbjct: 422 LWGSVGYTMGACLGAEFAVQEINKNEFPPTKHRVILFMGDGAFQLTVQELSTIVKW---- 477

Query: 300 LWDLNFSPFSIVRNSGIYGSKITSAWSYRRFKPLDLDHKQFEALHRYAYSIFNRPGCGEY 359
                 +P+  V N+          +S  RF     D   ++        +    GC  Y
Sbjct: 478 ----GLTPYIFVMNN--------QGYSVDRFLHHRSDASYYDIQPWNYLGLLRVFGCANY 525

Query: 360 LLSFILSCG------GNPRFSLEDTL 379
               I++ G       +P F++ D +
Sbjct: 526 ETKKIITVGEFRSLINDPNFAINDKI 551

>SAKL0F07744g Chr6 complement(592416..593996) [1581 bp, 526 aa] {ON}
           similar to uniprot|P43609 Saccharomyces cerevisiae
           YFR037C RSC8 One of 15 subunits of the 'Remodel the
           Structure of Chromatin' (RSC) complex essential for
           viability and mitotic growth homolog of SWI/SNF subunit
           Swi3p but unlike Swi3p does not activate transcription
           of reporters
          Length = 526

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 11/64 (17%)

Query: 115 KTLP-FFSNGAKFKTGKILKTQIEDNDDYYINEFCITPDTNININSA------DVKHLIF 167
           K LP FF + ++FKT K+ K    D  D+ +N + ++P   + + +A      DV  ++ 
Sbjct: 80  KALPDFFDDSSRFKTPKVYK----DVRDFLVNTYRLSPYEYLTVTAARRNIALDVASIVK 135

Query: 168 IHGY 171
           IH +
Sbjct: 136 IHSF 139

>SAKL0E14564g Chr5 complement(1201558..1204242) [2685 bp, 894 aa]
           {ON} some similarities with uniprot|P36165 YKR089C
           Saccharomyces cerevisiae STC1 Protein of unknown
           function found in lipid particles potential Cdc28p
           substrate
          Length = 894

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 2/43 (4%)

Query: 97  QDYKIFQKDPERLQID--LLKTLPFFSNGAKFKTGKILKTQIE 137
           +D+ IFQ D E+ + +  L+K   FF NG  F    ++KT IE
Sbjct: 284 KDFNIFQDDSEKSESENLLIKISRFFKNGTWFDNKHLVKTMIE 326

>KLLA0A10395g Chr1 complement(908097..908981) [885 bp, 294 aa] {ON}
           similar to uniprot|P53750 Saccharomyces cerevisiae
           YNR064C
          Length = 294

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 32/51 (62%), Gaps = 3/51 (5%)

Query: 165 LIFIHGYGAGLGFFIKNLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKY 215
           ++ +HGY      F ++L  IPL+++++ + A DLPG+G++   + + + +
Sbjct: 33  IVLLHGYPTSSTMF-RHL--IPLISDKFHVIAPDLPGFGFTEVPEDYHYSF 80

>Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 54/134 (40%), Gaps = 36/134 (26%)

Query: 212 PFKYPRDSQLKVQNWFHDKIHIWLQKRNLL--------------NYPKNNL--------I 249
           P  YP  + L  Q W  ++I  W Q  +++               +P N L         
Sbjct: 366 PRPYPAGNVLLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGS 425

Query: 250 VAHSLGAYLMAQYAF------KFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDL 303
           V +++GA L A++A       KFP+   ++I+    G  + ++++L+    W        
Sbjct: 426 VGYTMGACLGAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKW-------- 477

Query: 304 NFSPFSIVRNSGIY 317
             +P+  V N+  Y
Sbjct: 478 GLTPYIFVMNNQGY 491

>YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}
           THI3Probable alpha-ketoisocaproate decarboxylase, may
           have a role in catabolism of amino acids to long-chain
           and complex alcohols; required for expression of enzymes
           involved in thiamine biosynthesis
          Length = 609

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 40/202 (19%), Positives = 74/202 (36%), Gaps = 50/202 (24%)

Query: 212 PFKYPRDSQLKVQNWFHDKIHIWLQKRNLL--------------NYPKNNL--------I 249
           P  YP  + L  Q W  ++I  W Q  +++               +P N L         
Sbjct: 366 PRPYPAGNVLLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGS 425

Query: 250 VAHSLGAYLMAQYAF------KFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDL 303
           V +++GA L A++A       KFP+   ++I+    G  + ++++L+    W        
Sbjct: 426 VGYTMGACLGAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKW-------- 477

Query: 304 NFSPFSIVRNSGIYGSKITSAWSYRRFKPLDLDHKQFEALHRYAYSIFNRPGCGEYLLSF 363
             +P+  V N+          +S  RF     D   ++        +    GC  Y    
Sbjct: 478 GLTPYIFVMNN--------QGYSVDRFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKK 529

Query: 364 ILSCG------GNPRFSLEDTL 379
           I++ G       +P F+  D +
Sbjct: 530 IITVGEFRSMISDPNFATNDKI 551

>Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON}
           YDL080C (REAL)
          Length = 621

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 40/202 (19%), Positives = 74/202 (36%), Gaps = 50/202 (24%)

Query: 212 PFKYPRDSQLKVQNWFHDKIHIWLQKRNLL--------------NYPKNNL--------I 249
           P  YP  + L  Q W  ++I  W Q  +++               +P N L         
Sbjct: 366 PRPYPAGNVLLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGS 425

Query: 250 VAHSLGAYLMAQYAF------KFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWDL 303
           V +++GA L A++A       KFP    ++I+    G  + ++++L+    W        
Sbjct: 426 VGYTMGACLGAEFAVQEIKKDKFPVTKHRVILFMGDGAFQLTVQELSTIVKW-------- 477

Query: 304 NFSPFSIVRNSGIYGSKITSAWSYRRFKPLDLDHKQFEALHRYAYSIFNRPGCGEYLLSF 363
             +P+  V N+          +S  RF     D   ++        +    GC  Y    
Sbjct: 478 GLTPYIFVMNN--------QGYSVDRFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKK 529

Query: 364 ILSCG------GNPRFSLEDTL 379
           I++ G       +P F++ D +
Sbjct: 530 IITVGEFRSMIDDPEFAINDKI 551

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.139    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,270,443
Number of extensions: 2387145
Number of successful extensions: 5852
Number of sequences better than 10.0: 90
Number of HSP's gapped: 5782
Number of HSP's successfully gapped: 108
Length of query: 456
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 343
Effective length of database: 40,524,141
Effective search space: 13899780363
Effective search space used: 13899780363
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)