Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G009703.487ON33233217120.0
NCAS0E008403.487ON3363319661e-130
KAFR0C019303.487ON3133327941e-104
Skud_7.4383.487ON3133397631e-100
Smik_6.2233.487ON3133397551e-98
YGR127W3.487ON3123387421e-96
Suva_7.4153.487ON3133397411e-96
CAGL0I10582g3.487ON3193346925e-89
SAKL0F02882g3.487ON2983326722e-86
KNAG0B008403.487ON3133356402e-81
Kpol_1017.93.487ON3103356351e-80
KLLA0E04687g3.487ON3063346151e-77
TDEL0D055503.487ON3103355961e-74
TPHA0D032603.487ON3143395916e-74
Ecym_12423.487ON3113345454e-67
KLTH0F14718g3.487ON3003315332e-65
Kwal_55.212173.487ON3033285307e-65
AFR305W3.487ON3093324924e-59
TBLA0D029903.487ON3183334585e-54
ZYRO0D10098g3.487ON2762794294e-50
YOL125W (TRM13)3.46ON47648694.3
KLTH0H03586g6.240ON38292685.5
KLLA0E05281g4.238ON1755105685.6
KNAG0F021906.176ON1114140686.1
CAGL0I08943g1.357ON60249669.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G00970
         (332 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON...   664   0.0  
NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {O...   376   e-130
KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.48...   310   e-104
Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W (...   298   e-100
Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W (...   295   1e-98
YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative pro...   290   1e-96
Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W (...   290   1e-96
CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa] ...   271   5e-89
SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {O...   263   2e-86
KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON...   251   2e-81
Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}...   249   1e-80
KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {O...   241   1e-77
TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3....   234   1e-74
TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.48...   232   6e-74
Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON} ...   214   4e-67
KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} simil...   209   2e-65
Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W...   208   7e-65
AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic hom...   194   4e-59
TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON...   181   5e-54
ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {O...   169   4e-50
YOL125W Chr15 (83834..85264) [1431 bp, 476 aa] {ON}  TRM132'-O-m...    31   4.3  
KLTH0H03586g Chr8 complement(326294..327442) [1149 bp, 382 aa] {...    31   5.5  
KLLA0E05281g Chr5 (467253..472520) [5268 bp, 1755 aa] {ON} simil...    31   5.6  
KNAG0F02190 Chr6 (418793..422137) [3345 bp, 1114 aa] {ON} Anc_6....    31   6.1  
CAGL0I08943g Chr9 (867666..869474) [1809 bp, 602 aa] {ON} simila...    30   9.6  

>NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON}
           Anc_3.487 YGR127W
          Length = 332

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/332 (96%), Positives = 320/332 (96%)

Query: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60
           MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT
Sbjct: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60

Query: 61  WLGINKDGKIATVXXXXXXXXXXXXQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNFTK 120
           WLGINKDGKIATV            QLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNFTK
Sbjct: 61  WLGINKDGKIATVLNLKLNKSLSLKQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNFTK 120

Query: 121 KYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFTCNGQLGELQ 180
           KYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFTCNGQLGELQ
Sbjct: 121 KYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFTCNGQLGELQ 180

Query: 181 SNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSSTCSVT 240
           SNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSSTCSVT
Sbjct: 181 SNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSSTCSVT 240

Query: 241 VEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTYEVKF 300
           VEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTYEVKF
Sbjct: 241 VEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTYEVKF 300

Query: 301 AEHVIYTSDSDIKTFSPANPKETVRFDFTLNR 332
           AEHVIYTSDSDIKTFSPANPKETVRFDFTLNR
Sbjct: 301 AEHVIYTSDSDIKTFSPANPKETVRFDFTLNR 332

>NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {ON}
           Anc_3.487 YGR127W
          Length = 336

 Score =  376 bits (966), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 186/331 (56%), Positives = 231/331 (69%), Gaps = 15/331 (4%)

Query: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60
           MCILLATTAHP YELILISNRDEF +RKTH SCWHNDDFILSP+DMAK C+ ++KK+FGT
Sbjct: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76

Query: 61  WLGINKDGKIATVXXXXXXXXXXXXQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNFTK 120
           W+GIN+D KIAT+            QLV P+SRGM+PFV+LS+   D F +WD Y+ F  
Sbjct: 77  WIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSD-FNKWDTYEKFDG 135

Query: 121 KYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFTCNGQLGELQ 180
           KY  L+ TGDFN FYGD    +YRI+DS GNT   L+ +  YL VSND+F   G   E  
Sbjct: 136 KYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSGD-PYLTVSNDMFATGGITVERA 194

Query: 181 SNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSSTCSVT 240
           SN           ++I  W K+K G  LLQ LV +S  +  DED +I +CFKL+STCSV 
Sbjct: 195 SN-----------NRIAEWRKIKFGKILLQDLVEES--KSLDEDMLIEKCFKLASTCSVQ 241

Query: 241 VEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTYEVKF 300
            +++ KF+QNSTLP ETI VPPL C++ DD+GTSL +G+YYGTRSQIVILI +    VK 
Sbjct: 242 PKENTKFNQNSTLPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKL 301

Query: 301 AEHVIYTSDSDIKTFSPANPKETVRFDFTLN 331
            EH++YTSD+DI+ +S  NPKE   F+F  N
Sbjct: 302 VEHILYTSDNDIQHYSSTNPKEVKSFEFKPN 332

>KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.487
           YGR127W
          Length = 313

 Score =  310 bits (794), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 155/332 (46%), Positives = 217/332 (65%), Gaps = 22/332 (6%)

Query: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60
           MCIL AT +H +YELILISNRDE+L RKTH +CWHND+FILSPYDM++E  + +K +FGT
Sbjct: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNK-IFGT 59

Query: 61  WLGINKDGKIATVXXXXXXXXXXXXQLVAPKSRGMLPFVYL-SDMT-EDSFAEWDGYDNF 118
           WLG+NK GKIAT+            +LV P+SRG++PF +L SD T EDSF EW+ ++ F
Sbjct: 60  WLGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKF 119

Query: 119 TKKYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFTCNGQLGE 178
             KYP LQS+GDFN FYGD+K   YRI+DS+GNT   L++N + +++SND++        
Sbjct: 120 KSKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRNMIISNDLY-------- 171

Query: 179 LQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSSTCS 238
            Q   + EGK         TWGK+K+G   L   + ++  E+ +ED ++++CF+L+S CS
Sbjct: 172 -QHKDEYEGKP--------TWGKIKIGAERLNKFLKET--ERSNEDEVLAKCFELASYCS 220

Query: 239 VTVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTYEV 298
           +      + + N  L  ETI VPPL+    +D+G +   G+YYGTR+QIV+L+ +    V
Sbjct: 221 IDSSITREENPNKELAAETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHV 280

Query: 299 KFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330
              EH I+ SD +I  +S  NPKE  R DFT+
Sbjct: 281 TLVEHTIHNSDEEIYKYSGLNPKEVQRLDFTI 312

>Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  298 bits (763), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 159/339 (46%), Positives = 209/339 (61%), Gaps = 35/339 (10%)

Query: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60
           MCIL+AT AHPDYELILISNRDEFL RKTH +CWHNDDFILSPYD+AK  K  +K++FGT
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSK--EKQIFGT 58

Query: 61  WLGINKDGKIATVXXXXXXXXXXXXQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNFTK 120
           W GIN++GK+AT+              +  KSRG+LPF +LS    D F  WD YD F  
Sbjct: 59  WSGINREGKLATI---LNLKLDGQRDTIKSKSRGLLPFTFLSTHKAD-FQNWDNYDKFEM 114

Query: 121 KYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQ-----YLVVSNDVFTCNGQ 175
            Y GL +TGDFN FYGDV  KQY+++DS+G T + L+S C+     Y+ VSN  F  +  
Sbjct: 115 NYDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPS 174

Query: 176 LGELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSS 235
           + E                  + W KVK+    L+ LV  +I    DE+TIIS CF+L+S
Sbjct: 175 ISE------------------QAWKKVKVARDGLEKLVLGNI--DSDEETIISNCFQLAS 214

Query: 236 TCSV----TVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILI 291
             SV    +  +  +   +  +   TI VPPLR    DD+G S+P G+YYGTRSQIV+L+
Sbjct: 215 KSSVPGTASKPNALQMLADPNVIMNTIYVPPLRRPPDDDLGASIPDGDYYGTRSQIVLLV 274

Query: 292 KRGTYEVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330
            + + +V F E ++Y+SD D+  +S A PKE  RF+F L
Sbjct: 275 SKNSSKVTFIERILYSSDEDVNHYSVATPKEEKRFEFKL 313

>Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  295 bits (755), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 157/339 (46%), Positives = 211/339 (62%), Gaps = 35/339 (10%)

Query: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60
           MCIL+AT AHPDYELILISNRDEFL RKTH +CWHNDDFILSPYD+A+  K  + + FGT
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSK--EGQEFGT 58

Query: 61  WLGINKDGKIATVXXXXXXXXXXXXQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNFTK 120
           W GINK+GK+AT+              +  KSRG+LP+++LS+  E +F +WD Y  F  
Sbjct: 59  WSGINKEGKLATILNLKLGSERST---IKSKSRGLLPYIFLSNH-EANFKDWDSYSKFGN 114

Query: 121 KYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQ-----YLVVSNDVFTCNGQ 175
            Y GL++TGDFN FYGDV  KQY+++DS+G T   L+S C+     Y+V+SN  F     
Sbjct: 115 HYDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSS 174

Query: 176 LGELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSS 235
           + E                  + W KVKL    L+ LV+ +I    DE+TIIS CF+L+S
Sbjct: 175 IPE------------------KAWEKVKLARDSLEDLVSDNI--GLDEETIISSCFQLAS 214

Query: 236 TCS----VTVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILI 291
             S    V+  D  +   +  +   TI VPPLR    DD+G S+P G++YGTRSQIV+LI
Sbjct: 215 KSSLPGTVSKPDVLQMLVDPNVTMSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLI 274

Query: 292 KRGTYEVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330
            + + +  F E +IY+SD D++ +S + PKE  RF+F L
Sbjct: 275 SKDSTKATFIERIIYSSDEDVRQYSVSAPKEEKRFEFEL 313

>YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative
           protein of unknown function; expression is regulated by
           Msn2p/Msn4p, indicating a possible role in stress
           response
          Length = 312

 Score =  290 bits (742), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 156/338 (46%), Positives = 211/338 (62%), Gaps = 34/338 (10%)

Query: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60
           MCIL+AT AHPDYELILISNRDEFL RKTH +CWHN+DFILSPYD+AK     +K++FGT
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSA--EKQIFGT 58

Query: 61  WLGINKDGKIATVXXXXXXXXXXXXQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNFTK 120
           W GINK+GK+AT+            +    +SRG+LPF++LS    D F +WD Y  F  
Sbjct: 59  WSGINKEGKLATILNLKLDNEQNNTK---SRSRGLLPFIFLSIHKAD-FEDWDNYKKFEG 114

Query: 121 KYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQ-----YLVVSNDVFTCNGQ 175
            Y GL+STGDFN FYGDV +KQY+++DS+G T   L+S C+     Y+VVSN  F  +  
Sbjct: 115 HYDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSS 174

Query: 176 LGELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSS 235
           +                    + W KVK+    L++LV ++I  + DE+ IIS CF+L+S
Sbjct: 175 IPG------------------QAWEKVKVARDSLENLVLENI--ESDEEKIISSCFQLAS 214

Query: 236 TCSV--TVEDHCKFHQ-NSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIK 292
             S+  T+ +       +  +   TI VPPLR    DD+G S+P G+YYGTRSQIV+L+ 
Sbjct: 215 KSSLPSTISNPDVLQMVDPNVTMNTIYVPPLRRPPRDDLGASIPDGDYYGTRSQIVLLVS 274

Query: 293 RGTYEVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330
           + +  V F E V+Y+SD D++ +S  +PKE  RF F L
Sbjct: 275 KDSTRVTFIERVLYSSDEDVRKYSVTSPKEEKRFKFKL 312

>Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  290 bits (741), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 153/339 (45%), Positives = 212/339 (62%), Gaps = 35/339 (10%)

Query: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60
           MCIL+AT AHP YELILISNRDEFL+RKTH +CWHNDDFILSPYD+AK     +K++FGT
Sbjct: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSM--EKQIFGT 58

Query: 61  WLGINKDGKIATVXXXXXXXXXXXXQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNFTK 120
           W GINK+GK+AT+            +    KSRGMLPF +L+   +  F +WD Y+ F K
Sbjct: 59  WSGINKEGKLATILNLKMDDQRSCTK---SKSRGMLPFTFLTSH-KARFQDWDDYNKFEK 114

Query: 121 KYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQ-----YLVVSNDVFTCNGQ 175
            Y GL++TGDFN FYGDV  K+Y+++DS+G+T   L S C+     Y+V+SN  +  +  
Sbjct: 115 HYDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSS 174

Query: 176 LGELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSS 235
           + E                  + W KVK+    L++L+  +I  + DE+T+IS CF+L+S
Sbjct: 175 ISE------------------QAWEKVKIARDSLETLILDNI--ESDEETLISNCFQLAS 214

Query: 236 TCSVT----VEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILI 291
             S+       D  +   +  +   TI VPPLR    DD+G S+P G+YYGTRSQIV+L+
Sbjct: 215 KSSLPDTGLKPDLLQMLVDPNVTMNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLV 274

Query: 292 KRGTYEVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330
            + + +V F E V+Y+SD D+  +S + PKE  RF+F L
Sbjct: 275 SKDSSKVTFIERVLYSSDEDVSHYSASAPKEEKRFEFEL 313

>CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa]
           {ON} similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127w
          Length = 319

 Score =  271 bits (692), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 142/334 (42%), Positives = 208/334 (62%), Gaps = 20/334 (5%)

Query: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60
           MCIL AT  HPDYELI+ISNRDEFL+RKTH++CWHNDDFILSPYD+A+         FGT
Sbjct: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60

Query: 61  WLGINKDGKIATVXXXXXXXXXXXXQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNFTK 120
           W G+N+ G++ATV            +++  +SRG LPFV+L+D  + +F +WD Y  F K
Sbjct: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDR-QGNFEDWDTYAKFCK 119

Query: 121 KYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQ-YLVVSNDVFTCNGQLGEL 179
            YP ++ TGDFNLFYGD K  +Y ++DS+GNT    +   + YLV+SN++   + +L  L
Sbjct: 120 CYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNI---HDKL-HL 175

Query: 180 QSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSI-VEKQDEDTIISECFKLSSTCS 238
           QS          + S  E WGK+K G  +++  V  +  + K+D   +I  CFKL+ST  
Sbjct: 176 QSQ--------DINSGPEEWGKIKKGKQIMEEFVKTNTNLGKED---VIENCFKLASTNL 224

Query: 239 V--TVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTY 296
           +   + +     ++  +  ETI V PL     +++G+ L  G+YYGTRSQIV+L+ +   
Sbjct: 225 ILDKITEEFDLVKSLGVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKT 284

Query: 297 EVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330
           +  F E +IY+SD DI  +S +NPKE +R+++ +
Sbjct: 285 KATFIERIIYSSDQDISLYSTSNPKEELRYEYDI 318

>SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 298

 Score =  263 bits (672), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 137/332 (41%), Positives = 198/332 (59%), Gaps = 36/332 (10%)

Query: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60
           MCILL TTAHP Y LILISNRDEF +R+TH +C H+DDFI+SP+DM+   K    + FGT
Sbjct: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTK---GRNFGT 57

Query: 61  WLGINKDGKIATVXXXXXXXXXXXXQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNFTK 120
           W G+NKDGK+A +             +  P+SRG++P  +L+    D F  WD Y+ F+ 
Sbjct: 58  WCGVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVD-FNNWDSYEKFSH 116

Query: 121 KYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFTCNGQLGELQ 180
            YPG++ TG+FNLFYGD  + +Y+++ S+  T     ++  Y+VVSND            
Sbjct: 117 HYPGIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSND------------ 164

Query: 181 SNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSS--TCS 238
                      L S  + WGK+ L   LL++LV  S+ + +D  +I+ +CFKL+S  TCS
Sbjct: 165 -----------LISSKKKWGKISLAKNLLRNLVESSVDDTKD--SILDKCFKLASHSTCS 211

Query: 239 VTVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTYEV 298
             +       ++ ++ NETI VPPL  +   D+  S+P G+YYGTRSQIVIL+ +   ++
Sbjct: 212 EKI-----VVKHESVTNETIYVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKM 266

Query: 299 KFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330
            F E V+YT D D+  + P NPKE + F+F +
Sbjct: 267 TFVERVLYTCDEDVLKYGPKNPKEQIEFEFDI 298

>KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON}
           Anc_3.487 YGR127W
          Length = 313

 Score =  251 bits (640), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 136/335 (40%), Positives = 193/335 (57%), Gaps = 27/335 (8%)

Query: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60
           MCILL T  HPDY+L+LISNRDEF +R TH + WH+ D+ILSPYDM K      K V GT
Sbjct: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60

Query: 61  WLGINKDGKIATVXXXXXXXXXXXXQLVAP---KSRGMLPFVYLSDMTEDSFAEWDGYDN 117
           W+G+N+ G+++TV                P   +SRG++PF++LSD       +WD ++ 
Sbjct: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSD--RGFIDQWDSFEK 118

Query: 118 FTKKYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLN-SNCQYLVVSNDVFTCNGQL 176
           F  +YP L+ +GDFNLF GD++++ Y+++DS GNT S LN +    +VVSND +      
Sbjct: 119 FRDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDTYK----- 173

Query: 177 GELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSST 236
            E   N             I  W KVKLG   L  LVN ++    D+ + I +CF  +S 
Sbjct: 174 -EFNEN------------DISEWNKVKLGKLKLHELVNTAV--NLDKSSFIDKCFHAASF 218

Query: 237 CSVTVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTY 296
           CS+  + H    +   + + TI VPPL+C+   DVG +   G Y+GTRSQ+V L+ +   
Sbjct: 219 CSIE-KSHEDISKTPEVISNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRR 277

Query: 297 EVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTLN 331
           +V  AE +++TSD D    SP NPKE  +F F L+
Sbjct: 278 QVTVAERILHTSDLDRDFNSPHNPKEVKQFTFDLS 312

>Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}
           complement(28899..29831) [933 nt, 311 aa]
          Length = 310

 Score =  249 bits (635), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 141/335 (42%), Positives = 197/335 (58%), Gaps = 30/335 (8%)

Query: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDF--ILSPYDMAKECKYNDKKVF 58
           MCILLA+  HP+Y+LILISNRDEFLQR+TH +CW+  ++  IL PYDM+K  + N  K+ 
Sbjct: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNKI- 59

Query: 59  GTWLGINKDGKIATVXXXXXXXXXXXXQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNF 118
           GTW GIN+ G+++T+                 KSRG LP  +L +   DS   WD Y+ F
Sbjct: 60  GTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKF 119

Query: 119 TKKYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFTCNGQLGE 178
            K+YP ++ TGDFN FYGDV+  +Y ++DSIG+T   L  +  YLV+SND F        
Sbjct: 120 VKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDNPYLVISNDKFG------- 172

Query: 179 LQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSSTCS 238
                K  GK        + W K+ L   LL+ L    + E   ED +I +CF ++ST +
Sbjct: 173 -----KSNGKS------TKEWEKITLAKNLLKHL---PLCET--EDDLIHKCFDIASTNT 216

Query: 239 VTVEDHCKFHQNSTLPNETILVPPLRCKITDD---VGTSLPIGEYYGTRSQIVILIKRGT 295
           +  ED  K      L  ETILVPPL     ++   +G SLPIG+YYGTRSQIVIL+ +  
Sbjct: 217 LN-EDLIKDVDVRELMTETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNR 275

Query: 296 YEVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330
            +VKF E ++Y SD D+ T   ++P + + ++FT+
Sbjct: 276 TKVKFIERILYNSDDDVTTQKLSSPIQDLTYNFTI 310

>KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 306

 Score =  241 bits (615), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 132/334 (39%), Positives = 192/334 (57%), Gaps = 34/334 (10%)

Query: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60
           MCIL AT AHPDY+LIL+SNRDEF +RKTH +CW++D FILSPYDMA E K    + +GT
Sbjct: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIEKK---GQGYGT 57

Query: 61  WLGINKDGKIATVXXXXXXXXXXXXQLVA---PKSRGMLPFVYLSDMTEDSFAEWDGYDN 117
           WLGIN+ G+IA +             ++    P+SRG++P  +L       F  WD ++ 
Sbjct: 58  WLGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEK 117

Query: 118 FTKKYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFTCNGQLG 177
           F  ++  L+ TG F LFYGD K  +Y ++D + ++ +      +++V+SND+F C   +G
Sbjct: 118 FNGQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPF-EKMEHMVISNDIFHC--AVG 174

Query: 178 ELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSSTC 237
           E  S                 W K + G  LL +L   +    ++E  ++ +CF+L S  
Sbjct: 175 EHTSR----------------WNKTEYGYVLLDALAKNTTGIAKEE--LLQKCFELLSNH 216

Query: 238 SVTVEDHCKFHQNSTLPNETILVPPLRC-KITDDVGTSLPIGEYYGTRSQIVILIKRGTY 296
           +    +        ++   +I VPPLR  K  D +GTSLPIG+YYGTRSQIVIL+ +   
Sbjct: 217 TFNEGEDV-----DSVTTSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKDN- 270

Query: 297 EVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330
            V + EHVIY SD D +T+S  +PKE ++F F +
Sbjct: 271 RVTYEEHVIYESDEDCETYSFMDPKEVIQFQFNM 304

>TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3.487
           YGR127W
          Length = 310

 Score =  234 bits (596), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 131/335 (39%), Positives = 180/335 (53%), Gaps = 28/335 (8%)

Query: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60
           MCIL+AT+ HP Y+L+L+SNRDE+  RK   + W  D+F+L P D   +    D    GT
Sbjct: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSSGED---LGT 57

Query: 61  WLGINKDGKIATVXXXXXXXXXXXXQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNFTK 120
           W+G N+DGKI TV              V P+SRG +P  +LS    + F +WD YD F  
Sbjct: 58  WIGANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGAN-FKDWDTYDKFCH 116

Query: 121 KYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLN-SNCQYLVVSNDVFTCNGQLGEL 179
           ++ GL+ T DFN FYGD     YR++DS+GNT   L  +N +Y+VVSND+F      GE 
Sbjct: 117 QFQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQ-----GES 171

Query: 180 QSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSSTCSV 239
             N                W K+ L    L  LV +      DED  I ECF ++S    
Sbjct: 172 NKN--------------RVWDKISLADQALHHLVRE--FNDTDEDKFIQECFGIASINPF 215

Query: 240 -TVEDHCKFHQNST-LPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTYE 297
            +  DH  ++  +  L  +T+ VPPL+    D +G S+PIGEYYGTRSQ VIL+ +    
Sbjct: 216 HSKHDHGNYYMKAVELSMQTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSH 275

Query: 298 VKFAEHVIYTSDSDIKTFSPANPKETVRFDFTLNR 332
           + + E +I+ SD D   +S  + KE  R+DF L R
Sbjct: 276 ITYVERIIHDSDLDALQYSRDHYKEQKRYDFDLPR 310

>TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.487
           YGR127W
          Length = 314

 Score =  232 bits (591), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 128/339 (37%), Positives = 187/339 (55%), Gaps = 35/339 (10%)

Query: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDF--ILSPYDMAKECKYNDKKVF 58
           MCIL  T +HPDYELILISNRDEFLQRKT  SCW+      +L PYD+++     D   F
Sbjct: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSR--NETDPSKF 58

Query: 59  GTWLGINKDGKIATVXXXXXXXXXXXXQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNF 118
           GTW GIN+ G++++V            + V  KSRG LP  +L +  E+SF +W+ Y  F
Sbjct: 59  GTWCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKF 118

Query: 119 TKKYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQ----YLVVSNDVFTCNG 174
            K+YP L+ TG FNLF GDVK+++Y ++DS G T   L+   +     +V+SN  F  N 
Sbjct: 119 LKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEFISND 178

Query: 175 QLGELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLS 234
           +                     E W K+  G  L+   ++K I   +DE+++I  CFK++
Sbjct: 179 K---------------------ERWHKISNGEKLMDEFLSKDI---RDENSVIESCFKIA 214

Query: 235 STCSVTVEDHCKFHQNSTLPNETILVPPLRCK---ITDDVGTSLPIGEYYGTRSQIVILI 291
           ST  +T E          L  ET+ VPP++ +     D++G SLP+G++YGTRSQIVIL+
Sbjct: 215 STSELTNEYLHSHDDILDLMTETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILV 274

Query: 292 KRGTYEVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330
            +    V++ E V+Y  D D+       P   + F++ +
Sbjct: 275 NKERTTVRYMERVLYECDDDVSKAGIEKPINELNFEYNI 313

>Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON}
           similar to Ashbya gossypii AFR305W
          Length = 311

 Score =  214 bits (545), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 119/334 (35%), Positives = 181/334 (54%), Gaps = 28/334 (8%)

Query: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKK---- 56
           MCILLATT HPDY+LILISNRDEF +R+TH +CWH D  IL+PYD++     +D      
Sbjct: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60

Query: 57  VFGTWLGINKDGKIATVXXXXXXXXXXXXQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYD 116
            +GTWLGIN+ G ++ +                 KSRG +   +L D++  ++ +W+ Y+
Sbjct: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE 120

Query: 117 NFTKKYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFTCNGQL 176
            F++ +  L  T  F LFYGD+K   + ++DS   +++  +S   Y+V+SN    C    
Sbjct: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVNC---- 176

Query: 177 GELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSST 236
                  + EG +         W KV  G  LL+ LV  ++     ++ ++ +CF+L+ T
Sbjct: 177 -------EDEGPR---------WKKVVEGEQLLKELVKGNL--NVSKEHLLQKCFELAGT 218

Query: 237 CSVTVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTY 296
               V    +   +++LP +TI VP L+      +G S  +GEYYGTR+ IVIL+    +
Sbjct: 219 SQFDVNGVIQV-TDTSLPEKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVDNFNH 277

Query: 297 EVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330
            V   EHVI+ SD DI   S  NPK  V ++F +
Sbjct: 278 -VTMHEHVIHDSDKDIGLSSAMNPKTKVAYEFDI 310

>KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} similar
           to uniprot|P53275 Saccharomyces cerevisiae YGR127W
           Hypothetical ORF
          Length = 300

 Score =  209 bits (533), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 117/331 (35%), Positives = 176/331 (53%), Gaps = 33/331 (9%)

Query: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60
           MCIL+A+ AHP Y LI ISNRDEF +RKT  +C ++DD+ILSP D A   + N+K   GT
Sbjct: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTA--LRSNNKPALGT 58

Query: 61  WLGINKDGKIATVXXXXXXXXXXXXQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNFTK 120
           W G+N+ G++A +             + +P SRG +P  YL D    +  +W+ ++ F  
Sbjct: 59  WCGVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMDRGPST--DWNSFEKFVS 116

Query: 121 KYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFTCNGQLGELQ 180
           KYP + +  +FN+FYGD    +Y  +DS+G +   L +N   LV+SND    + +     
Sbjct: 117 KYPQI-TECEFNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSNDHIDSSSR----- 170

Query: 181 SNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSSTCSVT 240
                             W KV+    LLQ LV  S  +   E+ +I +CF L+S     
Sbjct: 171 ------------------WPKVQKADILLQELVQSS--QHDSEEELIEKCFALASNTEPA 210

Query: 241 VEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTYEVKF 300
             D+    + +     +I +PP+      DVG SLP G +YGTRSQIVIL+KR    + F
Sbjct: 211 EIDNSDKEEFTC---SSIFIPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISF 267

Query: 301 AEHVIYTSDSDIKTFSPANPKETVRFDFTLN 331
            E V++ SD ++   S  +PKE ++F+  ++
Sbjct: 268 TERVLHDSDFEVPLHSEKHPKEKLQFNLHVD 298

>Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W -
           Hypothetical ORF [contig 131] FULL
          Length = 303

 Score =  208 bits (530), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 120/328 (36%), Positives = 180/328 (54%), Gaps = 38/328 (11%)

Query: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60
           MCILLA++AHP Y LILISNRDEF++R+T  +C ++DD+++SP DM    K N++   GT
Sbjct: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMT--LKDNNEPNLGT 58

Query: 61  WLGINKDGKIATVXXXXX--XXXXXXXQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNF 118
           W G N++G+IA +              ++V   SRG +   YL+D  +   ++W+ Y  F
Sbjct: 59  WCGANRNGRIAVILNLRTGNTNQTKTKRIV---SRGNVTMRYLTD--KQPASDWNSYAKF 113

Query: 119 TKKYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFTCNGQLGE 178
             K P ++S  +FN+FYGD K   Y  +DS G++   L S   YLV+SND          
Sbjct: 114 ASKCPDIKSC-EFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNPYLVISND---------S 163

Query: 179 LQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSSTCS 238
           ++S  K              W K++L   L++ LV  S+     ED +++ CF L+S   
Sbjct: 164 IESATK--------------WPKIELAEKLMRDLVRDSV--NDSEDDLLARCFSLASHKQ 207

Query: 239 VTVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTYEV 298
               DH        + +  I VPPL    ++D+G S+P G +YGTRSQIV+L+ +    +
Sbjct: 208 DYNVDH---MDKEKVTSSNIFVPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSI 264

Query: 299 KFAEHVIYTSDSDIKTFSPANPKETVRF 326
           +F EHV+Y SD +   F  ANPK+ V +
Sbjct: 265 RFVEHVLYDSDPETTHFCAANPKKCVSY 292

>AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR127W
          Length = 309

 Score =  194 bits (492), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 117/332 (35%), Positives = 166/332 (50%), Gaps = 28/332 (8%)

Query: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECK--YNDKKVF 58
           MCIL ATTAHP Y+L+LISNRDE+  RKTHT+CW ++D IL+PYDMA +     +     
Sbjct: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60

Query: 59  GTWLGINKDGKIATVXXXXXXXXXXXXQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNF 118
           GTW+GIN+ G ++ +                  SRG +   YL D   +++  W+ Y+ F
Sbjct: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYEKF 120

Query: 119 TKKYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFTCNGQLGE 178
              +P L  T  F  FYGDV   Q+ +++S+G T+    S   Y VVSN        LG+
Sbjct: 121 GAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPF-SQSPYYVVSNGPSDGAKALGQ 179

Query: 179 LQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSSTCS 238
                               W KV  G  L + ++ +S+   ++E  ++  CF L+S   
Sbjct: 180 --------------------WPKVVEGNQLFKKMIQESLDVSEEE--LLQRCFNLASYSQ 217

Query: 239 VTVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTYEV 298
                    H +S +P  TI VP L   ++     S   G YYGTRS IV+L+      V
Sbjct: 218 YVSNQPIGVHDDS-IPKRTIFVPALY-NLSGQANLSFAAGMYYGTRSTIVMLVSEDG-NV 274

Query: 299 KFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330
              EHVI+ SD D+ ++S  NPKE V   F+L
Sbjct: 275 VTREHVIHDSDQDLDSYSILNPKEQVTHRFSL 306

>TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON}
           Anc_3.487 YGR127W
          Length = 318

 Score =  181 bits (458), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 115/333 (34%), Positives = 177/333 (53%), Gaps = 42/333 (12%)

Query: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYND------ 54
           MCILL TTAHP Y+LILISNRDE  +R+TH++CW+++  IL PYDM+K+  ++       
Sbjct: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60

Query: 55  KKVFGTWLGINKDGKIATVXXXXXXXXXXXXQLV--APKSRGMLPFVYLSDMTEDSFAEW 112
           K   GTW G+NKDGKI TV                 + +SRG++P  YL D  +  F +W
Sbjct: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNSLQSRGLIPIKYLCDF-DHGFQDW 119

Query: 113 DGYDNFTKKYPGLQS-TGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFT 171
           + YD F ++   +    G FNLF GD+K  +Y I++S+G +   L+    Y+VVSN  + 
Sbjct: 120 NTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPYMVVSNINWG 179

Query: 172 CNGQLGELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSI-VEKQDEDTIISEC 230
              ++GE                    W K+K G  LL++L+N  +    +DE  I+ +C
Sbjct: 180 DPKKMGE--------------------WSKIKNGIKLLETLINDKLDNSNKDELEILEDC 219

Query: 231 FKLSSTCSVTVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIG----------EY 280
           F++SST +++ +      +      + I VPPL+ +   +V                 +Y
Sbjct: 220 FQISSTINLSGKKIDGNIERLEQTKDLIFVPPLK-RSEGEVRGDAGGDAGGDAGGESVKY 278

Query: 281 YGTRSQIVILIKRGTYEVKFAEHVIYTSDSDIK 313
           YGTRSQIV+L +R + +V F E +++  + D K
Sbjct: 279 YGTRSQIVVLCERKSNKVTFVERILHCKNEDAK 311

>ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 276

 Score =  169 bits (429), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 98/279 (35%), Positives = 149/279 (53%), Gaps = 30/279 (10%)

Query: 58  FGTWLGINKDGKIATVXXXXXXXXXXXXQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDN 117
           FGTW GINKDG++ TV              +   SRG +P  +LS    D + +W+ Y+ 
Sbjct: 23  FGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQHDLD-WEQWNSYNK 81

Query: 118 FTKKYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSN-----CQYLVVSNDVFTC 172
           F  ++  L +TGDFN FYGD K  QY+I+DS+  T   L +N       Y+VVSNDV+  
Sbjct: 82  FANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVYRY 141

Query: 173 NGQLGELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFK 232
            G+                     ETW KV+L    L+ L+  ++ E  D+D+ IS+CF+
Sbjct: 142 QGE---------------------ETWPKVQLAKKNLRKLIEDNVNE--DQDSFISKCFQ 178

Query: 233 LSSTCSVTVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIK 292
           ++ST         +  ++S +  ++I VPPL+     ++GT+   G +YGTRSQIV+L+ 
Sbjct: 179 VASTSPGLDWQSEELLKSSDVTKQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVS 237

Query: 293 RGTYEVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTLN 331
           +   +V F E V++ SD  +   SP +P E ++F F LN
Sbjct: 238 KDRQKVTFVERVLHNSDEQVSQRSPDHPAEQLKFQFDLN 276

>YOL125W Chr15 (83834..85264) [1431 bp, 476 aa] {ON}
           TRM132'-O-methyltransferase responsible for modification
           of tRNA at position 4; C-terminal domain has similarity
           to Rossmann-fold (RFM) superfamily of RNA
           methyltransferases
          Length = 476

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 273 TSLPIGEYYGTRSQIVILIKRGTYEVKFAEHVIYTSDSDIKTFSPANP 320
           TSLP  E+ G+ S   +LI R T  +KF +  I    S+IK+ SP+ P
Sbjct: 225 TSLP-AEHSGSNSNEFVLIDRATNRMKF-DKKIKDDFSEIKSNSPSKP 270

>KLTH0H03586g Chr8 complement(326294..327442) [1149 bp, 382 aa] {ON}
           weakly similar to uniprot|P53122 Saccharomyces
           cerevisiae YGL138C Hypothetical ORF
          Length = 382

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 38/92 (41%), Gaps = 12/92 (13%)

Query: 193 QSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSSTCSVTVEDHCKFHQNST 252
           Q     WG +K G     ++   S+ E   +DT    CFK++       E + K   +  
Sbjct: 160 QGHSRIWGALKKGNRNQDTVKGPSLKELARQDTANFHCFKMARR-----EKYTKRSTSIY 214

Query: 253 LPNETI-------LVPPLRCKITDDVGTSLPI 277
           LPNE +       L P  + ++ D +G  L I
Sbjct: 215 LPNEWVGGLFYCDLTPDGKSRLLDQMGDDLHI 246

>KLLA0E05281g Chr5 (467253..472520) [5268 bp, 1755 aa] {ON} similar
           to uniprot|P25386 Saccharomyces cerevisiae YDL058W USO1
           involved intracellular protein transport coiled-coil
           protein necessary for protein transport from ER to Golgi
           Integrin analogue gene
          Length = 1755

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 51/105 (48%), Gaps = 7/105 (6%)

Query: 165 VSNDVFTCNGQLGELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDED 224
           +S ++FT   + G+L+ ++K   K+  +Q K     K    TA L+  + +   E Q+  
Sbjct: 829 MSRELFTLTKENGKLKEDLKSHSKKLEIQEK-----KYSSETANLEKQLKERGTEVQELR 883

Query: 225 TIISECFKLSSTC--SVTVEDHCKFHQNSTLPNETILVPPLRCKI 267
             ISE  K   T   +VT+  + K    + L N+T L+P L  K+
Sbjct: 884 ERISEDIKRIDTLEKNVTILSNQKIELETKLSNQTSLIPKLTEKL 928

>KNAG0F02190 Chr6 (418793..422137) [3345 bp, 1114 aa] {ON} Anc_6.176
           YGL094C
          Length = 1114

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 56/140 (40%), Gaps = 24/140 (17%)

Query: 130 DFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVS------NDVFTCNGQLGELQSNI 183
           +    Y  + R + R+  S  N  STLNS  ++          N    C+ Q  E+   I
Sbjct: 555 ELGYLYDMMNRSKGRVCRST-NFQSTLNSIPEFKAAGLGCSGFNYPVECSNQTTEVSDAI 613

Query: 184 KREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSSTCSVTVED 243
                     S ++ + K+ LG  L      K   E  D +T + +CF L  T +  +  
Sbjct: 614 -------STMSTVQKFNKLLLGRLL------KEEFEGMDHNTTLEQCFGL--TVNSEIRS 658

Query: 244 HCKFHQNSTL--PNETILVP 261
            C  +Q  T+  P+ T+L P
Sbjct: 659 KCNHYQKETMVVPSLTVLSP 678

>CAGL0I08943g Chr9 (867666..869474) [1809 bp, 602 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae YFR023w PES4
           DNA-directed DNA polymerase epsilon suppressor
          Length = 602

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 105 TEDSFAEWDGYDNFTKKYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTV 153
            +D+ +   GY NF  K    ++T DFN  Y  +  K+ RIM SI ++V
Sbjct: 99  ADDNRSLGHGYINFGNKEDAERATEDFN--YNKIMGKEIRIMPSIRDSV 145

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,973,453
Number of extensions: 1536747
Number of successful extensions: 3710
Number of sequences better than 10.0: 28
Number of HSP's gapped: 3709
Number of HSP's successfully gapped: 28
Length of query: 332
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 222
Effective length of database: 40,868,139
Effective search space: 9072726858
Effective search space used: 9072726858
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)