Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G009803.486ON23423411561e-162
NCAS0E008503.486ON2302174331e-52
Smik_6.2223.486ON2302284261e-51
Skud_7.4373.486ON2302294225e-51
YGR126W3.486ON2302284149e-50
Suva_7.4143.486ON2302293903e-46
CAGL0I10604g3.486ON2112353711e-43
KNAG0B008503.486ON2252443547e-41
TDEL0D055403.486ON2162393182e-35
KAFR0C019203.486ON2232223052e-33
SAKL0F02904g3.486ON2222103032e-33
KLTH0F14696g3.486ON2191632991e-32
TPHA0D032503.486ON2191672807e-30
Kwal_55.212153.486ON1421422712e-29
KLLA0E04709g3.486ON1661452026e-19
Kpol_1017.103.486ON2341631391e-09
KAFR0C020303.503ON624711252e-07
KLTH0G02266g3.503ON644861243e-07
AFR322C3.503ON592591225e-07
TBLA0D029003.503ON691571201e-06
KNAG0B007303.503ON622841191e-06
Suva_16.4843.503ON622741191e-06
Suva_7.4253.503ON6131171181e-06
Kwal_47.189193.503ON640611173e-06
SAKL0F02442g3.503ON610711163e-06
Smik_16.4083.503ON622741164e-06
YGR138C (TPO2)3.503ON6141171154e-06
YPR156C (TPO3)3.503ON622741137e-06
Skud_7.4483.503ON611671138e-06
Skud_16.4503.503ON622741121e-05
CAGL0I10384g3.503ON630911121e-05
Smik_6.2333.503ON6141171102e-05
NCAS0E007503.503ON620741102e-05
Kpol_1017.33.503ON621701083e-05
TDEL0D057103.503ON616941084e-05
TPHA0D033103.503ON613571084e-05
NCAS0F036203.503ON634751074e-05
KLLA0E03829g3.503ON609811066e-05
NDAI0I027703.503ON626581057e-05
ZYRO0G19646g3.503ON59455910.005
KLLA0D13640g3.394ON357167701.5
NDAI0D024105.113ON2002123693.0
TBLA0C044703.490ON222106663.9
KNAG0F007302.1ON1609134674.6
Smik_14.921.119ON97138675.2
Ecym_44773.394ON354153665.6
Kwal_23.63146.336ON31160655.8
KLTH0F13200g3.394ON359135648.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G00980
         (234 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON...   449   e-162
NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON...   171   1e-52
Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W (...   168   1e-51
Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W (...   167   5e-51
YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative pro...   164   9e-50
Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W (...   154   3e-46
CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa] ...   147   1e-43
KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON...   140   7e-41
TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3....   127   2e-35
KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.48...   122   2e-33
SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {O...   121   2e-33
KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakl...   119   1e-32
TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.48...   112   7e-30
Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W...   108   2e-29
KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {O...    82   6e-19
Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON...    58   1e-09
KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {O...    53   2e-07
KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly...    52   3e-07
AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}...    52   5e-07
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    51   1e-06
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    50   1e-06
Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {...    50   1e-06
Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON...    50   1e-06
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    50   3e-06
SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly...    49   3e-06
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    49   4e-06
YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}  ...    49   4e-06
YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON} ...    48   7e-06
Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON...    48   8e-06
Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {...    48   1e-05
CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} high...    48   1e-05
Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON...    47   2e-05
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               47   2e-05
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    46   3e-05
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    46   4e-05
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    46   4e-05
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    46   4e-05
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    45   6e-05
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     45   7e-05
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    40   0.005
KLLA0D13640g Chr4 (1176601..1177674) [1074 bp, 357 aa] {ON} unip...    32   1.5  
NDAI0D02410 Chr4 (554265..560273) [6009 bp, 2002 aa] {ON} Anc_5....    31   3.0  
TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....    30   3.9  
KNAG0F00730 Chr6 (127002..131831) [4830 bp, 1609 aa] {ON} Anc_2....    30   4.6  
Smik_14.92 Chr14 (167182..170097) [2916 bp, 971 aa] {ON} YNL243W...    30   5.2  
Ecym_4477 Chr4 (970072..971136) [1065 bp, 354 aa] {ON} similar t...    30   5.6  
Kwal_23.6314 s23 (1526391..1527326) [936 bp, 311 aa] {ON} YCR069...    30   5.8  
KLTH0F13200g Chr6 complement(1085074..1086153) [1080 bp, 359 aa]...    29   8.5  

>NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON}
           Anc_3.486 YGR126W
          Length = 234

 Score =  449 bits (1156), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 222/234 (94%), Positives = 222/234 (94%)

Query: 1   MTHSGNIISADNTDNEXXXXXXXXXXXXYQPEPFTGLKGNELPNAQPSTTATTTEQDHDD 60
           MTHSGNIISADNTDNE            YQPEPFTGLKGNELPNAQPSTTATTTEQDHDD
Sbjct: 1   MTHSGNIISADNTDNEFDDISSFSSIDSYQPEPFTGLKGNELPNAQPSTTATTTEQDHDD 60

Query: 61  TVISSHSHDTKHGEEPSRTSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNT 120
           TVISSHSHDTKHGEEPSRTSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNT
Sbjct: 61  TVISSHSHDTKHGEEPSRTSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNT 120

Query: 121 RKKSVADINTPLNAGTAEFPEEYRIETETGLVKAKTIESLRRQESIASANSRRSQDQGSF 180
           RKKSVADINTPLNAGTAEFPEEYRIETETGLVKAKTIESLRRQESIASANSRRSQDQGSF
Sbjct: 121 RKKSVADINTPLNAGTAEFPEEYRIETETGLVKAKTIESLRRQESIASANSRRSQDQGSF 180

Query: 181 KSARTNNTRKSRASSSLDPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLFD 234
           KSARTNNTRKSRASSSLDPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLFD
Sbjct: 181 KSARTNNTRKSRASSSLDPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLFD 234

>NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON}
           Anc_3.486 YGR126W
          Length = 230

 Score =  171 bits (433), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 110/217 (50%), Positives = 137/217 (63%), Gaps = 23/217 (10%)

Query: 29  YQPEPFTGLKGNELPNAQPSTT--------ATTTEQDHDD-TVISSHSHDTKHGEEPSRT 79
           YQPEPFTG+K    P A   T          T  +Q+H + T  SSH+ D       SRT
Sbjct: 26  YQPEPFTGVKE---PTAYKGTDRKDTLSGDETELKQEHTNATATSSHTKDGI----TSRT 78

Query: 80  STATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADINTPLNAGTAE- 138
           S +TL++ DSN   IE+ +T+N     TETL SL  +GL+  KK+  DIN PL +  A+ 
Sbjct: 79  SMSTLRRPDSNA--IERVITSNAKEGNTETLGSLAAKGLDLNKKATLDINAPLTSNPADV 136

Query: 139 -FPEEYRIETETGLVKAKTIESLRRQESIASANSRRSQDQGSFKSARTNNTRKSRASSSL 197
            FPEEY +ETETGLVKAKTIE+LRR+ S  S+ +RR  D  S KS  T  ++  R++ SL
Sbjct: 137 AFPEEYNLETETGLVKAKTIETLRRETSRVSS-TRRGDDVVSHKSQATGKSQ--RSAQSL 193

Query: 198 DPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLFD 234
              KLN+AVEKNKKELEK  KHK QKG+KGF NRLFD
Sbjct: 194 QAEKLNLAVEKNKKELEKIEKHKHQKGLKGFMNRLFD 230

>Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  168 bits (426), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 143/228 (62%), Gaps = 13/228 (5%)

Query: 13  TDNEXXXXXXXXXXXXYQPEPFTGLKGNELPNAQP---STTATTTEQDHDDTVISSHSHD 69
           TDNE            Y+PEPFTG K ++LP+ QP   + T     Q  +D ++      
Sbjct: 10  TDNEYEDISSFSSIDSYKPEPFTGFKDSQLPD-QPLMKNDTIVGKGQSENDDILDDQHRH 68

Query: 70  TKHGEEPSRTSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADIN 129
           +      S  S++TLK+  SN   IEK +T N +   +ETLDSL + GLN +KK++ DI 
Sbjct: 69  SDVH---SHHSSSTLKRPTSN--SIEKMVTQNALEGTSETLDSLKEDGLNLKKKALPDIT 123

Query: 130 TPL--NAGTAEFPEEYRIETETGLVKAKTIESLRRQES-IASANSRRSQDQGSFKSARTN 186
            P+  +A  A FPEEYR+ETETGLVK KT+E+LRR++S ++S     + D     S R+ 
Sbjct: 124 APVTNSAHDATFPEEYRLETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHSTRSK 183

Query: 187 NTRKSRASSSLDPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLFD 234
            T  S+  SSL+PNKLNMAVEKNKK++E+Y KHK +KGIKGFF+R+FD
Sbjct: 184 VTTNSQG-SSLEPNKLNMAVEKNKKKIEQYQKHKSEKGIKGFFHRIFD 230

>Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  167 bits (422), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 100/229 (43%), Positives = 142/229 (62%), Gaps = 15/229 (6%)

Query: 13  TDNEXXXXXXXXXXXXYQPEPFTGLKGNELPNAQP----STTATTTEQDHDDTVISSHSH 68
           TDNE            Y+PEPFTG K ++ P  QP     T     + ++++ +   H  
Sbjct: 10  TDNEYEDISSFSSIDSYKPEPFTGFKDSQAPE-QPLLKNDTIVGKAQSENEENIDEQH-- 66

Query: 69  DTKHGEEPSRTSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADI 128
             +H +  S  S++TLK+  SN   IEK +T N +   +ET DSL ++GLN  KK++ DI
Sbjct: 67  --RHSDVYSHHSSSTLKRPSSN--SIEKMITHNALEGNSETADSLKREGLNLNKKALPDI 122

Query: 129 NTPL--NAGTAEFPEEYRIETETGLVKAKTIESLRRQES-IASANSRRSQDQGSFKSART 185
             P+  +A    FPEEYR+ETETGLVK KT+E+L+R++S ++SA    + D     S R+
Sbjct: 123 TAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRS 182

Query: 186 NNTRKSRASSSLDPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLFD 234
             T  S+  SSL+ +KLNMAVEKNKK++E+Y KHK +KGIKGFF+R+FD
Sbjct: 183 KVTTYSQG-SSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 230

>YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to both the cytoplasm and
           the nucleus and is induced in response to the
           DNA-damaging agent MMS
          Length = 230

 Score =  164 bits (414), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 138/228 (60%), Gaps = 13/228 (5%)

Query: 13  TDNEXXXXXXXXXXXXYQPEPFTGLKGNELPNAQP---STTATTTEQDHDDTVISSHSHD 69
           TDNE            Y+PEPFTG K +E P  QP   + T     Q  DD+ +      
Sbjct: 10  TDNEYEDISSFSSIDSYKPEPFTGFKDSEAPE-QPLLKNDTIVGKGQLEDDSNVDDQHRH 68

Query: 70  TKHGEEPSRTSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADIN 129
           +      S  S++TLK+  SN   IEK +T N +   +ET+DSL + GLN  KK++ DI 
Sbjct: 69  SDVH---SHHSSSTLKRPTSN--SIEKMVTHNALEGNSETVDSLKEDGLNLNKKALPDIT 123

Query: 130 TPL--NAGTAEFPEEYRIETETGLVKAKTIESLRRQES-IASANSRRSQDQGSFKSARTN 186
            P+  +A  A FPEEYR+ETETGLVK KT+ESL+R++S ++S       D     S R+ 
Sbjct: 124 APVTNSAHDAAFPEEYRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHSTRSK 183

Query: 187 NTRKSRASSSLDPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLFD 234
            T  S+  SSL+PNKLNMAVEKNKK +EKY KHK +KGIKGFF+R+FD
Sbjct: 184 VTTNSQG-SSLEPNKLNMAVEKNKKRIEKYQKHKSEKGIKGFFHRIFD 230

>Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  154 bits (390), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 102/229 (44%), Positives = 138/229 (60%), Gaps = 15/229 (6%)

Query: 13  TDNEXXXXXXXXXXXXYQPEPFTGLKGNELPNAQP----STTATTTEQDHDDTVISSHSH 68
           TDNE            Y+PEPFTG K ++ P  QP     T     + ++DD+V      
Sbjct: 10  TDNEYEDISSFSSIDSYKPEPFTGFKDSQAPE-QPLLKNDTIVGKGQSENDDSV----DD 64

Query: 69  DTKHGEEPSRTSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADI 128
             +H +  S  S++TLK+  SN   IEK +T N +   +ET+DSL K+GLN  KK   DI
Sbjct: 65  QHRHSDVHSHHSSSTLKRPTSN--SIEKMVTHNALEGNSETVDSLKKEGLNLNKKGTPDI 122

Query: 129 NTPL--NAGTAEFPEEYRIETETGLVKAKTIESLRRQES-IASANSRRSQDQGSFKSART 185
             P+  +A  A FPEEYR+ETETGLVK KT+E+L+R++S ++ A      D     S R+
Sbjct: 123 TAPVTNSAHDAAFPEEYRLETETGLVKLKTLETLKREDSRVSGAKKDHGHDHTDAHSTRS 182

Query: 186 NNTRKSRASSSLDPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLFD 234
             T  S+ SS L+ +KLN+AVEKNKK +EKY KHK +KGIKG F+R+FD
Sbjct: 183 KATAYSQGSS-LESDKLNIAVEKNKKRIEKYQKHKGEKGIKGLFHRMFD 230

>CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa]
           {ON} similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126w
          Length = 211

 Score =  147 bits (371), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 97/235 (41%), Positives = 137/235 (58%), Gaps = 25/235 (10%)

Query: 1   MTHSGNIISADNTDNEXXXXXXXXXXXXYQPEPFTGLKGNELPNAQPSTTATTTEQDHDD 60
           M+++G   +  +TD E            Y+PEPFTGL+  +  N   S  AT   Q    
Sbjct: 1   MSYNG---TTSDTDYEVEDISSFSSVDSYKPEPFTGLEHTK--NENLSRKATNASQG--- 52

Query: 61  TVISSHSHDTKHGEEPSRTSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNT 120
                    T   +  S+ S ATLKKLDS    IEK +T N +   +ET++SL  +GL+ 
Sbjct: 53  ---------TYMDDATSKHSGATLKKLDSLA--IEKVVTQNAVAGNSETIESLKAKGLDM 101

Query: 121 RKKSVADINTPLNA-GTAEFPEEYRIETETGLVKAKTIESLRRQESIASANSRRSQDQGS 179
           ++K++ D N PL   GT +FPEEYR+ET+TGLVK KT+E+L+R+ +  S NS  S    S
Sbjct: 102 QRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKSTQVSRNSDLSSKDKS 161

Query: 180 FKSARTNNTRKSRASSSLDPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLFD 234
              +++N +  S  +      K+NMAVE+NKKE+ KY KHK +KGIKGFF+R+FD
Sbjct: 162 ISKSQSNKSEVSDIA-----QKINMAVERNKKEIAKYQKHKSEKGIKGFFHRMFD 211

>KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON}
           Anc_3.486 YGR126W
          Length = 225

 Score =  140 bits (354), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 137/244 (56%), Gaps = 31/244 (12%)

Query: 1   MTHSGNIISADNTDNEXXXXXXXXXXXXYQPEPFTGLKGNELPNAQPSTTATTTEQDHD- 59
           M++  +I+    TD E            Y+PEPF G                T E+ HD 
Sbjct: 1   MSNRSDIV----TDPEFDEVSSFSSVDSYKPEPFVGF--------------GTEEEQHDS 42

Query: 60  -----DTVISSHSHDTKHGEEPS----RTSTATLKKLDSNVNDIEKTMTTNIMNDKTETL 110
                DT+++S          PS    + S+ TL K DSN   IE+ +T N MN+++E+ 
Sbjct: 43  RLFKNDTILNSEDLAENTANTPSDLNSKASSTTLGKRDSNA--IERVVTKNAMNNQSESA 100

Query: 111 DSLVKQGLNT-RKKSVADINTPLNAGTAEFPEEYRIETETGLVKAKTIESLRRQESIASA 169
           D+L  +GL+T +++++ DIN PL    + FPEEY++ETETGLVK KTIESL+ + S  + 
Sbjct: 101 DALRSKGLDTTKRRNIPDINAPLTLTQSHFPEEYQVETETGLVKMKTIESLKSRHSGGTH 160

Query: 170 NSRRSQDQGSFKSARTNNTRKSRASSSLDPNKLNMAVEKNKKELEKYSKHKQQKGIKGFF 229
           NS++S+   +       ++ +    + L+  KLN AVE+N+KELE+Y K++ +KGIKGF 
Sbjct: 161 NSKKSKGASTRSKNSLTSSMEEHGEAGLNAEKLNSAVERNRKELERYEKNRGKKGIKGFL 220

Query: 230 NRLF 233
           +++F
Sbjct: 221 SKMF 224

>TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3.486
           YGR126W
          Length = 216

 Score =  127 bits (318), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 90/239 (37%), Positives = 124/239 (51%), Gaps = 35/239 (14%)

Query: 5   GNIISADNTDNEXXXXXXXXXXXXYQPEPFTGLKGNELPNAQPSTTATTTEQDHDDTVIS 64
           G     D+  N+            YQP+PFTG +  ELP           E++ D +   
Sbjct: 4   GTTTKLDDASNQFDEVSSFSSIDSYQPQPFTGQE--ELPQ----------EKNPDSSSRR 51

Query: 65  SHSHDTKHGEEPSRTSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKS 124
           S    T            TL   DSN   IEK +T N MN  +ET  SL + GL+T KK+
Sbjct: 52  SSKSGT------------TLNHQDSNT--IEKEVTHNAMNGTSETAKSLQQAGLDTEKKA 97

Query: 125 VADINTPL--NAGTAEFPEEYRIETETGLVKAKTIESLRRQESIASANS-----RRSQDQ 177
           + DIN P+  NA T++FPEEYRIET+TGLVK KT+  L R ++  S  S     R+S   
Sbjct: 98  IPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSDTRVSIGSDGKISRKSSGP 157

Query: 178 GSFKSA--RTNNTRKSRASSSLDPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLFD 234
           G+  S      +T K+   ++ +   L  A+EKNK  +EK+ KH+ +KG+KGF +RLFD
Sbjct: 158 GTIDSKIEPKPDTAKAEQEAAQNAENLEHAIEKNKHRIEKFEKHRHEKGLKGFVHRLFD 216

>KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.486
           YGR126W
          Length = 223

 Score =  122 bits (305), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 128/222 (57%), Gaps = 33/222 (14%)

Query: 29  YQPEPFTG------------LKGNELPNAQPSTTATTTEQDHDDTVISSHSHDT----KH 72
           Y+PEPF G             + N L +AQ S T+   +++  D +    ++D+    + 
Sbjct: 19  YKPEPFVGQGIARENTDELEFQSN-LKDAQ-SHTSEKFQEEQVDPLKQVQTNDSFWSFRS 76

Query: 73  GEEPSRTSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADINTPL 132
               SRTS+  LKK  S   DIE+ +T N M  K ET+DSL   GL+  K++V DIN+P+
Sbjct: 77  VSNTSRTSSKNLKKQRSR--DIERIVTQNAMLGKAETVDSLRATGLDLTKRAVPDINSPI 134

Query: 133 NAGTAEFPEEYRIETETGLVKAKTIESLRRQESIASANSRRSQDQGSFKSARTNNTRKSR 192
            +  ++  +E + ET+TGL+K KT+E+L R      +N+R S  +        +NT    
Sbjct: 135 -SHESKLIDESKFETDTGLIKTKTLETLNR------SNTRNSSSKRKILGNDNSNT---- 183

Query: 193 ASSSLDPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLFD 234
             S LDP ++NM VE+N+K+LEKY +HK++KG+KGFF ++FD
Sbjct: 184 --SGLDPERMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIFD 223

>SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {ON}
           similar to gnl|GLV|CAGL0I10604g Candida glabrata
           CAGL0I10604g and weakly similar to YGR126W
           uniprot|P53274 Saccharomyces cerevisiae YGR126W
           Hypothetical ORF
          Length = 222

 Score =  121 bits (303), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 86/210 (40%), Positives = 123/210 (58%), Gaps = 19/210 (9%)

Query: 29  YQPEPFTGLKGNELPNAQPSTTATTTEQDHDDTV----ISSHSHDTKHGEEPSRTSTATL 84
           ++P+ FTG        A PS    T + + +D +    +S +       E  S  S+ TL
Sbjct: 26  FEPQAFTG--------ADPSVEQPTIDHELEDEIDPEPLSGNPVRPNSEEILSVRSSNTL 77

Query: 85  KKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADINTP-LNAGTAEFPEEY 143
           KKLDSN   IEK +T N +   TETL+SL  +GL+ RKK++ D N P ++   ++FPEEY
Sbjct: 78  KKLDSNA--IEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEY 135

Query: 144 RIETETGLVKAKTIESLRRQESIASANSRRSQDQGSFKSARTNNTRKSRASSSLDPNKLN 203
           +IETETGLVK KT++SL R ++  S  ++ S +Q    +    +    +     D  KL 
Sbjct: 136 QIETETGLVKVKTLQSLNRLDTRVSLGNKPSTNQ----NMEAESAHDEQRPVGYDEEKLK 191

Query: 204 MAVEKNKKELEKYSKHKQQKGIKGFFNRLF 233
            AV+KNKK++EKY KHK +KGIKGF +RLF
Sbjct: 192 KAVDKNKKKIEKYQKHKHEKGIKGFMSRLF 221

>KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakly
           similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126W Hypothetical ORF
          Length = 219

 Score =  119 bits (299), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/163 (46%), Positives = 101/163 (61%), Gaps = 14/163 (8%)

Query: 80  STATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADINTPL-NAGTAE 138
           S  TL+K DSN   IE+ MT N    ++ET++SL K GLN +KK++ DIN P  N     
Sbjct: 63  SNGTLRKQDSNA--IEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAANYKNCA 120

Query: 139 FPEEYRIETETGLVKAKTIESLRRQESIASANSRRSQDQGSFKSART-NNTRKSRASSS- 196
           FPEEY++ET+TGLVKA+T+  L R ES  S  S  SQ     KS RT N+T  S  +S+ 
Sbjct: 121 FPEEYQMETDTGLVKAQTLHGLNRLESRTSGRSGASQK----KSIRTANSTTNSDLASAN 176

Query: 197 -----LDPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLFD 234
                LD  KL  AVEKN+K+++KY KHK   G++ F  ++FD
Sbjct: 177 NTINGLDGEKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIFD 219

>TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.486
           YGR126W
          Length = 219

 Score =  112 bits (280), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 70/167 (41%), Positives = 105/167 (62%), Gaps = 8/167 (4%)

Query: 72  HGEEPSRTSTA---TLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADI 128
           H  + +R+ T+   T+K + SN  D+ + ++ NIM++  E+ ++L  Q  N   +  ADI
Sbjct: 55  HAIKETRSGTSDNNTIKPVTSN--DVHRIVSRNIMDNNVESEEALKTQLTNMESRR-ADI 111

Query: 129 NTPLNA-GTAEFPEEYRIETETGLVKAKTIESLRRQESIASANSRRSQDQGSFKSARTNN 187
             P +  G + FPEEY +ET TGLV  KT+E ++++++I S NSR+S      K++++NN
Sbjct: 112 ILPASMEGNSNFPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVSSELKASKSNN 171

Query: 188 TRKSRASSSLDPNKLNMAVEKNKKELEKYSKHKQQKG-IKGFFNRLF 233
           T KSR    L+P KLN AVEKNK+ELEKY  HK +K  IK    +LF
Sbjct: 172 TVKSRNEGGLNPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218

>Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W -
           Hypothetical ORF [contig 131] PARTIAL
          Length = 142

 Score =  108 bits (271), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 89/142 (62%), Gaps = 5/142 (3%)

Query: 98  MTTNIMNDKTETLDSLVKQGLNTRKKSVADINTPL-NAGTAEFPEEYRIETETGLVKAKT 156
           MT N    ++ET+DSL + GLN  +K+V D N P  N    EFPEEY++ET+TGLVK +T
Sbjct: 1   MTHNATEGRSETVDSLQRNGLNINQKAVPDYNNPAANFTNCEFPEEYQLETDTGLVKVQT 60

Query: 157 IESLRRQE---SIASANSRRSQDQGSFKSARTNNTRKSRAS-SSLDPNKLNMAVEKNKKE 212
           ++ L R E   SI S NS+R   + +  +  + +    R+S S LD  KL  AVEKNK++
Sbjct: 61  LQKLNRLESRTSIRSGNSQRKSMRSTPSTDHSISPSAGRSSNSGLDAEKLRKAVEKNKRQ 120

Query: 213 LEKYSKHKQQKGIKGFFNRLFD 234
           ++KY KHK   G+K F  ++FD
Sbjct: 121 IDKYQKHKASGGLKKFLGKIFD 142

>KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {ON}
           weakly similar to uniprot|P53274 Saccharomyces
           cerevisiae YGR126W Hypothetical ORF
          Length = 166

 Score = 82.4 bits (202), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 78/145 (53%), Gaps = 16/145 (11%)

Query: 89  SNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADINTPLNAGTAEFPEEYRIETE 148
           S   ++E  +  N+   +T+++DSL    L+  KK++   N P+  G AEFPEEY IET 
Sbjct: 37  STTQEVEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQPIAEG-AEFPEEYEIETR 95

Query: 149 TGLVKAKTIESLRRQESIASANSRRSQDQGSFKSARTNNTRKSRASSSLDPNKLNMAVEK 208
           TGLVK  T+  L R ++  + +S +       KS +  NT     S   D +KL   +E+
Sbjct: 96  TGLVKVATLHQLNRLDTRVTTHSSK-------KSTKEKNT-----SCGYDNDKLQKCIER 143

Query: 209 NKKELEKYSKHKQQKGIKGFFNRLF 233
           N+KE++ Y K   + G K F  +LF
Sbjct: 144 NQKEIDSYHK---KSGFKKFIGKLF 165

>Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON}
           complement(30565..31269) [705 nt, 235 aa]
          Length = 234

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 73/163 (44%), Gaps = 20/163 (12%)

Query: 92  NDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADINTPLNAGTAEFPEEYRIETETGL 151
           N+IEK +T N + + TET+ +L +      K    ++        A FPEEYRIET+TGL
Sbjct: 69  NEIEKIVTRNALENNTETVATLRETESKLSKVPTENVLPATMENNAAFPEEYRIETKTGL 128

Query: 152 VKAKTIESLRRQES-------------------IASANSRRSQDQGSFKSARTNNTRKSR 192
           V  KT+E +   +S                       +     D+      +  +  +  
Sbjct: 129 VPIKTLEEMHSNKSNGKNEENEHHNHQHNHHNHHNHHHHHEKNDEDKDVEQKEKHPAEHL 188

Query: 193 ASSSLDPNKLNMAVEKNKKELEKYSKHKQQ-KGIKGFFNRLFD 234
               L+   +++ VE+NKK+LEK+ +HK +   +K F  +  D
Sbjct: 189 PHGKLEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFLD 231

>KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {ON}
           Anc_3.503 YPR156C
          Length = 624

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 106 KTETLDSLVKQGLNTRKKSVADINTPLNAGTAEFPEEYRIETETGLVKAKTIESLRRQES 165
           +TET+ SL   G+N    +V D+N P +   A FPEEY IET TGLV   T++SL R  +
Sbjct: 51  RTETVKSLQDMGMNA-TPAVPDVNAPQSNRNAIFPEEYTIETTTGLVPVATLQSLGRTST 109

Query: 166 IASANSRRSQD 176
             S    R  D
Sbjct: 110 AISRTRTRQMD 120

>KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 644

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 44/86 (51%), Gaps = 14/86 (16%)

Query: 107 TETLDSLVKQGLNTRKKSVADINTPLNA--GTAEFPEEYRIETETGLVKAKTIESLRRQE 164
           TET+ SL   G+ T +  + D+N P     G A FPEEY +ET TGLV   T++SL R +
Sbjct: 57  TETVKSLQDMGV-TPEAPLPDVNAPTTGKGGAAIFPEEYTLETATGLVPVATLQSLGRTQ 115

Query: 165 SIAS-----------ANSRRSQDQGS 179
           S  S           A  RR  D GS
Sbjct: 116 SAVSRTRTRVMREGAAARRRGSDAGS 141

>AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR138C
           (TPO2) and YPR156C (TPO3)
          Length = 592

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 1/59 (1%)

Query: 107 TETLDSLVKQGLNTRKKSVADINTPLNAGTAEFPEEYRIETETGLVKAKTIESLRRQES 165
           TET+ SL + GL++ +K + D+N P  +    FPEEY +ET TGLVK  T+ SL R  S
Sbjct: 45  TETVKSLQEMGLSS-EKPIPDVNAPSTSAGVIFPEEYTLETPTGLVKIATLVSLGRTGS 102

>TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.503
           YPR156C
          Length = 691

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (64%), Gaps = 1/57 (1%)

Query: 106 KTETLDSLVKQGLNTRKKSVADINTPLNAGTAEFPEEYRIETETGLVKAKTIESLRR 162
           KTET+ SL+  G+++   + A IN P  +  A FPEEY +ETETGLV   T+ SL R
Sbjct: 70  KTETVKSLIDMGVSSYIPNPA-INAPKTSKKAIFPEEYTLETETGLVPVSTLHSLGR 125

>KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.503
           YPR156C
          Length = 622

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 50/84 (59%), Gaps = 3/84 (3%)

Query: 106 KTETLDSLVKQGLNTRKKSVADINTPLNAG-TAEFPEEYRIETETGLVKAKTIESL-RRQ 163
           +TET+ SL   G+ T+   + D+N P  A  TA FPEEY +ET TGLV   T++S+ R  
Sbjct: 50  RTETVKSLQDMGM-TKNAPIPDVNAPQTAKKTAIFPEEYTMETPTGLVPVATLQSIGRTA 108

Query: 164 ESIASANSRRSQDQGSFKSARTNN 187
            SI+   +R+     S +S+ +N+
Sbjct: 109 TSISRTRTRQMDRSISMRSSHSND 132

>Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 41/74 (55%), Gaps = 1/74 (1%)

Query: 106 KTETLDSLVKQGLNTRKKSVADINTPLNAGTAEFPEEYRIETETGLVKAKTIESLRRQES 165
           +TET+ SL   G+++R   V D+N P ++    FPEEY IET TGLV   T+ S+ R  +
Sbjct: 49  RTETVKSLQDMGVSSRAP-VPDVNAPQSSKNKIFPEEYTIETPTGLVPVATLHSIGRTST 107

Query: 166 IASANSRRSQDQGS 179
             S    R  D  S
Sbjct: 108 AISRTRTRQIDGAS 121

>Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON}
           YGR138C (REAL)
          Length = 613

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 61/117 (52%), Gaps = 19/117 (16%)

Query: 60  DTVISSHSHDTKH----GEEPSRTSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVK 115
           ++V+S +S +T      G++P +   A   K +S  N ++ T        KTET+ SL  
Sbjct: 5   ESVVSFNSQNTSMVDVEGQQPQQYVPA---KTNSRTNQLKLT--------KTETVKSLQD 53

Query: 116 QGLNTRKKSVADINTPLNAGTAEFPEEYRIETETGLVKAKTIESLRRQESIASANSR 172
            G+ T    V DIN P  A    FPEEY +ET +GLV   T++S+ R    ASA SR
Sbjct: 54  LGV-TSAAPVPDINAPQTAKNNIFPEEYTMETPSGLVPVATLQSMGRT---ASALSR 106

>Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]
           {ON} YGR138C (TPO2) -  [contig 188] FULL
          Length = 640

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 38/61 (62%), Gaps = 3/61 (4%)

Query: 107 TETLDSLVKQGLNTRKKSVADINTPLNA--GTAEFPEEYRIETETGLVKAKTIESLRRQE 164
           TET+ SL + G+ T +  + D+N P  A  G A FPEEY +ET TGLV   T++SL R  
Sbjct: 51  TETVKSLQEMGV-TPEAPLPDVNAPAAATSGKAIFPEEYTLETATGLVPVATLQSLGRTT 109

Query: 165 S 165
           S
Sbjct: 110 S 110

>SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 610

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 107 TETLDSLVKQGLNTRKKSVADINTPLNAGTAEFPEEYRIETETGLVKAKTIESLRRQESI 166
           TET  SL + G+++ +  + DIN P N  +  FPEEY +ET TGLV   T+ S+ R  S 
Sbjct: 44  TETAKSLQEMGVSS-EAPIPDINAPQNVKSPIFPEEYTMETPTGLVPVATLHSIGRTTSA 102

Query: 167 ASANSRRSQDQ 177
            S    R  D+
Sbjct: 103 VSRTRTRQLDR 113

>Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 44/74 (59%), Gaps = 2/74 (2%)

Query: 106 KTETLDSLVKQGLNTRKKSVADINTPLNAGTAEFPEEYRIETETGLVKAKTIESLRRQES 165
           +TET+ SL   G+++ K  V D+N P +     FPEEY +ET TGLV   T+ S+ R  S
Sbjct: 49  RTETVKSLQDMGVSS-KAPVPDVNAPQSGKNKIFPEEYTLETPTGLVPVATLHSIGRT-S 106

Query: 166 IASANSRRSQDQGS 179
            A + +R  Q +G+
Sbjct: 107 TAISRTRTRQIEGA 120

>YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}
           TPO2Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; transcription of TPO2
           is regulated by Haa1p; member of the major facilitator
           superfamily
          Length = 614

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 61/117 (52%), Gaps = 19/117 (16%)

Query: 60  DTVISSHSHDTKH----GEEPSRTSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVK 115
           ++V+S +S +T      G++P +   +   K +S  N ++ T        KTET+ SL  
Sbjct: 5   ESVVSFNSQNTSMVDVEGQQPQQYVPS---KTNSRANQLKLT--------KTETVKSLQD 53

Query: 116 QGLNTRKKSVADINTPLNAGTAEFPEEYRIETETGLVKAKTIESLRRQESIASANSR 172
            G+ T    V DIN P  A    FPEEY +ET +GLV   T++S+ R    ASA SR
Sbjct: 54  LGV-TSAAPVPDINAPQTAKNNIFPEEYTMETPSGLVPVATLQSMGRT---ASALSR 106

>YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON}
           TPO3Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; member of the major
           facilitator superfamily
          Length = 622

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 1/74 (1%)

Query: 106 KTETLDSLVKQGLNTRKKSVADINTPLNAGTAEFPEEYRIETETGLVKAKTIESLRRQES 165
           +TET+ SL   G+++ K  V D+N P ++    FPEEY +ET TGLV   T+ S+ R  +
Sbjct: 49  RTETVKSLQDMGVSS-KAPVPDVNAPQSSKNKIFPEEYTLETPTGLVPVATLHSIGRTST 107

Query: 166 IASANSRRSQDQGS 179
             S    R  D  S
Sbjct: 108 AISRTRTRQIDGAS 121

>Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON}
           YGR138C (REAL)
          Length = 611

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 39/67 (58%), Gaps = 4/67 (5%)

Query: 106 KTETLDSLVKQGLNTRKKSVADINTPLNAGTAEFPEEYRIETETGLVKAKTIESLRRQES 165
           KTET+ SL   G+ T    V DIN P  A    FPEEY +ET +GLV   T++S+ R   
Sbjct: 44  KTETVKSLQDLGV-TSAAPVPDINAPKTAKNNIFPEEYTMETPSGLVPVATLQSMGRT-- 100

Query: 166 IASANSR 172
            ASA SR
Sbjct: 101 -ASALSR 106

>Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 41/74 (55%), Gaps = 1/74 (1%)

Query: 106 KTETLDSLVKQGLNTRKKSVADINTPLNAGTAEFPEEYRIETETGLVKAKTIESLRRQES 165
           +TET+ SL   G+++ K  + D+N P ++    FPEEY +ET TGLV   T+ S+ R  +
Sbjct: 49  RTETVKSLQDMGVSS-KAPIPDVNAPQSSKNKIFPEEYTLETPTGLVPVATLHSIGRTST 107

Query: 166 IASANSRRSQDQGS 179
             S    R  D  S
Sbjct: 108 AISRTRTRQIDGAS 121

>CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138c
          Length = 630

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 51/91 (56%), Gaps = 4/91 (4%)

Query: 106 KTETLDSLVKQGLNTRKKSVADINTP-LNAGTAEFPEEYRIETETGLVKAKTIESLRRQE 164
           +TET+ SL + G+ T+   + D+N P      A FPEEY +ET TGLV   T++SL R  
Sbjct: 50  RTETVKSLQEMGM-TQDAPIPDVNAPQTTTKNAIFPEEYTMETPTGLVPVATLQSLGR-T 107

Query: 165 SIASANSRRSQDQGSFKSARTNNTRKSRASS 195
           S A + SR  Q + S  S R+ N   S  SS
Sbjct: 108 STAISKSRTRQIERS-VSRRSQNIAASSNSS 137

>Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON}
           YGR138C (REAL)
          Length = 614

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 60/117 (51%), Gaps = 19/117 (16%)

Query: 60  DTVISSHSHDTKH----GEEPSRTSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVK 115
           ++V+S +S +T      G++P +       K +S  N ++ T        KTET+ SL  
Sbjct: 5   ESVVSFNSQNTSMVDIEGQQPQQYVP---TKTNSRANQLKLT--------KTETVKSLQD 53

Query: 116 QGLNTRKKSVADINTPLNAGTAEFPEEYRIETETGLVKAKTIESLRRQESIASANSR 172
            G+ T    V DIN P  A    FPEEY +ET +GLV   T++S+ R    A+A SR
Sbjct: 54  LGV-TSNAPVPDINAPQTAKNNIFPEEYTMETPSGLVPVATLQSMGRT---ATALSR 106

>NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 3/74 (4%)

Query: 106 KTETLDSLVKQGLNTRKKSVADINTPLNAG-TAEFPEEYRIETETGLVKAKTIESLRRQE 164
           +TET+ +L   G+ T    V DIN P ++   A FPEEY +ET TGLV   T++S+ R  
Sbjct: 45  RTETVKTLQDLGV-TSHVPVPDINAPQSSKKNAIFPEEYTMETTTGLVPVATLQSMGRTA 103

Query: 165 SIASANSRRSQDQG 178
           S A + +R  Q QG
Sbjct: 104 S-AISRTRTRQMQG 116

>Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON}
           (12526..14391) [1866 nt, 622 aa]
          Length = 621

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 2/70 (2%)

Query: 106 KTETLDSLVKQGLNTRKKSVADINTPLNAGTAEFPEEYRIETETGLVKAKTIESLRRQES 165
           +TET+ SL   G+ T +  +  +N P  +    FPEEY +ET TGLV   T++SL R  S
Sbjct: 47  RTETVKSLQDMGM-TSEAPIPGVNAPQTSRVQIFPEEYTMETPTGLVPVATLQSLGR-SS 104

Query: 166 IASANSRRSQ 175
           +A   +R  Q
Sbjct: 105 LAVTRTRTRQ 114

>TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa]
           {ON} Anc_3.503 YPR156C
          Length = 616

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 49/94 (52%), Gaps = 14/94 (14%)

Query: 106 KTETLDSLVKQGLNTRKKSVADINTPLNAGTAE-FPEEYRIETETGLVKAKTIESLRRQE 164
           +TET+ SL + G+ T    V D+N P      + FPEEY +ET TGLV   T++S+ R  
Sbjct: 44  RTETVKSLQEMGM-TATAPVPDVNAPQTTARPQIFPEEYTMETPTGLVPVATLQSIGRT- 101

Query: 165 SIASANSRRSQDQGSFKSARTNNTRKSRASSSLD 198
           S A + SR  Q +           R S  SSS+D
Sbjct: 102 STAISRSRTRQME-----------RTSSESSSMD 124

>TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {ON}
           Anc_3.503 YPR156C
          Length = 613

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 106 KTETLDSLVKQGLNTRKKSVADINTPLNAGTAEFPEEYRIETETGLVKAKTIESLRR 162
           +TET+ SL   GL T    + D+N P +   + FPEEY +ET TGLV   T+ SL R
Sbjct: 44  RTETVKSLQDMGL-TSDAPIPDVNAPTSNKHSIFPEEYTMETPTGLVPVATLHSLGR 99

>NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {ON}
           Anc_3.503 YGR138C
          Length = 634

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 44/75 (58%), Gaps = 3/75 (4%)

Query: 106 KTETLDSLVKQGLNTRKKSVADINTPLNAG-TAEFPEEYRIETETGLVKAKTIESLRRQE 164
           +TET  +L   G+ T +  + DIN P  +   A FPEEY +ET TGLV   T++S+ R  
Sbjct: 49  RTETAKTLQDMGM-TSEAPLPDINAPQGSKKPAIFPEEYTMETPTGLVPVVTLQSIGRNS 107

Query: 165 SIASANSRRSQDQGS 179
           S A + +R  Q +GS
Sbjct: 108 S-AISRTRTRQIEGS 121

>KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly
           similar to uniprot|Q06451 Saccharomyces cerevisiae
           YPR156C TPO3 Polyamine transport protein
          Length = 609

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 41/81 (50%), Gaps = 3/81 (3%)

Query: 99  TTNIMNDKTETLDSLVKQGLNTRKKSVADINTPLN--AGTAEFPEEYRIETETGLVKAKT 156
           ++N+    TET  SL   GL T +  + D N P    A  A FPEEY +ET TGLV   T
Sbjct: 40  SSNLKLVPTETAKSLQDMGL-TSEVPIPDFNAPTTSVAKNAIFPEEYTLETATGLVPVAT 98

Query: 157 IESLRRQESIASANSRRSQDQ 177
           + SL R  +  S    R  D+
Sbjct: 99  LHSLGRTPTAISRTRTRQMDR 119

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 106 KTETLDSLVKQGLNTRKKSVADINTP-LNAGTAEFPEEYRIETETGLVKAKTIESLRR 162
           +TET+ +L   G+ TR   V D+N P  +A    FPEEY +ET TGLV   T++SL R
Sbjct: 51  RTETVKTLQDLGV-TRDAPVPDVNAPQTSARNTIFPEEYTMETTTGLVPVSTLQSLGR 107

>ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} similar
           to uniprot|P53283 Saccharomyces cerevisiae YGR138C TPO2
           Polyamine transport protein
          Length = 594

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 108 ETLDSLVKQGLNTRKKSVADINTPLNAGTAEFPEEYRIETETGLVKAKTIESLRR 162
           ET ++L   G+  R   + D+  P  A    FPEEY +ET +G+V    +ESL R
Sbjct: 41  ETAETLQTMGM-ARGTPLPDVVAPTYAAAPVFPEEYTMETPSGIVPLAQLESLGR 94

>KLLA0D13640g Chr4 (1176601..1177674) [1074 bp, 357 aa] {ON}
           uniprot|Q05959 Kluyveromyces lactis KLLA0D13640g SUA7
           Transcription initiation factor IIB
          Length = 357

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 72/167 (43%), Gaps = 31/167 (18%)

Query: 65  SHSHDTKHGEEPSRTSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLN-TRKK 123
           + S+D ++G++PSR   A+   LD N       +TT I   + +  D+ V + LN  + K
Sbjct: 69  TFSNDDQNGDDPSRVGEASNPLLDGN------HLTTRI--GQAQGSDARVTRDLNRAQSK 120

Query: 124 SVAD----------INTPLNAGTAEFP--------EEYRIETETGLVKAKTIESLRRQES 165
           S+ D              +    AE P        E Y++  E  ++K K+ ES+    S
Sbjct: 121 SIVDKKDNELQAAYAKITMMCDAAELPKIVKDCAKEAYKLCFEERVLKGKSQESI--MAS 178

Query: 166 IASANSRRSQDQGSFKSART-NNTRKSRASSSLDPNKLNMAVEKNKK 211
           +     RR++   SFK   +  N RK     +    K N+  EKN +
Sbjct: 179 VILVGCRRAEVGRSFKEILSLTNVRKKEIGKTFTIIK-NILREKNDR 224

>NDAI0D02410 Chr4 (554265..560273) [6009 bp, 2002 aa] {ON} Anc_5.113
           YGR217W
          Length = 2002

 Score = 31.2 bits (69), Expect = 3.0,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 55/123 (44%), Gaps = 21/123 (17%)

Query: 46  QPSTTATTTEQDHDDTVIS---SHSHDTKHGEEPSRTSTAT--------------LKKLD 88
           +P+T  TT++  HD+  +S   S++++    E PSRT  +                K+LD
Sbjct: 191 KPATVDTTSQNGHDELRVSGKWSYNNEQTPEEGPSRTPNSAGVYGDGSIFVDDIGSKELD 250

Query: 89  SNV--NDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADI--NTPLNAGTAEFPEEYR 144
           ++   NDI  +  +  + D  + L+  + + L     S+A I    P+    A F  + R
Sbjct: 251 TSFKENDIAVSTISLPLPDFEQPLNKPILKTLKLYGNSIAMIPPTNPIRIRLARFHTDRR 310

Query: 145 IET 147
            +T
Sbjct: 311 YKT 313

>TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3.490
           YGR129W
          Length = 222

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 46/106 (43%), Gaps = 8/106 (7%)

Query: 34  FTGLKGNELPNAQPSTTATTTEQDHDDTVISSHSHDTKHGEEP--SRTSTATL---KKLD 88
            T L+     N +P   + T E D D+  I+  +    H EE   S+    TL   K  +
Sbjct: 29  LTSLRDKSATNNKPKVYSMTDEFDKDELPINDENARKNHSEEERISKLMNYTLREYKDWE 88

Query: 89  SNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADINTPLNA 134
              N+      TN  +D+ E+LDSL K+   T  K +  +N  L A
Sbjct: 89  LKQNEYTTESQTNSKDDQIESLDSLAKR---TYDKDIRKLNKALRA 131

>KNAG0F00730 Chr6 (127002..131831) [4830 bp, 1609 aa] {ON} Anc_2.1
            YNL242W
          Length = 1609

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 54/134 (40%), Gaps = 19/134 (14%)

Query: 41   ELPNAQPSTTATTTEQDHDDTVIS----SHSHDTKHGEEPSRTSTATLKKLDSNVNDIEK 96
            + P + P      T  DHD  +      S   D    EEP  T + +L   D+ +N +E 
Sbjct: 934  KFPESFPDEAKYKTHFDHDVNIFENVDFSFFQDLMK-EEPDSTHSMSL---DNGINVVES 989

Query: 97   TMTTNIMNDKTETLDSLVKQGLNTRKKSVADINTPLNAGTAEFPEEYRIETETGLVKAKT 156
                   N KT  L  L K   N+    +AD      AG     E+Y I+T     KA T
Sbjct: 990  FFDVKHDNSKTPHLVDLNKSDYNSSNSEIAD------AGVLAITEDY-IDTR----KAIT 1038

Query: 157  IESLRRQESIASAN 170
            +   R+QE +  ++
Sbjct: 1039 VAHSRKQEGVLRSD 1052

>Smik_14.92 Chr14 (167182..170097) [2916 bp, 971 aa] {ON} YNL243W
           (REAL)
          Length = 971

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 28/38 (73%), Gaps = 3/38 (7%)

Query: 96  KTMTTNIMNDKTETLDSLVKQGLNTRKKSVADINTPLN 133
           +TMT + MN     LD++++ G+NT ++SV ++++PL+
Sbjct: 566 ETMTVDKMN---PILDAILESGINTIQESVYNLDSPLS 600

>Ecym_4477 Chr4 (970072..971136) [1065 bp, 354 aa] {ON} similar to
           Ashbya gossypii ADR007C
          Length = 354

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 66/153 (43%), Gaps = 28/153 (18%)

Query: 65  SHSHDTKHGEEPSRTSTATLKKLDSN----------VNDIEKTMTTNIMNDKTETLDSLV 114
           + S+D ++G++PSR   A+   LD N           +D++ T   N    K     S+V
Sbjct: 69  TFSNDDQNGDDPSRVGEASNPLLDGNHLSTRIGQAQGSDVKLTRELNRAQSK-----SIV 123

Query: 115 KQGLNTRKKSVADINTPLNAGTAEFP--------EEYRIETETGLVKAKTIESLRRQESI 166
            +  N  + S A I    +A  AE P        E Y++  E   +K K+ ES+    S+
Sbjct: 124 DKKDNELQASYAKITMMCDA--AELPKIVKDCAKEAYKLCFEERALKGKSQESI--MASV 179

Query: 167 ASANSRRSQDQGSFKSART-NNTRKSRASSSLD 198
                RR++   SFK   +  N RK     +L+
Sbjct: 180 ILLGCRRAEVGRSFKEILSLTNVRKKEIGKTLN 212

>Kwal_23.6314 s23 (1526391..1527326) [936 bp, 311 aa] {ON} YCR069W
           (CPR4) - cyclophilin homolog [contig 17] FULL
          Length = 311

 Score = 29.6 bits (65), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 8/60 (13%)

Query: 39  GNELPNAQPSTTATTTEQDHDDTVISSHSHDTKHGEEPSRTSTATLKKLDSNVNDIEKTM 98
           G+ LP+  P T        H  +     + D KH + P R S A L K D+N +    TM
Sbjct: 115 GDVLPDVGPFTI-------HGGSYFEDENFDLKH-DRPGRVSMANLNKPDTNASQFFITM 166

>KLTH0F13200g Chr6 complement(1085074..1086153) [1080 bp, 359 aa]
           {ON} highly similar to uniprot|P29055 Saccharomyces
           cerevisiae YPR086W SUA7 Transcription factor TFIIB a
           general transcription factor required for transcription
           initiation and start site selection by RNA polymerase II
          Length = 359

 Score = 29.3 bits (64), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 59/135 (43%), Gaps = 27/135 (20%)

Query: 65  SHSHDTKHGEEPSRTSTATLKKLDSN----------VNDIEKTMTTNIMNDKTETLDSLV 114
           + S+D ++G++PSR   A+   LD N           +D++ T   N    K     S+V
Sbjct: 69  TFSNDDQNGDDPSRVGEASNPLLDGNHLSTRIGQAQGSDVKFTRDLNRAQSK-----SIV 123

Query: 115 KQGLNTRKKSVADINTPLNAGTAEFP--------EEYRIETETGLVKAKTIESLRRQESI 166
            +  N  + + A I    +A  AE P        E Y+I  E   +K K+ ES+    S+
Sbjct: 124 DKKDNELQAAYAKITMMCDA--AELPKIVKDCAKEAYKICYEERALKGKSQESI--MASV 179

Query: 167 ASANSRRSQDQGSFK 181
                RR++   SFK
Sbjct: 180 ILVGCRRAEVGRSFK 194

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.304    0.120    0.319 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,756,804
Number of extensions: 1049008
Number of successful extensions: 6791
Number of sequences better than 10.0: 479
Number of HSP's gapped: 6602
Number of HSP's successfully gapped: 533
Length of query: 234
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 128
Effective length of database: 41,326,803
Effective search space: 5289830784
Effective search space used: 5289830784
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 64 (29.3 bits)